


| Basic Information | |
|---|---|
| Family ID | F072374 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAENTDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEE |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 82.64 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 82.64 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (31.405 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (12.397 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.463 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.736 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF12322 | T4_baseplate | 80.17 |
| PF06841 | Phage_T4_gp19 | 6.61 |
| PF08007 | JmjC_2 | 4.13 |
| PF16075 | DUF4815 | 0.83 |
| PF01501 | Glyco_transf_8 | 0.83 |
| PF01592 | NifU_N | 0.83 |
| PF06714 | Gp5_OB | 0.83 |
| PF11246 | Phage_gp53 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 4.13 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1442 | Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG5597 | N-acetylglucosaminyl transferase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.60 % |
| Unclassified | root | N/A | 31.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000928|OpTDRAFT_10014753 | All Organisms → Viruses → Predicted Viral | 3794 | Open in IMG/M |
| 3300001472|JGI24004J15324_10021041 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2211 | Open in IMG/M |
| 3300005510|Ga0066825_10221401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300006404|Ga0075515_10735567 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300006737|Ga0098037_1125942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 873 | Open in IMG/M |
| 3300006789|Ga0098054_1198486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 732 | Open in IMG/M |
| 3300006874|Ga0075475_10372558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 578 | Open in IMG/M |
| 3300007539|Ga0099849_1249177 | Not Available | 653 | Open in IMG/M |
| 3300007667|Ga0102910_1170553 | Not Available | 515 | Open in IMG/M |
| 3300007725|Ga0102951_1084552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 906 | Open in IMG/M |
| 3300008964|Ga0102889_1192189 | All Organisms → Viruses | 594 | Open in IMG/M |
| 3300009001|Ga0102963_1036719 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300009001|Ga0102963_1081966 | All Organisms → Viruses → Predicted Viral | 1321 | Open in IMG/M |
| 3300009027|Ga0102957_1087525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1079 | Open in IMG/M |
| 3300009071|Ga0115566_10049151 | All Organisms → Viruses → Predicted Viral | 2876 | Open in IMG/M |
| 3300009077|Ga0115552_1085024 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300009080|Ga0102815_10383661 | Not Available | 780 | Open in IMG/M |
| 3300009433|Ga0115545_1286385 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED277 | 549 | Open in IMG/M |
| 3300009445|Ga0115553_1131591 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300009472|Ga0115554_1026636 | All Organisms → Viruses → Predicted Viral | 2877 | Open in IMG/M |
| 3300009476|Ga0115555_1118975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED65 | 1124 | Open in IMG/M |
| 3300009498|Ga0115568_10299510 | Not Available | 712 | Open in IMG/M |
| 3300009508|Ga0115567_10866913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 537 | Open in IMG/M |
| 3300009550|Ga0115013_10681726 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 696 | Open in IMG/M |
| 3300009592|Ga0115101_1585304 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED277 | 544 | Open in IMG/M |
| 3300009593|Ga0115011_10450789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1012 | Open in IMG/M |
| 3300009677|Ga0115104_10305323 | All Organisms → Viruses | 2239 | Open in IMG/M |
| 3300009677|Ga0115104_10340251 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300009677|Ga0115104_10659397 | All Organisms → Viruses → Predicted Viral | 1554 | Open in IMG/M |
| 3300009677|Ga0115104_11298840 | Not Available | 570 | Open in IMG/M |
| 3300010149|Ga0098049_1000172 | All Organisms → cellular organisms → Bacteria | 25929 | Open in IMG/M |
| 3300010149|Ga0098049_1078552 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300010150|Ga0098056_1104115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 968 | Open in IMG/M |
| 3300010151|Ga0098061_1345533 | Not Available | 506 | Open in IMG/M |
| 3300011311|Ga0138370_1102165 | Not Available | 823 | Open in IMG/M |
| 3300012920|Ga0160423_10057315 | Not Available | 2815 | Open in IMG/M |
| 3300012920|Ga0160423_10068185 | All Organisms → Viruses → Predicted Viral | 2549 | Open in IMG/M |
| 3300012920|Ga0160423_10084450 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2257 | Open in IMG/M |
| 3300012920|Ga0160423_10283644 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1142 | Open in IMG/M |
| 3300012920|Ga0160423_10395577 | Not Available | 945 | Open in IMG/M |
| 3300012920|Ga0160423_10853826 | Not Available | 611 | Open in IMG/M |
| 3300012920|Ga0160423_11045755 | Not Available | 546 | Open in IMG/M |
| 3300012920|Ga0160423_11164500 | Not Available | 515 | Open in IMG/M |
| 3300012928|Ga0163110_10081182 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2122 | Open in IMG/M |
| 3300012936|Ga0163109_10101680 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2105 | Open in IMG/M |
| 3300012936|Ga0163109_10273452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED65 | 1238 | Open in IMG/M |
| 3300012952|Ga0163180_10344304 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300012954|Ga0163111_10606161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 1023 | Open in IMG/M |
| 3300016739|Ga0182076_1373538 | Not Available | 537 | Open in IMG/M |
| 3300016771|Ga0182082_1120240 | Not Available | 720 | Open in IMG/M |
| 3300017713|Ga0181391_1065604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED65 | 841 | Open in IMG/M |
| 3300017719|Ga0181390_1123071 | Not Available | 674 | Open in IMG/M |
| 3300017725|Ga0181398_1009399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2511 | Open in IMG/M |
| 3300017732|Ga0181415_1148732 | Not Available | 523 | Open in IMG/M |
| 3300017748|Ga0181393_1175981 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED277 | 526 | Open in IMG/M |
| 3300017750|Ga0181405_1024030 | All Organisms → Viruses → Predicted Viral | 1680 | Open in IMG/M |
| 3300017768|Ga0187220_1070579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1051 | Open in IMG/M |
| 3300017773|Ga0181386_1255387 | Not Available | 517 | Open in IMG/M |
| 3300017782|Ga0181380_1031352 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300017782|Ga0181380_1138662 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 832 | Open in IMG/M |
| 3300017782|Ga0181380_1178227 | Not Available | 717 | Open in IMG/M |
| 3300017949|Ga0181584_10011948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 6416 | Open in IMG/M |
| 3300017950|Ga0181607_10101517 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300017956|Ga0181580_10075965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2496 | Open in IMG/M |
| 3300017967|Ga0181590_10366011 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300018424|Ga0181591_10121823 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300018426|Ga0181566_10140631 | Not Available | 1818 | Open in IMG/M |
| 3300019282|Ga0182075_1461820 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300019282|Ga0182075_1493985 | Not Available | 1420 | Open in IMG/M |
| 3300020014|Ga0182044_1064481 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED277 | 539 | Open in IMG/M |
| 3300020174|Ga0181603_10146511 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300020176|Ga0181556_1274780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 590 | Open in IMG/M |
| 3300020340|Ga0211594_1136579 | Not Available | 512 | Open in IMG/M |
| 3300020421|Ga0211653_10237888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED65 | 795 | Open in IMG/M |
| 3300020436|Ga0211708_10021563 | All Organisms → Viruses → Predicted Viral | 2445 | Open in IMG/M |
| 3300020436|Ga0211708_10428655 | Not Available | 542 | Open in IMG/M |
| 3300020438|Ga0211576_10207845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1040 | Open in IMG/M |
| 3300020451|Ga0211473_10111843 | All Organisms → Viruses → Predicted Viral | 1398 | Open in IMG/M |
| 3300020452|Ga0211545_10406959 | Not Available | 618 | Open in IMG/M |
| 3300020459|Ga0211514_10624835 | Not Available | 526 | Open in IMG/M |
| 3300021356|Ga0213858_10010970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 4284 | Open in IMG/M |
| 3300021368|Ga0213860_10051167 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300021371|Ga0213863_10306199 | Not Available | 664 | Open in IMG/M |
| 3300021373|Ga0213865_10033310 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
| 3300021373|Ga0213865_10358850 | Not Available | 659 | Open in IMG/M |
| 3300021375|Ga0213869_10109296 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300021379|Ga0213864_10274945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 855 | Open in IMG/M |
| 3300021957|Ga0222717_10209798 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300021958|Ga0222718_10104235 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300021959|Ga0222716_10341110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 890 | Open in IMG/M |
| 3300021959|Ga0222716_10714570 | Not Available | 530 | Open in IMG/M |
| 3300021961|Ga0222714_10459167 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED181 | 661 | Open in IMG/M |
| 3300021962|Ga0222713_10558151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 675 | Open in IMG/M |
| 3300022068|Ga0212021_1132914 | Not Available | 508 | Open in IMG/M |
| 3300023081|Ga0255764_10256024 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300023116|Ga0255751_10124175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1560 | Open in IMG/M |
| 3300025083|Ga0208791_1049605 | Not Available | 735 | Open in IMG/M |
| 3300025137|Ga0209336_10098741 | All Organisms → Viruses | 828 | Open in IMG/M |
| 3300025168|Ga0209337_1066835 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300025680|Ga0209306_1151377 | Not Available | 658 | Open in IMG/M |
| 3300025685|Ga0209095_1086879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1012 | Open in IMG/M |
| 3300025696|Ga0209532_1192881 | Not Available | 588 | Open in IMG/M |
| 3300025699|Ga0209715_1103499 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300025719|Ga0209252_1058795 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
| 3300025769|Ga0208767_1081797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED65 | 1356 | Open in IMG/M |
| 3300025769|Ga0208767_1279964 | Not Available | 502 | Open in IMG/M |
| 3300025830|Ga0209832_1074186 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300025876|Ga0209223_10432906 | Not Available | 552 | Open in IMG/M |
| 3300025881|Ga0209309_10494108 | All Organisms → Viruses | 509 | Open in IMG/M |
| 3300025892|Ga0209630_10095830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED65 | 1614 | Open in IMG/M |
| 3300025897|Ga0209425_10049064 | All Organisms → Viruses → Predicted Viral | 2831 | Open in IMG/M |
| 3300025897|Ga0209425_10194621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1088 | Open in IMG/M |
| 3300026495|Ga0247571_1123302 | Not Available | 606 | Open in IMG/M |
| 3300027906|Ga0209404_10131313 | Not Available | 1508 | Open in IMG/M |
| 3300028196|Ga0257114_1066308 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
| 3300031510|Ga0308010_1249657 | Not Available | 624 | Open in IMG/M |
| 3300031628|Ga0308014_1029946 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1388 | Open in IMG/M |
| 3300031773|Ga0315332_10935456 | Not Available | 518 | Open in IMG/M |
| 3300032032|Ga0315327_10468154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 785 | Open in IMG/M |
| 3300032047|Ga0315330_10028263 | All Organisms → Viruses → Predicted Viral | 3773 | Open in IMG/M |
| 3300032136|Ga0316201_11097185 | Not Available | 667 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.40% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 12.40% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.74% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 10.74% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 9.92% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.09% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 6.61% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 4.13% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.48% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.48% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.48% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.65% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.83% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.83% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.83% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.83% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.83% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300006404 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300011311 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 DCM_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016739 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019282 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020340 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555960-ERR599119) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025719 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026495 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OpTDRAFT_100147531 | 3300000928 | Freshwater And Marine | MAEGTDNSRNEVEIDLDKYMALIEKLDASEDMIKEMQVEAAAAKKR |
| JGI24004J15324_100210414 | 3300001472 | Marine | MSEESKDTSKNEVEIDLDKYMALIEKLDAQEDVIKEMKEDAIKARNGLEP |
| Ga0066825_102214013 | 3300005510 | Marine | MAEGVDNSRNEVEIDLDKYMALIEKLDKSEDTIKEMKAEAEAARKQ |
| Ga0075515_107355671 | 3300006404 | Aqueous | MAEGQDNSRNEVEIDLDKYMALIEKLDAAEDTIAEMQDEAKKAREQ |
| Ga0098037_11259421 | 3300006737 | Marine | MASRRDRDRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEEARKAR |
| Ga0098054_11984863 | 3300006789 | Marine | MAEGTDSSRNEVEIDLDKYMALIDKLDTAEDTIAEMQEEARKVKDR |
| Ga0075475_103725583 | 3300006874 | Aqueous | MAEGQDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEEAKKAR |
| Ga0099849_12491773 | 3300007539 | Aqueous | MAEGQDNSRNEVEIDLDKYMALIDKLDKSEDMIKEMQLEAAEA |
| Ga0102910_11705531 | 3300007667 | Estuarine | MADNTDNSKNEVEIDLDKYMALIEKLDAQEDVIKE |
| Ga0102951_10845523 | 3300007725 | Water | MAENTDNSRNEVEIDLDKYMAMIEKLDEQEDQIREM |
| Ga0102889_11921891 | 3300008964 | Estuarine | MADNQDNSRNEVEIDLDKYMAMIEKLDEQEDAIKEMKEEA |
| Ga0102963_10367194 | 3300009001 | Pond Water | MAENTDNSRNEVEIDLDKYMAMIEKLDEQEDQIREMKEEAKKARDQLSP |
| Ga0102963_10819661 | 3300009001 | Pond Water | MADEKDYKDQSSNEVEIDLDKYMALIEKLDEQEDVIKEMKEDAIKAK |
| Ga0102957_10875253 | 3300009027 | Pond Water | MAETDNSRNEVEIDLDKYMAMIEKLDEQEDKIKDMQEEARKARDQLSP |
| Ga0115566_100491515 | 3300009071 | Pelagic Marine | MAEETKDMSSNEVEIDLDKYMALIEKLDEQEDVIREMKEDAIKAKRGLEPP |
| Ga0115552_10850241 | 3300009077 | Pelagic Marine | MAENTDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEEAKKARD |
| Ga0102815_103836612 | 3300009080 | Estuarine | MAEETKDMSSNEVEIDLDKYMALIEKLDEQEDIIKEM |
| Ga0115545_12863851 | 3300009433 | Pelagic Marine | MAEGSDNSRNEVEIDLDKYMALIEKLDKSEDMIKE |
| Ga0115553_11315911 | 3300009445 | Pelagic Marine | MAEETKDMSSNEVEIDLDKYMALIEKLDEQEDVIREM |
| Ga0115554_10266365 | 3300009472 | Pelagic Marine | MAEETKDMSSNEVEIDLDKYMALIEKLDEQEDVIREMKEDAIKAKRGLEPPKR |
| Ga0115555_11189754 | 3300009476 | Pelagic Marine | MAENTDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEEAK |
| Ga0115568_102995103 | 3300009498 | Pelagic Marine | MAENKDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEMKEEARQAAERLGPRK |
| Ga0115567_108669133 | 3300009508 | Pelagic Marine | MADNNTDNSRNEVEIDLDKYMALIDKLDKSEDMIKEMQLEAAEA |
| Ga0115013_106817262 | 3300009550 | Marine | MAENSDNSRNEVEIDLDKYMSLIDKLDKAEDTIVEMQEE |
| Ga0115101_15853042 | 3300009592 | Marine | MAEGTDNSRNEVEIDLDKYMALIEKLDKSEDMIKEMQLE |
| Ga0115011_104507893 | 3300009593 | Marine | MAEESKDTSRNEVEIDLEKYMALIDKLDAQEDVIREMKE |
| Ga0115104_103053235 | 3300009677 | Marine | MAENQDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEMKEEARQA |
| Ga0115104_103402514 | 3300009677 | Marine | MADNQDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEMKEEARQA |
| Ga0115104_106593973 | 3300009677 | Marine | MAKDNDSNEVEIDLDKYMALIEKLDEQEDQIKEMKED |
| Ga0115104_112988401 | 3300009677 | Marine | MAEETKDMSSNEVEIDLDKYMALIEKLDEQEDVIREMKEDAIKAK |
| Ga0098049_10001721 | 3300010149 | Marine | MAEGQDNSRNEVEIDLDKYMALIDKLDKSEDMIKEMQLEA |
| Ga0098049_10785522 | 3300010149 | Marine | MAEGQDNSRNEVEIDLDKYMALIDKLDKSEDMIKEMQ |
| Ga0098056_11041153 | 3300010150 | Marine | MADNQDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEMKEEARMAAEQLGPR |
| Ga0098061_13455333 | 3300010151 | Marine | MAEGTDSSRNEVEIDLDKYMALIDKLDTAEDTIAEMQEEARKV |
| Ga0138370_11021654 | 3300011311 | Marine | MADNNAQDNSRNEVEIDLDKYMSLIEKLDTAEDTIREMQLEAAEAKKRLA |
| Ga0160423_100573151 | 3300012920 | Surface Seawater | MAESQDNSRNEVEIDLDKYMSLIDKLDNAEDTIKEMQAEAAEAKK |
| Ga0160423_100681856 | 3300012920 | Surface Seawater | MAEEKDNSRNEVEIDLEKYMALLEQLDEQEDKIKEM |
| Ga0160423_100844505 | 3300012920 | Surface Seawater | MAENTDTSRNEVEIDLDKYMSLIDKLDEQEDKIKEMQEEAKKARDQ |
| Ga0160423_102836444 | 3300012920 | Surface Seawater | MAENTDTSRNEVEIDLDKYMSLIDKLDEQEDKIKEMQEEAKKARDQLAP |
| Ga0160423_103955773 | 3300012920 | Surface Seawater | MAENTDTSRNEVEIDLDKYMSLIDKLDEQEDKIKEMQEEAKKA |
| Ga0160423_108538261 | 3300012920 | Surface Seawater | MAEQDNSRNEVEIDLDKYMNLINKLDDAEDTIKAMQAEAAEAKKRLA |
| Ga0160423_110457552 | 3300012920 | Surface Seawater | MAENDNSRNEVEIDLDKYMNLINKLDDAEDTIKAMQAEAAEAKKRLA |
| Ga0160423_111645003 | 3300012920 | Surface Seawater | MAENTDTSRNEVEIDLDKYMSLIDKLDEQEDKIKEMQEEAKKARDQLAPPK |
| Ga0163110_100811821 | 3300012928 | Surface Seawater | MAENTDTSRNEVEIDLDKYMSLIDKLDEQEDKIKEMQEEAKKARD |
| Ga0163109_101016805 | 3300012936 | Surface Seawater | MAENTDTSRNEVEIDLDKYMSLIDKLDEQEDKIKEMQEEAK |
| Ga0163109_102734521 | 3300012936 | Surface Seawater | MAENVDNDRNEVEIDLDKYMSLIDKLDKAEDTIKD |
| Ga0163180_103443043 | 3300012952 | Seawater | MATIESDNSRNEVQIDLDKYMKLVDKLDAAEDLIE |
| Ga0163111_106061611 | 3300012954 | Surface Seawater | MAENTDTSRNEVEIDLDKYMSLIDKLDEQEDKIKEMQEEAKKAR |
| Ga0182076_13735381 | 3300016739 | Salt Marsh | MAEGTDSSRNEVEIDLDKYMALIEKFDNAEDTIKEMKDEAE |
| Ga0182082_11202402 | 3300016771 | Salt Marsh | MAEATTHDHDRNEVEIDLDKYMELINKLDAAEDTITAMK |
| Ga0181391_10656042 | 3300017713 | Seawater | MAETQDNSRNEVEIDLDKYMAMIEKLDEQEDQIKEMKDEAKR |
| Ga0181390_11230711 | 3300017719 | Seawater | MAENQDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEMKEEA |
| Ga0181398_10093996 | 3300017725 | Seawater | MAENQDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEMKE |
| Ga0181415_11487322 | 3300017732 | Seawater | MAEETKDMSSNEVEIDLDKYMALIEKLDEQEDVIREMQEDAIKAH |
| Ga0181393_11759811 | 3300017748 | Seawater | MAEGTDNSRNEVEIDLDKYMALIEKLDKSEDMIKE |
| Ga0181405_10240303 | 3300017750 | Seawater | MAKDNDSNEVEIDLDKYMALIEKLDEQEDQIKEMKEDAIAARN |
| Ga0187220_10705793 | 3300017768 | Seawater | MADNQDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEMKEEARQAAERLG |
| Ga0181386_12553872 | 3300017773 | Seawater | MAEESKTVDSRNEVEIDLEKYMALIEKLDEQEDVI |
| Ga0181380_10313521 | 3300017782 | Seawater | MAENQDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEMKEE |
| Ga0181380_11386622 | 3300017782 | Seawater | MAENQDNSRNEVEIDLDKYMAMIEKLDEQEDQIKDMK |
| Ga0181380_11782271 | 3300017782 | Seawater | MAETQDNSRNEVEIDLDKYMAMIEKLDEQEDQIKEMKDEAKRAR |
| Ga0181584_100119481 | 3300017949 | Salt Marsh | MAEGQDNSRNEVEIDLDKYMGLIDKLDKAEDTIKEMQLEA |
| Ga0181607_101015171 | 3300017950 | Salt Marsh | MAETDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQ |
| Ga0181580_100759651 | 3300017956 | Salt Marsh | MAEGQDNSRNEVEIDLDKYMGLIDKLDKAEDTIKEMQ |
| Ga0181590_103660112 | 3300017967 | Salt Marsh | MAEGQDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEEAKK |
| Ga0181591_101218234 | 3300018424 | Salt Marsh | MAEGQDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEM |
| Ga0181566_101406311 | 3300018426 | Salt Marsh | MSEATDNSRNEVQIDLDKYMRLVEKLDDAEDTIKL |
| Ga0182075_14618204 | 3300019282 | Salt Marsh | MAEGQDSSRNEVEIDLDKYMALIDKLDKAEDTIVEMQEEARKVKSQL |
| Ga0182075_14939855 | 3300019282 | Salt Marsh | MSEATDNSRNEVQIDLDKYMRLVEKLDDAEDTIKLLK |
| Ga0182044_10644811 | 3300020014 | Salt Marsh | MAEGTDNSRNEVEIDLDKYMALIEKLDNAEDTIKDMQA |
| Ga0181603_101465111 | 3300020174 | Salt Marsh | MAETDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQE |
| Ga0181556_12747803 | 3300020176 | Salt Marsh | MAEGQDNSRNEVEIDLDKYMSLIDKLDQAEDTIKDMQLEA |
| Ga0211594_11365793 | 3300020340 | Marine | MAESQDTSRNEVEIDLDKYMSLIDKLDEQEDKIKEMQEEAKKARDQLA |
| Ga0211653_102378881 | 3300020421 | Marine | MAENQDNDRNEVEIDLDKYMALIDKLDKSEDMIKE |
| Ga0211708_100215635 | 3300020436 | Marine | MAENTDTSRNEVEIDLDKYMSLIDKLDEQEDKIKE |
| Ga0211708_104286553 | 3300020436 | Marine | MAESKDTSRNEVEIDLDKYMSLIDKLDEQEDKIKE |
| Ga0211576_102078451 | 3300020438 | Marine | MADNQDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEMKEEARQ |
| Ga0211473_101118436 | 3300020451 | Marine | MAELETDNSRNEVQIDLDKYMKLVDKLDEAEDLIEK |
| Ga0211545_104069592 | 3300020452 | Marine | MAENQDNSRNEVEIDLDKYMAMIDKLDAQEDTIKEMKE |
| Ga0211514_106248353 | 3300020459 | Marine | MAEESKTVDSRNEVEIDLEKYMALIEKLDEQEDVIKEM |
| Ga0213858_100109708 | 3300021356 | Seawater | MAETDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEEAKRA |
| Ga0213860_100511671 | 3300021368 | Seawater | MAEGQDNSRNEVEIDLDKYMALIDKLDQAEDTIKDMQLEAAEAKK |
| Ga0213863_103061992 | 3300021371 | Seawater | MADNQDNSRNEVEIDLDKYMAMIEKLDQQEDQIKEMQEEARRAAEAL |
| Ga0213865_100333106 | 3300021373 | Seawater | MAEGQDNSRNEVEIDLDKYMGLIDKLDQAEDTIKEMQ |
| Ga0213865_103588503 | 3300021373 | Seawater | MAETDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEEAK |
| Ga0213869_101092964 | 3300021375 | Seawater | MAEGQDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQ |
| Ga0213864_102749453 | 3300021379 | Seawater | MAEGQDNSRNEVEIDLDKYMALIDKLDQAEDTINDMQ |
| Ga0222717_102097981 | 3300021957 | Estuarine Water | MADEKEYKDQSSNEVEIDLDKYMALIEKLDEQEDVIKEMKED |
| Ga0222718_101042351 | 3300021958 | Estuarine Water | MAENTDNSRNEVEIDLDKYMAMIEKLDEQEDQIREMKEEAKKA |
| Ga0222716_103411101 | 3300021959 | Estuarine Water | MAEGQDSSRNEVEIDLDKYMALIDKLDKAEDTIVEMQEEARKV |
| Ga0222716_107145703 | 3300021959 | Estuarine Water | MAKDNDSNEVEIDLDKYMALIEKLDEQEDQIKEMKEDAI |
| Ga0222714_104591671 | 3300021961 | Estuarine Water | MAEGQDNSRNEVEIDLDKYMALIDKLDKSEDMIKEM |
| Ga0222713_105581511 | 3300021962 | Estuarine Water | MAEGQDNSRNEVEIDLDKYMALIDKLDQAEDTIKDMQ |
| Ga0212021_11329142 | 3300022068 | Aqueous | MAEGQDNSRNEVEIDLDKYMGLIDKLDQAEDTIKEMQLE |
| Ga0255764_102560241 | 3300023081 | Salt Marsh | MAEGQDNSRNEVEIDLDKYMGLIDKLDKAEDTIKEMQLEAA |
| Ga0255751_101241751 | 3300023116 | Salt Marsh | MAEGQDNSRNEVEIDLDKYMGLIDKLDKAEDTIKEMQL |
| Ga0208791_10496052 | 3300025083 | Marine | MGDKDEKDKSTNEVEISLEKYMALIDKLDEQEDNIKEMQE |
| Ga0209336_100987411 | 3300025137 | Marine | MAENQDNSRNEVEIDLDKYMAMIDKLDEQEDQIKEM |
| Ga0209337_10668354 | 3300025168 | Marine | MADNQDNSRNEVEIDLDKYMAMIDKLGEQEDQIKEMKEQAIEAAE |
| Ga0209306_11513771 | 3300025680 | Pelagic Marine | MAETDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEEAKKARD |
| Ga0209095_10868792 | 3300025685 | Pelagic Marine | MAEETKDMSSNEVEIDLDKYMALIEKLDEQEDVIREMKEDAIKAKRG |
| Ga0209532_11928811 | 3300025696 | Pelagic Marine | MAEETKDMSSNEVEIDLDKYMALIEKLDEQEDVIREMKE |
| Ga0209715_11034991 | 3300025699 | Pelagic Marine | MADEKEYKDQSSNEVEIDLDKYMALIEKLDEQEDV |
| Ga0209252_10587953 | 3300025719 | Marine | MADNTDNSKNEVEIDLDKYMALIEKLDAQEDVIKEMKEDAI |
| Ga0208767_10817974 | 3300025769 | Aqueous | MAEGQDSSRNEVEIDLDKYMALIDKLDKAEDTIVEMQ |
| Ga0208767_12799641 | 3300025769 | Aqueous | MAEGQDNSRNEVEIDLDKYMGLIDKLDQAEDTIKEMQLEAAEAKK |
| Ga0209832_10741863 | 3300025830 | Pelagic Marine | MADEKEYKDQSSNEVEIDLDKYMALIEKLDEQEDVIKEMKEDAIKAK |
| Ga0209223_104329062 | 3300025876 | Pelagic Marine | MSDKEKDKSTNEVEISLEKYMALIDKLDEQEDNIKEMQEE |
| Ga0209309_104941081 | 3300025881 | Pelagic Marine | MADNNTDNSRNEVEIDLDKYMALIDKLDKSEDMIKEMQL |
| Ga0209630_100958301 | 3300025892 | Pelagic Marine | MAENTDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQEE |
| Ga0209425_100490645 | 3300025897 | Pelagic Marine | MAEETKDMSSNEVEIDLDKYMALIEKLDEQEDVIREMKEDAIK |
| Ga0209425_101946211 | 3300025897 | Pelagic Marine | MAENTDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQ |
| Ga0247571_11233021 | 3300026495 | Seawater | MADGVDSRNEVEIDLDKYMKLIDQLDEQEDKIKEMQAEAA |
| Ga0209404_101313131 | 3300027906 | Marine | MSENNDNSRNEVEIDLDKYMKLIDKLDNAEDTIKEMKD |
| Ga0257114_10663081 | 3300028196 | Marine | MGDKDEKDKSTNEVEISLEKYMALIDKLDEQEDNIKEMQEEAK |
| Ga0308010_12496572 | 3300031510 | Marine | MADNQQDNSRNEVEIDLEKYMAMIDKLDEQEDQIK |
| Ga0308014_10299464 | 3300031628 | Marine | MSDESKDTSKNEVEIDLDKYMALIEKLDAQEDVIKEMKDDA |
| Ga0315332_109354562 | 3300031773 | Seawater | MAEESKTVDSRNEVEIDLEKYMALIEKLDEQEDVIKE |
| Ga0315327_104681543 | 3300032032 | Seawater | MADNQDNSRNEVEIDLDKYMAMIEKLDEQEDQIKEMKEE |
| Ga0315330_100282631 | 3300032047 | Seawater | MAKDNDSNEVEIDLDKYMALIEKLDEQEDQIKEMKEDAIAA |
| Ga0316201_110971851 | 3300032136 | Worm Burrow | MAEQDNSRNEVEIDLDKYMAMIEKLDEQEDKIKEMQ |
| ⦗Top⦘ |