


| Basic Information | |
|---|---|
| Family ID | F072252 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEEK |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 53.72 % |
| % of genes near scaffold ends (potentially truncated) | 19.83 % |
| % of genes from short scaffolds (< 2000 bps) | 73.55 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (33.058 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (22.314 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.165 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.777 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF04466 | Terminase_3 | 24.79 |
| PF01555 | N6_N4_Mtase | 12.40 |
| PF02195 | ParBc | 9.09 |
| PF00145 | DNA_methylase | 6.61 |
| PF12684 | DUF3799 | 6.61 |
| PF05869 | Dam | 3.31 |
| PF14550 | Peptidase_S78_2 | 2.48 |
| PF13455 | MUG113 | 1.65 |
| PF08299 | Bac_DnaA_C | 1.65 |
| PF08291 | Peptidase_M15_3 | 0.83 |
| PF00162 | PGK | 0.83 |
| PF02954 | HTH_8 | 0.83 |
| PF01510 | Amidase_2 | 0.83 |
| PF00005 | ABC_tran | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 24.79 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 12.40 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 12.40 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 12.40 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 6.61 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.65 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.94 % |
| Unclassified | root | N/A | 33.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10004688 | Not Available | 7653 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10005506 | Not Available | 7695 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10035009 | All Organisms → Viruses → Predicted Viral | 2391 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10035235 | All Organisms → Viruses → Predicted Viral | 2381 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10156778 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 745 | Open in IMG/M |
| 3300000973|BBAY93_10071581 | Not Available | 893 | Open in IMG/M |
| 3300001956|GOS2266_1017925 | All Organisms → Viruses → Predicted Viral | 1971 | Open in IMG/M |
| 3300001965|GOS2243_1029612 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
| 3300002231|KVRMV2_100009574 | All Organisms → Viruses → Predicted Viral | 4396 | Open in IMG/M |
| 3300002231|KVRMV2_100010724 | All Organisms → cellular organisms → Bacteria | 6171 | Open in IMG/M |
| 3300002242|KVWGV2_10027433 | All Organisms → Viruses → Predicted Viral | 2366 | Open in IMG/M |
| 3300002242|KVWGV2_10151572 | All Organisms → Viruses → Predicted Viral | 3888 | Open in IMG/M |
| 3300002242|KVWGV2_10562397 | Not Available | 1090 | Open in IMG/M |
| 3300005837|Ga0078893_11509398 | All Organisms → Viruses → Predicted Viral | 1633 | Open in IMG/M |
| 3300005837|Ga0078893_13339061 | Not Available | 531 | Open in IMG/M |
| 3300006027|Ga0075462_10012314 | All Organisms → Viruses → Predicted Viral | 2763 | Open in IMG/M |
| 3300006027|Ga0075462_10028619 | All Organisms → Viruses → Predicted Viral | 1796 | Open in IMG/M |
| 3300006027|Ga0075462_10084252 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300006735|Ga0098038_1049860 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300006735|Ga0098038_1077969 | Not Available | 1164 | Open in IMG/M |
| 3300006737|Ga0098037_1050440 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
| 3300006749|Ga0098042_1099249 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 739 | Open in IMG/M |
| 3300006749|Ga0098042_1105950 | Not Available | 709 | Open in IMG/M |
| 3300006802|Ga0070749_10013245 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 5286 | Open in IMG/M |
| 3300006810|Ga0070754_10048693 | All Organisms → Viruses → Predicted Viral | 2254 | Open in IMG/M |
| 3300006916|Ga0070750_10126154 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 1171 | Open in IMG/M |
| 3300006916|Ga0070750_10129343 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| 3300006916|Ga0070750_10184895 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300006916|Ga0070750_10211387 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 855 | Open in IMG/M |
| 3300006916|Ga0070750_10351916 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 622 | Open in IMG/M |
| 3300006916|Ga0070750_10373418 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 599 | Open in IMG/M |
| 3300006919|Ga0070746_10098714 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
| 3300006919|Ga0070746_10252770 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 822 | Open in IMG/M |
| 3300006919|Ga0070746_10475241 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 552 | Open in IMG/M |
| 3300006920|Ga0070748_1173496 | Not Available | 795 | Open in IMG/M |
| 3300007539|Ga0099849_1232421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 683 | Open in IMG/M |
| 3300008218|Ga0114904_1072081 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300009435|Ga0115546_1013298 | Not Available | 3689 | Open in IMG/M |
| 3300009605|Ga0114906_1108580 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300009794|Ga0105189_1029822 | Not Available | 538 | Open in IMG/M |
| 3300010148|Ga0098043_1006683 | All Organisms → Viruses → Predicted Viral | 3919 | Open in IMG/M |
| 3300010148|Ga0098043_1019117 | All Organisms → Viruses → Predicted Viral | 2210 | Open in IMG/M |
| 3300010148|Ga0098043_1131964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 714 | Open in IMG/M |
| 3300011256|Ga0151664_1050278 | Not Available | 883 | Open in IMG/M |
| 3300011258|Ga0151677_1066642 | Not Available | 1027 | Open in IMG/M |
| 3300012920|Ga0160423_10074435 | Not Available | 2424 | Open in IMG/M |
| 3300012920|Ga0160423_10106266 | Not Available | 1982 | Open in IMG/M |
| 3300012920|Ga0160423_10299474 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
| 3300012920|Ga0160423_10339837 | Not Available | 1030 | Open in IMG/M |
| 3300012920|Ga0160423_10610594 | Not Available | 739 | Open in IMG/M |
| 3300012920|Ga0160423_10610595 | Not Available | 739 | Open in IMG/M |
| 3300017709|Ga0181387_1086459 | Not Available | 637 | Open in IMG/M |
| 3300017709|Ga0181387_1102340 | Not Available | 587 | Open in IMG/M |
| 3300017720|Ga0181383_1004845 | All Organisms → Viruses → Predicted Viral | 3684 | Open in IMG/M |
| 3300017720|Ga0181383_1118073 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 712 | Open in IMG/M |
| 3300017727|Ga0181401_1035673 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1410 | Open in IMG/M |
| 3300017730|Ga0181417_1004181 | All Organisms → Viruses → Predicted Viral | 3971 | Open in IMG/M |
| 3300017738|Ga0181428_1036306 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
| 3300017738|Ga0181428_1036572 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1141 | Open in IMG/M |
| 3300017739|Ga0181433_1027883 | All Organisms → Viruses → Predicted Viral | 1480 | Open in IMG/M |
| 3300017744|Ga0181397_1039433 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| 3300017746|Ga0181389_1001048 | All Organisms → Viruses | 11072 | Open in IMG/M |
| 3300017753|Ga0181407_1027060 | All Organisms → Viruses → Predicted Viral | 1557 | Open in IMG/M |
| 3300017753|Ga0181407_1032151 | All Organisms → Viruses → Predicted Viral | 1412 | Open in IMG/M |
| 3300017755|Ga0181411_1035219 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
| 3300017756|Ga0181382_1001989 | Not Available | 9154 | Open in IMG/M |
| 3300017758|Ga0181409_1006247 | All Organisms → cellular organisms → Bacteria | 4133 | Open in IMG/M |
| 3300017762|Ga0181422_1122116 | Not Available | 807 | Open in IMG/M |
| 3300017768|Ga0187220_1042441 | All Organisms → Viruses → Predicted Viral | 1370 | Open in IMG/M |
| 3300017768|Ga0187220_1125588 | Not Available | 776 | Open in IMG/M |
| 3300017776|Ga0181394_1090035 | Not Available | 987 | Open in IMG/M |
| 3300017783|Ga0181379_1142485 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300018416|Ga0181553_10170186 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1281 | Open in IMG/M |
| 3300019699|Ga0193985_1054489 | Not Available | 502 | Open in IMG/M |
| 3300019705|Ga0193981_1047317 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 544 | Open in IMG/M |
| 3300019721|Ga0194011_1063201 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 500 | Open in IMG/M |
| 3300019751|Ga0194029_1026353 | Not Available | 906 | Open in IMG/M |
| 3300020249|Ga0211635_1073833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300020408|Ga0211651_10322346 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 581 | Open in IMG/M |
| 3300020410|Ga0211699_10169200 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 828 | Open in IMG/M |
| 3300020420|Ga0211580_10386745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Inhavirus P12024S | 571 | Open in IMG/M |
| 3300020450|Ga0211641_10269661 | Not Available | 835 | Open in IMG/M |
| 3300020451|Ga0211473_10102454 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300020453|Ga0211550_10124444 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300021373|Ga0213865_10106235 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300021373|Ga0213865_10217220 | Not Available | 935 | Open in IMG/M |
| 3300021373|Ga0213865_10360708 | Not Available | 657 | Open in IMG/M |
| 3300022067|Ga0196895_1000974 | All Organisms → Viruses → Predicted Viral | 2971 | Open in IMG/M |
| 3300022068|Ga0212021_1018311 | Not Available | 1287 | Open in IMG/M |
| 3300022068|Ga0212021_1076761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 685 | Open in IMG/M |
| 3300025086|Ga0208157_1084420 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 787 | Open in IMG/M |
| 3300025101|Ga0208159_1007042 | All Organisms → Viruses → Predicted Viral | 3276 | Open in IMG/M |
| 3300025120|Ga0209535_1012485 | Not Available | 4671 | Open in IMG/M |
| 3300025132|Ga0209232_1107580 | Not Available | 934 | Open in IMG/M |
| 3300025151|Ga0209645_1015212 | All Organisms → Viruses → Predicted Viral | 3008 | Open in IMG/M |
| 3300025674|Ga0208162_1051058 | All Organisms → Viruses | 1389 | Open in IMG/M |
| 3300025759|Ga0208899_1071631 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
| 3300025759|Ga0208899_1113723 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300025759|Ga0208899_1114604 | Not Available | 979 | Open in IMG/M |
| 3300025759|Ga0208899_1190389 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 661 | Open in IMG/M |
| 3300025769|Ga0208767_1115276 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300025889|Ga0208644_1008666 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 7143 | Open in IMG/M |
| 3300027859|Ga0209503_10023940 | All Organisms → Viruses → Predicted Viral | 2727 | Open in IMG/M |
| 3300027917|Ga0209536_101411839 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300028022|Ga0256382_1041564 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300028022|Ga0256382_1092533 | Not Available | 723 | Open in IMG/M |
| 3300029301|Ga0135222_1022092 | All Organisms → Viruses | 534 | Open in IMG/M |
| 3300029308|Ga0135226_1033981 | Not Available | 533 | Open in IMG/M |
| 3300029309|Ga0183683_1000576 | Not Available | 18880 | Open in IMG/M |
| 3300029309|Ga0183683_1000945 | All Organisms → Viruses | 13127 | Open in IMG/M |
| 3300029309|Ga0183683_1016858 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
| 3300029318|Ga0185543_1000056 | Not Available | 32282 | Open in IMG/M |
| 3300029318|Ga0185543_1067602 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 731 | Open in IMG/M |
| 3300029448|Ga0183755_1000302 | Not Available | 29730 | Open in IMG/M |
| 3300029635|Ga0135217_105724 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 706 | Open in IMG/M |
| 3300029787|Ga0183757_1000244 | Not Available | 33190 | Open in IMG/M |
| 3300031774|Ga0315331_10033207 | All Organisms → Viruses → Predicted Viral | 3826 | Open in IMG/M |
| 3300031774|Ga0315331_10437464 | Not Available | 953 | Open in IMG/M |
| 3300031774|Ga0315331_10664338 | Not Available | 740 | Open in IMG/M |
| 3300032073|Ga0315315_10387956 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300034375|Ga0348336_055277 | All Organisms → Viruses → Predicted Viral | 1599 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.31% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 17.36% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.57% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.57% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.96% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.13% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 4.13% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.31% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.48% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.48% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 2.48% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.65% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.65% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.65% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.65% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.83% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.83% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.83% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.83% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.83% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.83% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.83% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001956 | Marine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009794 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300011256 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019699 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_1-2_MG | Environmental | Open in IMG/M |
| 3300019705 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_2-3_MG | Environmental | Open in IMG/M |
| 3300019721 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020249 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556038-ERR599056) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020453 | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029301 | Marine harbor viral communities from the Indian Ocean - SRH1 | Environmental | Open in IMG/M |
| 3300029308 | Marine harbor viral communities from the Indian Ocean - SRB2 | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029635 | Marine harbor viral communities from the Indian Ocean - SMH2 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_1000468817 | 3300000116 | Marine | MKQKKHTNIQRIKRLENIVSQIYLSVEVIKKNLEKQNSKE* |
| DelMOWin2010_1000550612 | 3300000117 | Marine | MKAKKYTQIQRIKRLENIVSQMYLSLEVLKKSIDKQKEK* |
| DelMOWin2010_100350093 | 3300000117 | Marine | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKQRLDKKEEK* |
| DelMOWin2010_100352357 | 3300000117 | Marine | MKQKKFTQIQRIKRLENIVSQIYMSVEVIKQRLDKKEEK* |
| DelMOWin2010_101567781 | 3300000117 | Marine | MKQKKFTQIQRIKRLENIVSQIYMSVEVIKQRLDKKE |
| BBAY93_100715811 | 3300000973 | Macroalgal Surface | LKQKKHTTIQRIKRLENIVAIIYHNVEQLKKQLDEI |
| GOS2266_10179251 | 3300001956 | Marine | NIRYRMKPKKYTTIQRIKRLENIVSQIYMSVEVIKQQLDKKEED* |
| GOS2243_10296123 | 3300001965 | Marine | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK* |
| KVRMV2_1000095747 | 3300002231 | Marine Sediment | LKQKKFTQIQRIKRLENIVSQIYMSVEVIKKQLEKQTETQNPKN* |
| KVRMV2_1000107242 | 3300002231 | Marine Sediment | MVNKKHTTIQRIKRLENIVSQIYMSVEVIKKQLDEKQKPES* |
| KVWGV2_100274335 | 3300002242 | Marine Sediment | MVNKKHTTIQRIKRLENIVSQIYMSVEVIKKQLDENSKLD* |
| KVWGV2_101515727 | 3300002242 | Marine Sediment | LKQKKFTQIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK* |
| KVWGV2_105623973 | 3300002242 | Marine Sediment | LKQKKFTQIQRIKRLENIVSQIYMSVEVIKKQLEKQTKTQNPKN* |
| Ga0078893_115093983 | 3300005837 | Marine Surface Water | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKQQLDKKEED* |
| Ga0078893_133390612 | 3300005837 | Marine Surface Water | MKPKKYTTIQRIKRLENIVSQMYYSLEVIKKQLEKENKNK* |
| Ga0075462_100123142 | 3300006027 | Aqueous | MVNKKYTTIQRIKRLENIVSQIYLSVEVIKKQLDENSKHD* |
| Ga0075462_100286194 | 3300006027 | Aqueous | MVNKKYTTIQRIKRLENIVSQIYLSVEVIKKQLDKKEEN* |
| Ga0075462_100842522 | 3300006027 | Aqueous | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEEK* |
| Ga0098038_10498603 | 3300006735 | Marine | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKKQLEKDEQ* |
| Ga0098038_10779692 | 3300006735 | Marine | MVNKKHTTIQRIKRLENIVSQIYMSVEVIKKQLEKDESK* |
| Ga0098037_10504402 | 3300006737 | Marine | MLKRKKFTQIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK* |
| Ga0098042_10992491 | 3300006749 | Marine | MLKQKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKKEED* |
| Ga0098042_11059502 | 3300006749 | Marine | MKQKKFTQIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK* |
| Ga0070749_100132452 | 3300006802 | Aqueous | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDENSKHD* |
| Ga0070754_100486932 | 3300006810 | Aqueous | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDEKQKPES* |
| Ga0070750_101261542 | 3300006916 | Aqueous | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDEKQEPES* |
| Ga0070750_101293431 | 3300006916 | Aqueous | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEED* |
| Ga0070750_101848951 | 3300006916 | Aqueous | MKQKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEEK* |
| Ga0070750_102113872 | 3300006916 | Aqueous | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLEKKEEL* |
| Ga0070750_103519161 | 3300006916 | Aqueous | KYTTIQRIKRLENIVSQIYLSVEVIKKQLEKKEEL* |
| Ga0070750_103734182 | 3300006916 | Aqueous | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKKEEN* |
| Ga0070746_100987143 | 3300006919 | Aqueous | KPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEED* |
| Ga0070746_102527703 | 3300006919 | Aqueous | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKNENKSR* |
| Ga0070746_104752412 | 3300006919 | Aqueous | MKPKKYTTIQRIKRLENIVSQIYLSVEVIKKQLEKKEEL* |
| Ga0070748_11734963 | 3300006920 | Aqueous | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKQRLDKKEEK* |
| Ga0099849_12324211 | 3300007539 | Aqueous | KKFTQIQRIKRLENIVSQIYMRIEVIKKQLDKKEED* |
| Ga0114904_10720811 | 3300008218 | Deep Ocean | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLEKQTETQNPKN* |
| Ga0115546_10132981 | 3300009435 | Pelagic Marine | LKPKKHTTIQRIKRLENIVSQIYLSVEVIKKQLEK |
| Ga0114906_11085803 | 3300009605 | Deep Ocean | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDENK* |
| Ga0105189_10298221 | 3300009794 | Marine Oceanic | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDENK* |
| Ga0098043_10066834 | 3300010148 | Marine | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK* |
| Ga0098043_10191174 | 3300010148 | Marine | LKQKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKKEED* |
| Ga0098043_11319641 | 3300010148 | Marine | QQTTTRPNNIRNRMKQKKFTQIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK* |
| Ga0151664_10502781 | 3300011256 | Marine | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLEKDEPK |
| Ga0151677_10666423 | 3300011258 | Marine | MKPKKYTQIQRIKRLENIVSQMYYSLEVIKKQLEKENKNK* |
| Ga0160423_100744354 | 3300012920 | Surface Seawater | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLNKENIKD* |
| Ga0160423_101062661 | 3300012920 | Surface Seawater | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKKEKK* |
| Ga0160423_102994742 | 3300012920 | Surface Seawater | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKKEEK* |
| Ga0160423_103398372 | 3300012920 | Surface Seawater | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDENNKPNKNAST* |
| Ga0160423_106105942 | 3300012920 | Surface Seawater | MKPKKYTAIQRIKRLENIVSQIYLSVEVIKKQLDKKEEN* |
| Ga0160423_106105952 | 3300012920 | Surface Seawater | MKPKKYTVIQRIKRLENIVSQIYLSVEVIKKQLDKKEED* |
| Ga0181387_10864591 | 3300017709 | Seawater | MVNKKHTTIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK |
| Ga0181387_11023402 | 3300017709 | Seawater | MKQKKFTQIQRIKRLENIVSQIYMSVEAIKQQLDKKEED |
| Ga0181383_10048455 | 3300017720 | Seawater | MVNKKHTTIQRIKRLENIVSQIYMSVEVIKQQLDKKEKK |
| Ga0181383_11180732 | 3300017720 | Seawater | MVNKKHTTIQRIKRLENIVSQIYMSVEVIKKQLEKDEQ |
| Ga0181401_10356734 | 3300017727 | Seawater | MLKPKKFTQIQRIKRLENIVSQIYMSVEAIKQQLDKKEEK |
| Ga0181417_10041814 | 3300017730 | Seawater | MKDKKFTQIQRIKRLENIVSQIYISVEAIKQQLDKKEEK |
| Ga0181428_10363062 | 3300017738 | Seawater | MKDKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEEK |
| Ga0181428_10365722 | 3300017738 | Seawater | MLKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDENKTK |
| Ga0181433_10278832 | 3300017739 | Seawater | MVNKKHTTIQRIKRLENIVSQIYMSVEAIKQQLDKKEEK |
| Ga0181397_10394333 | 3300017744 | Seawater | KQKKHTNIQRIKRLENIVSQIYLSVEVIKKNLEKQNPKD |
| Ga0181389_100104816 | 3300017746 | Seawater | MKQKKHTNIQRIKRLENIVSQIYLSVEVIKKNLEKQNSKE |
| Ga0181407_10270603 | 3300017753 | Seawater | MKDKKFTQIQRIKRLENIVSQIYMSVEAIKQQLDKKEEK |
| Ga0181407_10321514 | 3300017753 | Seawater | MKPKKFTQIQRIKRLENIVSQIYMSVEAIKKQLDEKQKPKS |
| Ga0181411_10352191 | 3300017755 | Seawater | KKHTNIQRIKRLENIVSQIYLSVEVIKKNLEKQNPKD |
| Ga0181382_100198911 | 3300017756 | Seawater | MVNKKHTTIQRIKRLENIVSQIYMSVEVIKEQLDKKEED |
| Ga0181409_10062473 | 3300017758 | Seawater | MKQKKHTNIQRIKRLENIVSQIYLSVEVIKKNLEKQNPKD |
| Ga0181422_11221161 | 3300017762 | Seawater | MVNKKHTTIQRIKRLENIVSQIYMSVEAIKQQLDKKEEKYRYI |
| Ga0187220_10424412 | 3300017768 | Seawater | MKQKKFTQIQRIKRLENIVSQIYMSVEAIKQQLDKKEEK |
| Ga0187220_11255882 | 3300017768 | Seawater | MKLKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDENKKD |
| Ga0181394_10900351 | 3300017776 | Seawater | KHTTIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK |
| Ga0181379_11424852 | 3300017783 | Seawater | MKQKKHTNIQRIKRLENIVSQIYLSVEVIKKNLEKNKNNKTQ |
| Ga0181553_101701862 | 3300018416 | Salt Marsh | MKQKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKKDDKTN |
| Ga0193985_10544892 | 3300019699 | Sediment | MVNKKYTTIQRIKRLENIVSQIYLSVEVIKKQLDKKEED |
| Ga0193981_10473171 | 3300019705 | Sediment | MKAKKYTQIQRIKRLENIVSQMYLSLEVLKKSIDKQKEK |
| Ga0194011_10632012 | 3300019721 | Sediment | MKAKKYTQIQRIKRLENIVSQIYLSVEVIKKQLDKKEED |
| Ga0194029_10263533 | 3300019751 | Freshwater | MKPKKYTTIQRIKRLENIVSQIYLSVEVIKKQLDKKEEDKRYIFD |
| Ga0211635_10738331 | 3300020249 | Marine | LKQKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDEKQKP |
| Ga0211651_103223462 | 3300020408 | Marine | MKPKKYTVIQRIKRLENIVSQIYLSVEVIKKQLDKKEED |
| Ga0211699_101692003 | 3300020410 | Marine | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDEKQKPES |
| Ga0211580_103867452 | 3300020420 | Marine | LKPKKYTTIQRIKRLENIVSQIYMSVEVIKQQLDKKEDEDNK |
| Ga0211641_102696611 | 3300020450 | Marine | TTTRPNNIRNRMKPKKFTQIQRIKRLENIVSQIYMSVEVIKNQLDKKEEK |
| Ga0211473_101024544 | 3300020451 | Marine | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDENKTK |
| Ga0211550_101244442 | 3300020453 | Marine | MKQKKYTTIQRIKRLENIVSQIYMSVEVIKKQLEKQTETQNPKN |
| Ga0213865_101062352 | 3300021373 | Seawater | MKPKKYTTIQRIKRLENIVSQIYLSVEVIKKQLEKKEEL |
| Ga0213865_102172203 | 3300021373 | Seawater | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKQQLDKKEED |
| Ga0213865_103607081 | 3300021373 | Seawater | LKQKKFTQIQRIKRLENIVSQIYLSVEVIKKQLEKKEEL |
| Ga0196895_10009745 | 3300022067 | Aqueous | MVNKKYTTIQRIKRLENIVSQIYLSVEVIKKQLDKKEEN |
| Ga0212021_10183111 | 3300022068 | Aqueous | MKPKKYTQIQRIKRLENIVSQIYLSVEVIKKQLDKKEED |
| Ga0212021_10767613 | 3300022068 | Aqueous | CYSRNRMEPKKYTQIQRIKRLENIVSQIYLSVEVIKKQLDKKEED |
| Ga0208157_10844202 | 3300025086 | Marine | MVNKKHTTIQRIKRLENIVSQIYMSVEVIKKQLEKDESK |
| Ga0208159_10070425 | 3300025101 | Marine | MKQKKFTQIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK |
| Ga0209535_10124853 | 3300025120 | Marine | MKQKKHTNIQRIKRLENIVSQIYLSVEVIKKQLEKNEQ |
| Ga0209232_11075801 | 3300025132 | Marine | MKDKKFTQIQRIKRLENIVSQIYISVEAIKQQLDKKE |
| Ga0209645_10152125 | 3300025151 | Marine | MKTKKYTTIQRIKRLENIVSQIYLSVEVIKKQLDKKEED |
| Ga0208162_10510583 | 3300025674 | Aqueous | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEED |
| Ga0208899_10716313 | 3300025759 | Aqueous | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLEKKEEL |
| Ga0208899_11137233 | 3300025759 | Aqueous | MKPKKFTQIQRIKRLENIVSQIYLSVEVIKKQLDKKEEN |
| Ga0208899_11146043 | 3300025759 | Aqueous | KKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEED |
| Ga0208899_11903893 | 3300025759 | Aqueous | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKKEEN |
| Ga0208767_11152761 | 3300025769 | Aqueous | MKQKKYTQIQRIKRLENIVAQLYYSVEAIKKTLKI |
| Ga0208644_10086664 | 3300025889 | Aqueous | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDENSKHD |
| Ga0209503_100239404 | 3300027859 | Marine | MKQKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDENSKLD |
| Ga0209536_1014118392 | 3300027917 | Marine Sediment | LKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKKEED |
| Ga0256382_10415643 | 3300028022 | Seawater | TNRIILKQKKFTQIQRIKRLENIVSQIYMSVEVIKKQLEKQTETQNPKN |
| Ga0256382_10925332 | 3300028022 | Seawater | MKQKKFTQIQRIKRLENIVSQIYLSVEVIKKQLDEKQKPES |
| Ga0135222_10220922 | 3300029301 | Marine Harbor | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDEKQKPES |
| Ga0135226_10339812 | 3300029308 | Marine Harbor | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLEKDEQ |
| Ga0183683_10005765 | 3300029309 | Marine | MVNKKHTTIQRIKRLENIVSQIYMSVEVIKKQLDKKEED |
| Ga0183683_100094513 | 3300029309 | Marine | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKNQLDKKEEK |
| Ga0183683_10168582 | 3300029309 | Marine | MKPKKFTTIQRIKRLENIVSQIYMSVEVIKKQLEKNEKQS |
| Ga0185543_100005626 | 3300029318 | Marine | MKQKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEED |
| Ga0185543_10676022 | 3300029318 | Marine | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDENSKLD |
| Ga0183755_100030219 | 3300029448 | Marine | MKDKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDENKKD |
| Ga0135217_1057243 | 3300029635 | Marine Harbor | MKPKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDKKEEN |
| Ga0183757_100024428 | 3300029787 | Marine | MVNKKYTTIQRIKRLENIVSQIYMSVEVIKKQLDENK |
| Ga0315331_100332074 | 3300031774 | Seawater | MKDKKFTQIQRIKRLENIVSQIYMSVELIKQQLDKKEEK |
| Ga0315331_104374642 | 3300031774 | Seawater | MVNKKHTTIQRIKRLENIVSQIYMSVEVMKKQLDEKQKSKS |
| Ga0315331_106643383 | 3300031774 | Seawater | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKQQLDKKEEK |
| Ga0315315_103879562 | 3300032073 | Seawater | MKDKKFTQIQRIKRLENIVSQIYMSVELIKQQLNKKDDKTN |
| Ga0348336_055277_209_328 | 3300034375 | Aqueous | MKPKKFTQIQRIKRLENIVSQIYMSVEVIKKQLDKKEEK |
| ⦗Top⦘ |