


| Basic Information | |
|---|---|
| Family ID | F072212 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LVAAFDAVRAGKVQPSPDSPGKVLYKVDDISFLMRAPAAH |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.04 % |
| % of genes from short scaffolds (< 2000 bps) | 85.95 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.661 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.835 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.025 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.76% β-sheet: 23.53% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF06684 | AA_synth | 23.97 |
| PF00144 | Beta-lactamase | 8.26 |
| PF13520 | AA_permease_2 | 7.44 |
| PF02358 | Trehalose_PPase | 2.48 |
| PF00072 | Response_reg | 1.65 |
| PF07859 | Abhydrolase_3 | 1.65 |
| PF01926 | MMR_HSR1 | 1.65 |
| PF00326 | Peptidase_S9 | 1.65 |
| PF00561 | Abhydrolase_1 | 1.65 |
| PF12158 | DUF3592 | 0.83 |
| PF01243 | Putative_PNPOx | 0.83 |
| PF03572 | Peptidase_S41 | 0.83 |
| PF13565 | HTH_32 | 0.83 |
| PF02566 | OsmC | 0.83 |
| PF01850 | PIN | 0.83 |
| PF01058 | Oxidored_q6 | 0.83 |
| PF02861 | Clp_N | 0.83 |
| PF07690 | MFS_1 | 0.83 |
| PF12697 | Abhydrolase_6 | 0.83 |
| PF01266 | DAO | 0.83 |
| PF13442 | Cytochrome_CBB3 | 0.83 |
| PF13590 | DUF4136 | 0.83 |
| PF13419 | HAD_2 | 0.83 |
| PF12847 | Methyltransf_18 | 0.83 |
| PF13847 | Methyltransf_31 | 0.83 |
| PF00583 | Acetyltransf_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 8.26 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 8.26 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 8.26 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 2.48 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.65 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.83 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.83 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.83 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.83 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.83 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.25 % |
| Unclassified | root | N/A | 29.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10740852 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300001686|C688J18823_10180700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1434 | Open in IMG/M |
| 3300001867|JGI12627J18819_10464505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100057564 | All Organisms → cellular organisms → Bacteria | 3553 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100534466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300005435|Ga0070714_100176857 | Not Available | 1939 | Open in IMG/M |
| 3300005439|Ga0070711_100153364 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300005439|Ga0070711_101195229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300005454|Ga0066687_10750767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300005467|Ga0070706_101617079 | Not Available | 591 | Open in IMG/M |
| 3300005538|Ga0070731_10139017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1610 | Open in IMG/M |
| 3300005538|Ga0070731_10381492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300005541|Ga0070733_10050055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2615 | Open in IMG/M |
| 3300005568|Ga0066703_10027981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2997 | Open in IMG/M |
| 3300005602|Ga0070762_10166473 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005610|Ga0070763_10600502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 638 | Open in IMG/M |
| 3300005764|Ga0066903_102679913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 967 | Open in IMG/M |
| 3300005921|Ga0070766_10451538 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300006046|Ga0066652_101935147 | Not Available | 528 | Open in IMG/M |
| 3300006059|Ga0075017_100090406 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
| 3300006102|Ga0075015_100438083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300006162|Ga0075030_101585267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300006755|Ga0079222_12136980 | Not Available | 555 | Open in IMG/M |
| 3300006871|Ga0075434_102590531 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006914|Ga0075436_100669998 | Not Available | 767 | Open in IMG/M |
| 3300009520|Ga0116214_1142160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300009521|Ga0116222_1511558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300009545|Ga0105237_11486370 | Not Available | 684 | Open in IMG/M |
| 3300009698|Ga0116216_10726160 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009824|Ga0116219_10391624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 775 | Open in IMG/M |
| 3300009826|Ga0123355_10562268 | Not Available | 1373 | Open in IMG/M |
| 3300009839|Ga0116223_10749540 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010360|Ga0126372_11898624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300010376|Ga0126381_100948279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300010376|Ga0126381_104884328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 515 | Open in IMG/M |
| 3300010379|Ga0136449_101050651 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300012210|Ga0137378_10709353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300012363|Ga0137390_11166510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300012469|Ga0150984_108970747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1543 | Open in IMG/M |
| 3300014156|Ga0181518_10605824 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300014162|Ga0181538_10729476 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300014169|Ga0181531_10292884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300014200|Ga0181526_10531269 | Not Available | 744 | Open in IMG/M |
| 3300014489|Ga0182018_10235219 | Not Available | 1013 | Open in IMG/M |
| 3300016701|Ga0181509_1375248 | Not Available | 607 | Open in IMG/M |
| 3300017972|Ga0187781_10647531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300017973|Ga0187780_10178652 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300018006|Ga0187804_10289299 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300018032|Ga0187788_10424093 | Not Available | 563 | Open in IMG/M |
| 3300018046|Ga0187851_10238099 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300018085|Ga0187772_10469826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300018085|Ga0187772_11349260 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300018468|Ga0066662_10035719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3013 | Open in IMG/M |
| 3300020579|Ga0210407_10705856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300020581|Ga0210399_10914505 | Not Available | 711 | Open in IMG/M |
| 3300020582|Ga0210395_10817160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300020583|Ga0210401_10164841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2068 | Open in IMG/M |
| 3300020583|Ga0210401_10748735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300021168|Ga0210406_11200484 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021170|Ga0210400_10163426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1798 | Open in IMG/M |
| 3300021170|Ga0210400_11181745 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021178|Ga0210408_10547725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300021180|Ga0210396_10262844 | Not Available | 1533 | Open in IMG/M |
| 3300021405|Ga0210387_10149194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1999 | Open in IMG/M |
| 3300021405|Ga0210387_10736299 | Not Available | 873 | Open in IMG/M |
| 3300021406|Ga0210386_10936842 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300021406|Ga0210386_11467393 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300021433|Ga0210391_10429190 | Not Available | 1037 | Open in IMG/M |
| 3300021474|Ga0210390_10177003 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300021477|Ga0210398_10028293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4709 | Open in IMG/M |
| 3300021478|Ga0210402_11187483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300021559|Ga0210409_10189916 | Not Available | 1873 | Open in IMG/M |
| 3300021861|Ga0213853_10277271 | Not Available | 530 | Open in IMG/M |
| 3300022528|Ga0242669_1076878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300024271|Ga0224564_1006489 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300025134|Ga0207416_1222025 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300025922|Ga0207646_11612808 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300025928|Ga0207700_11749573 | Not Available | 547 | Open in IMG/M |
| 3300025929|Ga0207664_11605633 | Not Available | 572 | Open in IMG/M |
| 3300025939|Ga0207665_10063425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2509 | Open in IMG/M |
| 3300025945|Ga0207679_10752636 | Not Available | 886 | Open in IMG/M |
| 3300026116|Ga0207674_10795296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 913 | Open in IMG/M |
| 3300026983|Ga0207856_1036074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300027604|Ga0208324_1202554 | Not Available | 526 | Open in IMG/M |
| 3300027648|Ga0209420_1073273 | Not Available | 996 | Open in IMG/M |
| 3300027884|Ga0209275_10848289 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027895|Ga0209624_10243672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300028773|Ga0302234_10465903 | Not Available | 540 | Open in IMG/M |
| 3300028808|Ga0302228_10523581 | Not Available | 522 | Open in IMG/M |
| 3300028906|Ga0308309_10353368 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300030707|Ga0310038_10347931 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300031231|Ga0170824_103922958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1303 | Open in IMG/M |
| 3300031231|Ga0170824_117680181 | Not Available | 562 | Open in IMG/M |
| 3300031234|Ga0302325_10643204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1547 | Open in IMG/M |
| 3300031446|Ga0170820_10912939 | Not Available | 548 | Open in IMG/M |
| 3300031446|Ga0170820_17198879 | Not Available | 562 | Open in IMG/M |
| 3300031545|Ga0318541_10847014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300031718|Ga0307474_10504671 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300031730|Ga0307516_11014774 | Not Available | 503 | Open in IMG/M |
| 3300031748|Ga0318492_10664223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 558 | Open in IMG/M |
| 3300031833|Ga0310917_10031561 | All Organisms → cellular organisms → Bacteria | 3136 | Open in IMG/M |
| 3300031946|Ga0310910_10186560 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300031962|Ga0307479_11816789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300032001|Ga0306922_10390404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1491 | Open in IMG/M |
| 3300032059|Ga0318533_11049252 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300032160|Ga0311301_10292960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2618 | Open in IMG/M |
| 3300032160|Ga0311301_10842397 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300032174|Ga0307470_10030338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 2563 | Open in IMG/M |
| 3300032205|Ga0307472_100129311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1803 | Open in IMG/M |
| 3300032783|Ga0335079_11445556 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300032805|Ga0335078_11885786 | Not Available | 645 | Open in IMG/M |
| 3300032828|Ga0335080_10943105 | Not Available | 882 | Open in IMG/M |
| 3300033004|Ga0335084_11163787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300033158|Ga0335077_10463677 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300033808|Ga0314867_044985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.66% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.13% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.13% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.48% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.65% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.83% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300016701 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026983 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 21 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_107408521 | 3300001593 | Forest Soil | TLLPRLVAAFDAVRAGKVQPSPDSPGKVLYKVDDISFLMRAPDAH* |
| C688J18823_101807001 | 3300001686 | Soil | PSVLGGLVVAFDKVQAGKVPAVADSPGKVLYKVDGFSFLMRTPSH* |
| JGI12627J18819_104645052 | 3300001867 | Forest Soil | VLPRLVAAFDTVRAGKVAAVPDSPGKVLYKVGDISFLMRARTP* |
| JGIcombinedJ26739_1000575644 | 3300002245 | Forest Soil | PVRAGKVQPSPDSPGKVLYKVDDIPFLMRAPDAR* |
| JGIcombinedJ26739_1005344661 | 3300002245 | Forest Soil | PTVLARLVMAFDAVRAGKIKPVPEPAGKVLYKVDDISFLMRDPAAH* |
| Ga0066678_104034732 | 3300005181 | Soil | TAFQTVRAGKTSATPAAAGRVIYKVDDISFLMRSPESKH* |
| Ga0070714_1001768573 | 3300005435 | Agricultural Soil | SVLARLVNAFDEVRAGRVIATPASPGQVIYKVGEISFLMRAGTTKR* |
| Ga0070711_1001533643 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LVTAFDVVRAGKVQPSPDSPGKVLYKVDDISFLMRAPAAP* |
| Ga0070711_1011952292 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LVTAFDVVRAGKVQPSPDSPGKVLYKVDDISFLMRAPAAH* |
| Ga0066687_107507671 | 3300005454 | Soil | VLEQLVSAFHKVQSGKVPAVPNSPGKVLYKVDGVSFLMRPPSH* |
| Ga0070706_1016170791 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | APPSVLPRLVTAFQTVRAGKGSATPAAAGRVIYKVDYISFLMRSPESKH* |
| Ga0070731_101390171 | 3300005538 | Surface Soil | GAHNIPVAKPTVVAELAEAFDAVRAGKVKPTPDSPGKVLYKVGDITFLMRAPADK* |
| Ga0070731_103814921 | 3300005538 | Surface Soil | RAGKIPPAPADPGTVIYKVDDISFLMRAPVRTSQ* |
| Ga0070733_100500555 | 3300005541 | Surface Soil | ASPTVLARLVVAFDAVRAGKIKPVPDSPGKVLYKVDDISFLMRAPTAH* |
| Ga0066703_100279815 | 3300005568 | Soil | LPRLVSAFDAVRAGKVAGTPAPGGKVLYTVNGITFLMRAP* |
| Ga0070762_101664733 | 3300005602 | Soil | VAAFDAVRAGKVQPSPDAPGKVLYKVEDISFLMQAPAAH* |
| Ga0070763_106005021 | 3300005610 | Soil | VASPEVLIRLVAAFDAVRAGKVMPTADSPGKVLYKIGDISFLMRAPQGK* |
| Ga0066903_1026799133 | 3300005764 | Tropical Forest Soil | AKTAVLAELVDAFDAVRAGKVKPTPDSLGKVLYRAGNISFLMRAPAGK* |
| Ga0070766_104515382 | 3300005921 | Soil | LVAAFDAVRAGKVQPSPDSPGKVLYKVDDISFLMRAPAAH* |
| Ga0066652_1019351471 | 3300006046 | Soil | AFKQVRASKVAGTPASSGKVLYKVGEISFLMRSQAASKH* |
| Ga0075017_1000904062 | 3300006059 | Watersheds | VMGAHNIPVASPAVLPRLVAAFDVVRAGKIQPSADSPGKVLYKVDNISFLMRVPAAH* |
| Ga0075015_1004380832 | 3300006102 | Watersheds | FDAVRAGKIPATPASAGKVTYKVDDITFLMKAKESAP* |
| Ga0075030_1015852672 | 3300006162 | Watersheds | VDAFDAVRAGKIPATPASAGKVTYKVDDITFLMKAKESAP* |
| Ga0079222_121369802 | 3300006755 | Agricultural Soil | GAHNIPVASASVLPRLVSAFEAVRAGKVAGKPAPGGKILYTVNGITFLMRAP* |
| Ga0075434_1025905311 | 3300006871 | Populus Rhizosphere | IPVAQPKVLSELVSTFDEVRAGKVPPAPDSPGKVRYKVGEIVFLMRAPNK* |
| Ga0075436_1006699982 | 3300006914 | Populus Rhizosphere | PRLVAAFDIVRAGKATPTPESPGRVLYKVDNIPFLMRAPGK* |
| Ga0116214_11421602 | 3300009520 | Peatlands Soil | AVLARLVAAFDAVRAGKVTATPDSPGKVLYKVDDISFLMRAPDKTPHPQP* |
| Ga0116222_15115581 | 3300009521 | Peatlands Soil | VLARLVTAFDAVRAGKVTATPDSPGKVLYKVDDISFLMRAPDKTRHPQP* |
| Ga0105237_114863701 | 3300009545 | Corn Rhizosphere | SVLPRLVSAFDAVRAGKVAGKPAPGGKILYTVNGIIFLMHAP* |
| Ga0116216_107261602 | 3300009698 | Peatlands Soil | LVAAFDKVRVGKVLPEPDSPGKVLYKVDDISFLMRAPGSR* |
| Ga0116219_103916242 | 3300009824 | Peatlands Soil | FAFEAVRAGKVPPAPASSGKVLYKVDDFSFLMQAPPSKL* |
| Ga0123355_105622682 | 3300009826 | Termite Gut | FDAVRAGKIQPSPDSPGKVLYKVDDISFLMRAPAAH* |
| Ga0116223_107495401 | 3300009839 | Peatlands Soil | RLVAAFDKVRAWKVLPEPDSPGKVLYKVDDISFLMRAPGSR* |
| Ga0126372_118986242 | 3300010360 | Tropical Forest Soil | AAFDAVRSGKVPPTPADPGQVIYTADGISFLMRAPDAKTN* |
| Ga0126381_1009482792 | 3300010376 | Tropical Forest Soil | DQVRAGKVPATPGEDGKVLYKVGNISFLMRAPQKATK* |
| Ga0126381_1048843281 | 3300010376 | Tropical Forest Soil | LVAAFDAVRAGKIQPSPDSPGKVLYKVDDISFLMRAPAAH* |
| Ga0136449_1010506511 | 3300010379 | Peatlands Soil | AVLARLVAAFDAVRAGKVTATPDSPGKVLYKVDDISFLMRAPTPHQQP* |
| Ga0137365_103946061 | 3300012201 | Vadose Zone Soil | LPRLVTAFQTVRAGKASATPAAAGRVIYKVDDISFLMRSPESKH* |
| Ga0137378_107093531 | 3300012210 | Vadose Zone Soil | AFDKVQSGKVPAVPNSPGKVLYKVDGVSFLMRPPSH* |
| Ga0137371_104271842 | 3300012356 | Vadose Zone Soil | SVLPRLVTAFQTVRAGKASATPAAAGRVIYKVDDISFLMRSPESKH* |
| Ga0137390_111665101 | 3300012363 | Vadose Zone Soil | RIVAAFDAVRAGKIQPSPDSPGKVLYKVDDISFLMRAPAAH* |
| Ga0150984_1089707475 | 3300012469 | Avena Fatua Rhizosphere | GLVVAFDKVQAGKVPAVADSPGKVLYKVDGFSFLMRTPSH* |
| Ga0181518_106058241 | 3300014156 | Bog | AAFDAVRAGRVPATPAEAGKVIYTVDDISFLMRGP* |
| Ga0181538_107294761 | 3300014162 | Bog | TRLVTAFEAVRAGRIPATPAEPGKVIYKVGDISFLMRAPE* |
| Ga0181531_102928843 | 3300014169 | Bog | FDEVRAGKVQPTPAGDGKVLYKVGDISFLMKAPAAR* |
| Ga0181526_105312692 | 3300014200 | Bog | VAAFDAVRAGNIQPSPDSPGKVLYKVDVPLMRAPAAR* |
| Ga0182018_102352192 | 3300014489 | Palsa | VVMGAHNIPVASPTLLPRLVAAFDAVRAGKVQPSPDSPGKALYKVDEISFVMRAPAEH* |
| Ga0181509_13752482 | 3300016701 | Peatland | APPSVLASLVQAFDVIRAGKVRPAPASRGKITYKVDDISFMMAAP |
| Ga0187781_106475312 | 3300017972 | Tropical Peatland | SILPKLVSAFDAVRAGKISPTPDSPSRVLYKVGDISFLMRTPPP |
| Ga0187780_101786521 | 3300017973 | Tropical Peatland | PSVLARLVAAFDVVRAGKVAATPDSPGKVLYKVEDISFLMRAPDATNRHKP |
| Ga0187804_102892991 | 3300018006 | Freshwater Sediment | HNIPVASPAVLARLVSAFDLVRGGKVAPTPDSPGKVLYKVDDISFVMKKPDTP |
| Ga0187788_104240931 | 3300018032 | Tropical Peatland | KLVTAFDVVRAGQVKAEPASPGKVLYKVDDITFLMKAPEAKP |
| Ga0187851_102380992 | 3300018046 | Peatland | VLQHLVVAFETVRAGKIAPVAAGKGKVTYKVGDISFLMRAP |
| Ga0187772_104698261 | 3300018085 | Tropical Peatland | LVSAFDKVQAGKVAPTPDSPGKVLYRVNGFSFVMKTPDTP |
| Ga0187772_113492601 | 3300018085 | Tropical Peatland | SAFDEVRAGRIATSPASAGRVLYKVDEFSFLMRAPASR |
| Ga0066662_100357191 | 3300018468 | Grasslands Soil | RLVTAFEAVRAGKVAGTPQAEGKMLYKVGDISFLMRAPSSH |
| Ga0066669_109402372 | 3300018482 | Grasslands Soil | SVLPRLVTAFQTVRAGKTSATPAAAGRVIYKVDDISFLMRSPESKH |
| Ga0210407_107058562 | 3300020579 | Soil | AFNAVRAGKVQPSPDSPGKVLYKADDISFLMRAPPAH |
| Ga0210399_109145051 | 3300020581 | Soil | DAGRAGKIKPLPDSPGKVLYKVEDISFLMRAPTAH |
| Ga0210395_108171602 | 3300020582 | Soil | FDQVRAGKIAATPDSPGKVLYKVDDISFLMRAPDATNHQKP |
| Ga0210401_101648411 | 3300020583 | Soil | AHNIPVAKPDVLPRLVTAFDAVRAGKVTPTPASSEKVLYKINDITFLMRAPESKP |
| Ga0210401_107487352 | 3300020583 | Soil | TILPRLVAAFNAVRAGKVQPSPDSPGKVLYKADDISFLMRAPPAH |
| Ga0210406_112004841 | 3300021168 | Soil | IPVASPTLLPRLVAAFDAVRAGKVQPSPDSSGKVLYKVDDISFLMNPPAAH |
| Ga0210400_101634261 | 3300021170 | Soil | FDAVRADKVTLKPASPGKVTYEIDGITFLMKAPEPKP |
| Ga0210400_111817451 | 3300021170 | Soil | LVAAFDAVRAGKVMPTADSPGKVLYNIGDISFLMRAPQGK |
| Ga0210408_105477251 | 3300021178 | Soil | AVRTGQVTPKPASSGKVTYEIDGITFLMKAPEPKP |
| Ga0210396_102628441 | 3300021180 | Soil | ASPTLLPRLVAAFDAVRAGKVQPSPDSSGRVLYKVDDISFLMNPPAAH |
| Ga0210387_101491944 | 3300021405 | Soil | NIPVASPDVLSRLVTAFDEVRAGKVLSTPDSAGKVLYKVGDITFLMKPPAAAAR |
| Ga0210387_107362992 | 3300021405 | Soil | PAFDSVRAGKVSPIPESPGKVLYRVDDISFLMRATDTR |
| Ga0210386_109368422 | 3300021406 | Soil | AAFDAVRAGKVQPSPDSSGKVLYKVDDISFLMNPPAAH |
| Ga0210386_114673932 | 3300021406 | Soil | VAAFDAVRAGKVQPSPDSSGKVLYKVDDISFLMNPPAAH |
| Ga0210391_104291902 | 3300021433 | Soil | TVLPRLVAAFDAVRAGKVQPSPDSPGKVLYKVDGISFLMLAPAAH |
| Ga0210390_101770031 | 3300021474 | Soil | NVPVASPAQLPKLVAAFDAVRAGKVQPLPDSPGKVLYKVDGISFLMRAAAAH |
| Ga0210398_100282931 | 3300021477 | Soil | PRLVVAFDAVRAGKIKPVSDSPGKVLYKAGDISFLMRDPAAR |
| Ga0210402_111874832 | 3300021478 | Soil | FNAVRAGKVQPSPDSLGKVLYKADDISFLMRAPPAH |
| Ga0210409_101899162 | 3300021559 | Soil | PIASPTVLPRLVAAFDAVRAGKVQPSPDSPGKVLYKVDGISFMMLAPAAH |
| Ga0213853_102772711 | 3300021861 | Watersheds | AAMRSGKVTPTPDSPGKVLYKVGDISFLVAAPTAK |
| Ga0242669_10768782 | 3300022528 | Soil | ASPAVLGQLVSAFDKVQFRKVPAVPESPGKVLYKVDGFSFLMSTDSR |
| Ga0224564_10064891 | 3300024271 | Soil | AHNIPVAPPPVLPRLVAAFDAVRAGKVSASPDSPGKAIYKIDNISFLMRAPPAAH |
| Ga0207416_12220252 | 3300025134 | Iron-Sulfur Acid Spring | RLRVVMGAHNIPVASPTLLPRLVAAFDAVRGGKVQPSPDSPGKVLYKVDDISFVIRAPSA |
| Ga0207646_116128082 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AFDAVRAGKVRPVPASPGKVLYTVGDISFLMRANTR |
| Ga0207700_117495731 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLGAHNIPVAPASVLPSLVSAFDAVRAGKVSGTAAPGGKVLYTVNGSTFLMRAP |
| Ga0207664_116056332 | 3300025929 | Agricultural Soil | LGAHNIPVASASVLPRLVSAFDAVRAGKVAGKPAPGGKILYILNGITFLMRAP |
| Ga0207665_100634255 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KLVTAFDAVRTGKVVPTAASPGKVLYKVDDISFLMRAPATH |
| Ga0207679_107526361 | 3300025945 | Corn Rhizosphere | NVPVAPASVLPRLVAAFDAVRAGKVAGTPAPGGKVLYTVNGITFLMRAP |
| Ga0207674_107952961 | 3300026116 | Corn Rhizosphere | RLVSAFEAARAGKVAGKPAPGGKILYTVNGITFLMRAP |
| Ga0209803_12683332 | 3300026332 | Soil | LQTVRAGKTSATPAAAGRVIYKVDDISFLMRSPESKH |
| Ga0209378_10038341 | 3300026528 | Soil | PSVLPRLVTAFQTVRAGKTSATPAAAGRVIYKVDDISFLMRSPESKH |
| Ga0207856_10360741 | 3300026983 | Tropical Forest Soil | AHNVPVAPPSVLGRLVAAFDRVHAGKVAAIPDSPGKVLYKIDGFSFLMRSGTP |
| Ga0208324_12025541 | 3300027604 | Peatlands Soil | LVAAFDEVRAGKTKPTPDSPGKVLYKVEDISFLMHAPAGH |
| Ga0209420_10732731 | 3300027648 | Forest Soil | TVLARLVVAFDAVRAGKIKPVPDSPGKALYKVDDISFLMRDSAAH |
| Ga0209275_108482892 | 3300027884 | Soil | PRLVAAFDVVRAGKVQPSPDSPGKVLYKVDDISFLMNAPAAH |
| Ga0209624_102436722 | 3300027895 | Forest Soil | AAFDAVEAGKIPATANSPGRVIYTVGDISFLMRAPK |
| Ga0302234_104659032 | 3300028773 | Palsa | AFDEVRAGTIRPVPDSSGNVLYKVDDISFLMRAPTAH |
| Ga0302228_105235812 | 3300028808 | Palsa | SPTVLGRLVAAFDEVRAGTIRPVPDSSGNVLYKVDDISFLMRAPTAH |
| Ga0308309_103533682 | 3300028906 | Soil | SVLPRLVEAFDAVRAGKVTATPDSPGKVLYKVGDLSFLMRAPTTP |
| Ga0310038_103479312 | 3300030707 | Peatlands Soil | LVAAFDQVRAGKVLPEPDSPGKVLYKVDDFSFLMRAPGSR |
| Ga0170824_1039229581 | 3300031231 | Forest Soil | LVAAFDAVRAGKVAATPDSPGKVLYKVDDISFLMRAPTVH |
| Ga0170824_1176801812 | 3300031231 | Forest Soil | LAQLVTAFDGVRAGKVAATPDSLGKVLYKVGDISFLMRTPDAH |
| Ga0302325_106432041 | 3300031234 | Palsa | ASPTVLPRLASAFDRVRAGKATPTPDSPGYVIYKVDGFSFLMRAPAAH |
| Ga0170820_109129392 | 3300031446 | Forest Soil | SPTVLPRLVAAFDAVRAGKVAATPDSPGKVLYKVDGISFLMRAPTVH |
| Ga0170820_171988792 | 3300031446 | Forest Soil | VLSRLVLAFAAVRAGKVPAVPESPGKVIYKVDGISFLMKSPASAAR |
| Ga0318541_108470141 | 3300031545 | Soil | DVLTKLVLAFAAVRAGKIQPLPDSPERVVYKVGDISFLMRAPTAHLR |
| Ga0307474_105046712 | 3300031718 | Hardwood Forest Soil | PVASPAVLQQLVAAFETVRAGKVAAIPAGAGKATYKVGAISFLMRAP |
| Ga0307516_110147741 | 3300031730 | Ectomycorrhiza | FDGVRAGKVAATPDSPGKVLYKVGDISFLMRTPDAH |
| Ga0318492_106642232 | 3300031748 | Soil | TVLPRLVAAFDAVRAGKIQPSPDSPGKVLYKVDDISFLMRAPTAH |
| Ga0310917_100315613 | 3300031833 | Soil | LVAAFDAVRAGKIQPSPDSPGKVLYKVDDISFLMRAPAAH |
| Ga0310910_101865601 | 3300031946 | Soil | IFPSHLVAAFDAVRAGKIQPSPDSPGKVLYKVDDISFLMRAPTAHLR |
| Ga0307479_118167891 | 3300031962 | Hardwood Forest Soil | EQLVSAFDKVQSGKVTGAPDSPGKVLYKVDGVSFLMRAPSH |
| Ga0306922_103904041 | 3300032001 | Soil | SRPDVLPRLVTAFDQVRAGKVAPTPATDSKVLYKVDGFSFLMRPISR |
| Ga0318533_110492521 | 3300032059 | Soil | FRPETDLDARLVTAFDVVRAGKVPPSPDSPGKVLYKVDDISFLMRAPAAH |
| Ga0311301_102929601 | 3300032160 | Peatlands Soil | LVTAFDAVRAGKVTPTPDSPGKVLYKVGDISFLMRAPAAH |
| Ga0311301_108423971 | 3300032160 | Peatlands Soil | AAFDAVRAAKVTATPDSPGKVLYKVDDISFLMRAPTPHQQP |
| Ga0307470_100303385 | 3300032174 | Hardwood Forest Soil | PRLVTAFDAVRAGKVLPTPDSPGKVLYKVDDISFLMRAPLAH |
| Ga0307472_1001293111 | 3300032205 | Hardwood Forest Soil | GAHNIPVAQPEVLGKLVTAFDAVRAGKIAPEPASPGKVLYKTEGITFLMRPPDAK |
| Ga0335079_114455561 | 3300032783 | Soil | PSVLPRLVTAFEKVRAGKVTAIPESEGKVTYKVDGFSFLMRAPSNQK |
| Ga0335078_118857862 | 3300032805 | Soil | LGAHNIPVAEAKVLIELVSAFETVRAGRVAPTPDSPGTVRYKVGDIVFLMRATNR |
| Ga0335080_109431052 | 3300032828 | Soil | EPSVLPRLVTAFDAVRAGTVKPEPEPPGKVLYKIDGFTFLMKAPQ |
| Ga0335084_111637872 | 3300033004 | Soil | ASPSVLGQLVLAFDKLQSGKVPADPVSGGKVLYRVDGFSFLMRAPAR |
| Ga0335077_104636774 | 3300033158 | Soil | ELVSSFDVVRAGKVVPTPDSPGRVRYKVGDIVFLMRAPNK |
| Ga0314867_044985_908_1033 | 3300033808 | Peatland | LVAAFDAVRAGQVAAKPASAGKVTYTVDDITFLMPAPEAKP |
| ⦗Top⦘ |