


| Basic Information | |
|---|---|
| Family ID | F072115 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTHTTPTLLEVLSYLTDPTFTSVVVLVVGTFAALTAINKIGGAR |
| Number of Associated Samples | 61 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 38.02 % |
| % of genes near scaffold ends (potentially truncated) | 19.01 % |
| % of genes from short scaffolds (< 2000 bps) | 76.86 % |
| Associated GOLD sequencing projects | 55 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.207 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (34.711 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.066 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (41.322 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF12728 | HTH_17 | 57.85 |
| PF13392 | HNH_3 | 4.13 |
| PF00145 | DNA_methylase | 3.31 |
| PF14090 | HTH_39 | 2.48 |
| PF00589 | Phage_integrase | 1.65 |
| PF01807 | zf-CHC2 | 0.83 |
| PF03796 | DnaB_C | 0.83 |
| PF13730 | HTH_36 | 0.83 |
| PF01507 | PAPS_reduct | 0.83 |
| PF08308 | PEGA | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 3.31 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.83 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.83 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.21 % |
| All Organisms | root | All Organisms | 24.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2020350000|Qingha_contig18513 | Not Available | 568 | Open in IMG/M |
| 2022920000|QLn_FQAYR3Y02QV8O7 | Not Available | 516 | Open in IMG/M |
| 2199352018|QLA_contig20795.20795 | Not Available | 715 | Open in IMG/M |
| 3300002161|JGI24766J26685_10017135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium | 1863 | Open in IMG/M |
| 3300002202|metazooDRAFT_1243625 | Not Available | 561 | Open in IMG/M |
| 3300002203|metazooDRAFT_1296601 | Not Available | 625 | Open in IMG/M |
| 3300002212|metazooDRAFT_1372189 | Not Available | 668 | Open in IMG/M |
| 3300002408|B570J29032_109127405 | Not Available | 604 | Open in IMG/M |
| 3300002408|B570J29032_109239291 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 649 | Open in IMG/M |
| 3300002408|B570J29032_109262276 | Not Available | 660 | Open in IMG/M |
| 3300002408|B570J29032_109355495 | Not Available | 709 | Open in IMG/M |
| 3300002835|B570J40625_100637847 | Not Available | 967 | Open in IMG/M |
| 3300005805|Ga0079957_1052773 | Not Available | 2477 | Open in IMG/M |
| 3300005805|Ga0079957_1372065 | Not Available | 616 | Open in IMG/M |
| 3300006802|Ga0070749_10291497 | Not Available | 917 | Open in IMG/M |
| 3300006802|Ga0070749_10591228 | Not Available | 599 | Open in IMG/M |
| 3300007212|Ga0103958_1094172 | Not Available | 1224 | Open in IMG/M |
| 3300007538|Ga0099851_1061614 | Not Available | 1463 | Open in IMG/M |
| 3300007538|Ga0099851_1086312 | Not Available | 1205 | Open in IMG/M |
| 3300007539|Ga0099849_1225090 | Not Available | 697 | Open in IMG/M |
| 3300007541|Ga0099848_1023941 | All Organisms → cellular organisms → Bacteria | 2585 | Open in IMG/M |
| 3300007541|Ga0099848_1227194 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 660 | Open in IMG/M |
| 3300007541|Ga0099848_1237633 | Not Available | 641 | Open in IMG/M |
| 3300007541|Ga0099848_1248402 | Not Available | 623 | Open in IMG/M |
| 3300007541|Ga0099848_1295590 | Not Available | 557 | Open in IMG/M |
| 3300007541|Ga0099848_1298352 | Not Available | 553 | Open in IMG/M |
| 3300007542|Ga0099846_1100943 | Not Available | 1062 | Open in IMG/M |
| 3300007542|Ga0099846_1227612 | Not Available | 652 | Open in IMG/M |
| 3300007542|Ga0099846_1266727 | Not Available | 592 | Open in IMG/M |
| 3300007960|Ga0099850_1204247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 776 | Open in IMG/M |
| 3300007960|Ga0099850_1206927 | Not Available | 770 | Open in IMG/M |
| 3300007960|Ga0099850_1298166 | Not Available | 612 | Open in IMG/M |
| 3300008448|Ga0114876_1016046 | Not Available | 4033 | Open in IMG/M |
| 3300010354|Ga0129333_10433031 | Not Available | 1160 | Open in IMG/M |
| 3300010354|Ga0129333_10626396 | Not Available | 931 | Open in IMG/M |
| 3300010354|Ga0129333_10633911 | Not Available | 925 | Open in IMG/M |
| 3300010354|Ga0129333_11100616 | Not Available | 663 | Open in IMG/M |
| 3300010354|Ga0129333_11277505 | Not Available | 607 | Open in IMG/M |
| 3300010354|Ga0129333_11392649 | Not Available | 577 | Open in IMG/M |
| 3300010354|Ga0129333_11647596 | Not Available | 523 | Open in IMG/M |
| 3300010370|Ga0129336_10241795 | Not Available | 1016 | Open in IMG/M |
| 3300010370|Ga0129336_10295098 | Not Available | 902 | Open in IMG/M |
| 3300011984|Ga0119931_1037213 | Not Available | 583 | Open in IMG/M |
| 3300012000|Ga0119951_1042559 | Not Available | 1361 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10116679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1973 | Open in IMG/M |
| 3300017774|Ga0181358_1194937 | Not Available | 666 | Open in IMG/M |
| 3300017774|Ga0181358_1258841 | Not Available | 544 | Open in IMG/M |
| 3300019784|Ga0181359_1013932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 2940 | Open in IMG/M |
| 3300019784|Ga0181359_1048995 | Not Available | 1630 | Open in IMG/M |
| 3300019784|Ga0181359_1058277 | Not Available | 1482 | Open in IMG/M |
| 3300019784|Ga0181359_1077407 | Not Available | 1251 | Open in IMG/M |
| 3300020048|Ga0207193_1115516 | Not Available | 2379 | Open in IMG/M |
| 3300020506|Ga0208091_1018920 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 806 | Open in IMG/M |
| 3300020543|Ga0208089_1005914 | Not Available | 2202 | Open in IMG/M |
| 3300020553|Ga0208855_1002135 | Not Available | 4326 | Open in IMG/M |
| 3300020554|Ga0208599_1005525 | Not Available | 2237 | Open in IMG/M |
| 3300020556|Ga0208486_1018090 | Not Available | 1085 | Open in IMG/M |
| 3300022176|Ga0212031_1071982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300022190|Ga0181354_1015418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2347 | Open in IMG/M |
| 3300022190|Ga0181354_1126744 | Not Available | 816 | Open in IMG/M |
| 3300022198|Ga0196905_1107310 | Not Available | 741 | Open in IMG/M |
| 3300023174|Ga0214921_10021904 | All Organisms → cellular organisms → Bacteria | 6757 | Open in IMG/M |
| 3300025647|Ga0208160_1110081 | Not Available | 705 | Open in IMG/M |
| 3300025655|Ga0208795_1049561 | Not Available | 1246 | Open in IMG/M |
| 3300025687|Ga0208019_1205941 | Not Available | 511 | Open in IMG/M |
| 3300027793|Ga0209972_10098529 | Not Available | 1472 | Open in IMG/M |
| 3300027805|Ga0209229_10004300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5939 | Open in IMG/M |
| 3300027805|Ga0209229_10021297 | Not Available | 2800 | Open in IMG/M |
| 3300027805|Ga0209229_10067161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
| 3300027805|Ga0209229_10115872 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1208 | Open in IMG/M |
| 3300027805|Ga0209229_10133637 | Not Available | 1119 | Open in IMG/M |
| 3300027805|Ga0209229_10274568 | Not Available | 747 | Open in IMG/M |
| 3300027805|Ga0209229_10296110 | Not Available | 714 | Open in IMG/M |
| 3300029930|Ga0119944_1018507 | Not Available | 966 | Open in IMG/M |
| 3300029933|Ga0119945_1031201 | Not Available | 604 | Open in IMG/M |
| 3300031787|Ga0315900_10018544 | Not Available | 8166 | Open in IMG/M |
| 3300031787|Ga0315900_10204345 | Not Available | 1745 | Open in IMG/M |
| 3300031787|Ga0315900_10298401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium | 1337 | Open in IMG/M |
| 3300031857|Ga0315909_10418401 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 954 | Open in IMG/M |
| 3300033816|Ga0334980_0000446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19294 | Open in IMG/M |
| 3300033816|Ga0334980_0047520 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1818 | Open in IMG/M |
| 3300033816|Ga0334980_0093516 | Not Available | 1253 | Open in IMG/M |
| 3300033981|Ga0334982_0145100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1213 | Open in IMG/M |
| 3300033981|Ga0334982_0153682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1170 | Open in IMG/M |
| 3300033981|Ga0334982_0212503 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300033993|Ga0334994_0336132 | Not Available | 753 | Open in IMG/M |
| 3300033993|Ga0334994_0384450 | Not Available | 683 | Open in IMG/M |
| 3300033995|Ga0335003_0000132 | Not Available | 39841 | Open in IMG/M |
| 3300034012|Ga0334986_0275005 | Not Available | 904 | Open in IMG/M |
| 3300034012|Ga0334986_0390027 | Not Available | 711 | Open in IMG/M |
| 3300034019|Ga0334998_0253038 | Not Available | 1067 | Open in IMG/M |
| 3300034061|Ga0334987_0135336 | Not Available | 1830 | Open in IMG/M |
| 3300034062|Ga0334995_0003686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15672 | Open in IMG/M |
| 3300034062|Ga0334995_0052434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 3327 | Open in IMG/M |
| 3300034062|Ga0334995_0068892 | Not Available | 2795 | Open in IMG/M |
| 3300034062|Ga0334995_0330410 | Not Available | 985 | Open in IMG/M |
| 3300034073|Ga0310130_0018543 | Not Available | 2248 | Open in IMG/M |
| 3300034073|Ga0310130_0214535 | Not Available | 601 | Open in IMG/M |
| 3300034082|Ga0335020_0001322 | Not Available | 17456 | Open in IMG/M |
| 3300034082|Ga0335020_0008147 | Not Available | 6454 | Open in IMG/M |
| 3300034092|Ga0335010_0141125 | Not Available | 1540 | Open in IMG/M |
| 3300034092|Ga0335010_0201539 | Not Available | 1213 | Open in IMG/M |
| 3300034092|Ga0335010_0544424 | Not Available | 600 | Open in IMG/M |
| 3300034096|Ga0335025_0015912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5318 | Open in IMG/M |
| 3300034096|Ga0335025_0040230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3116 | Open in IMG/M |
| 3300034101|Ga0335027_0016249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6395 | Open in IMG/M |
| 3300034101|Ga0335027_0026530 | Not Available | 4864 | Open in IMG/M |
| 3300034101|Ga0335027_0066274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2857 | Open in IMG/M |
| 3300034101|Ga0335027_0091752 | Not Available | 2338 | Open in IMG/M |
| 3300034101|Ga0335027_0135042 | Not Available | 1832 | Open in IMG/M |
| 3300034101|Ga0335027_0698584 | Not Available | 602 | Open in IMG/M |
| 3300034101|Ga0335027_0822801 | Not Available | 536 | Open in IMG/M |
| 3300034101|Ga0335027_0857491 | Not Available | 520 | Open in IMG/M |
| 3300034104|Ga0335031_0169035 | Not Available | 1501 | Open in IMG/M |
| 3300034104|Ga0335031_0227466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1249 | Open in IMG/M |
| 3300034106|Ga0335036_0025060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 4746 | Open in IMG/M |
| 3300034106|Ga0335036_0653907 | Not Available | 629 | Open in IMG/M |
| 3300034106|Ga0335036_0820252 | Not Available | 536 | Open in IMG/M |
| 3300034112|Ga0335066_0205701 | Not Available | 1163 | Open in IMG/M |
| 3300034112|Ga0335066_0334552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium | 845 | Open in IMG/M |
| 3300034166|Ga0335016_0271292 | Not Available | 1056 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 34.71% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.18% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.44% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.44% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 6.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.31% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 2.48% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.65% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.65% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.65% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.83% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.83% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2020350000 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (assembled) | Environmental | Open in IMG/M |
| 2022920000 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled) | Environmental | Open in IMG/M |
| 2199352018 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau -Sample 11630 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300002203 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013 | Environmental | Open in IMG/M |
| 3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Qinghai_72970 | 2020350000 | Saline Water | FTTTMTNPTPLEVLSYLTDGTFVTVVAVLVIGFIILNALNRIGGRR |
| QL_na_7816100 | 2022920000 | Saline Water | MEAATVWRFTTTMTNPTPLEVLSYLTDGTFVTVVAVLVIGFIILNALNRIGG |
| QLA_00633080 | 2199352018 | Saline Water | MTNPTPLEVLSYLTDGTFVTVVAVLVIGFIILNALNRIGGRR |
| JGI24766J26685_100171354 | 3300002161 | Freshwater And Sediment | MTTPTLLEVLSYITDPVFTTVIVITIGTFAALNAINKIGGAR* |
| metazooDRAFT_12436251 | 3300002202 | Lake | EVLSYLTDPVFTTVVVLTIGTFAALQLINKLGGAR* |
| metazooDRAFT_12966012 | 3300002203 | Lake | MSTLEVLSYLTDPVFTAVVALTIGTFVALEAINKMGGRP* |
| metazooDRAFT_13721892 | 3300002212 | Lake | MSTLEVLSYLTDPVFTAVVALTIGTFVALEAINKIGGRP* |
| B570J29032_1091274052 | 3300002408 | Freshwater | MSALEVFSYLTDTTFTTVVLLTIGTFAALQFINKIGGAR* |
| B570J29032_1092392912 | 3300002408 | Freshwater | MSALEVLSYLTDPVFCTVVVLSVGTFVALEIINKIGGAR* |
| B570J29032_1092622763 | 3300002408 | Freshwater | MTPHHTPTLLEVLSYLTDPVFTTVIVLTIGTFAALQFINKIGGAR* |
| B570J29032_1093554952 | 3300002408 | Freshwater | MTNTTHTTLEVLSYLADPTFTVVVVLVVGAFAALTAINKIGGAR* |
| B570J40625_1006378472 | 3300002835 | Freshwater | MSALEALSYLTDATFVSLVVLLVIGFIALNAINKIGGRR* |
| Ga0079957_10527736 | 3300005805 | Lake | MTPHHTPTLLEVLSYLTDPVFTTVVVLTIGTFAALQFINRIGGAQ* |
| Ga0079957_13720652 | 3300005805 | Lake | MTHHTTPTLLEVLSYITDPVFTTVVVLTVGTFAALTAINRIGGAR* |
| Ga0070749_102914973 | 3300006802 | Aqueous | MTHHTTPTMLEVLSYLTDPTFTTVVVLVVGTYAALQAANRIGGAK* |
| Ga0070749_105912282 | 3300006802 | Aqueous | MTHHTTPTLLEVLSYLTDPTFTAVVVLVVGTYAALEAVNRIGGAR* |
| Ga0103958_10941723 | 3300007212 | Freshwater Lake | MTNTTPTLLEVLSYLTDPVFTTVVVLAVGTFAALNAINRIGGAR* |
| Ga0099851_10616144 | 3300007538 | Aqueous | MKHHTTPTLLEVLSYLTDATFTSVVVATVAFAFTLQVINRIGGAK* |
| Ga0099851_10863125 | 3300007538 | Aqueous | SMTHTTPTMLEVLSYLTDATFTSVVVATIAFAFTLQAINRIGGAR* |
| Ga0099849_12250902 | 3300007539 | Aqueous | MTHHTTPTLLEVMSYLTDATFTSVVVATIAFAFTLQAINRIGGAK* |
| Ga0099848_10239416 | 3300007541 | Aqueous | MSALEVLSYLTDSTFTTVVVLTISTFAALQFIERIGGAK* |
| Ga0099848_12271941 | 3300007541 | Aqueous | QALSMTHHTTPTLLEVASYLTDATFTSVVVATIAFAFTLQAINRIGGAK* |
| Ga0099848_12376332 | 3300007541 | Aqueous | MTHHTTPTLLEVLSYPTDATFTSVVVATIAFAFTLQAINRIGGAR* |
| Ga0099848_12484023 | 3300007541 | Aqueous | QALSMTHHTTPTLLEVASYLTDATFTSVVVATIAFAFTLQVINRIGGAR* |
| Ga0099848_12955902 | 3300007541 | Aqueous | MTHHTPTMLEVLSYLTDPTFTAVVVLVVGTYAALEAVNRIGGAK* |
| Ga0099848_12983521 | 3300007541 | Aqueous | MTHHTTPTLLEVASYLTDATFTSVVVATIAFAFTLQ |
| Ga0099846_11009432 | 3300007542 | Aqueous | MSALEVFSYLTDSTFTTVVVLTISTFAALQFIERIGGAK* |
| Ga0099846_12276122 | 3300007542 | Aqueous | MTHHTTPTLLEVLSYLTDATFTSVVVATIAFAFTLQAINRIGGAR* |
| Ga0099846_12667273 | 3300007542 | Aqueous | MTHTTPTLLEVLSYLTDATFTSVVVATIAFAFTLQAINRIGGAR* |
| Ga0099850_12042472 | 3300007960 | Aqueous | MTHHTTPTPLEVMSYLTDATFTSVVVATIAFAFTLQAISRIGGAK* |
| Ga0099850_12069271 | 3300007960 | Aqueous | TTSTPLEVLSYLTDATFTSVVVATIAFAFTLQAINRIGGAR* |
| Ga0099850_12981662 | 3300007960 | Aqueous | MTHHTTPTMLEVLSYLTDPTFTAVVVLVVGTYAALEAVNRIGGAK* |
| Ga0114876_101604610 | 3300008448 | Freshwater Lake | MTQSTLLEVLSYLTDPVFTTVVVLVVGTFAALNAINRIGGAK* |
| Ga0129333_104330312 | 3300010354 | Freshwater To Marine Saline Gradient | MPTDAIRLSMTHTTPTLLEVLSYLTDPTFTSVVVLVVGTFAALTAINRIGGRP* |
| Ga0129333_106263963 | 3300010354 | Freshwater To Marine Saline Gradient | MPSFAFLMTPHHTPTLLEVLSYLTDPVFTTVVVLTIGTFAALTAIHKIGGAR* |
| Ga0129333_106339113 | 3300010354 | Freshwater To Marine Saline Gradient | MPSFAKTLMHTTHTTPLEVLSYLTDPVFTTVVVLVVGAFAALEAINRIGGAK* |
| Ga0129333_111006163 | 3300010354 | Freshwater To Marine Saline Gradient | MTHHTTPTLLEVLSYLTDTTFTSVVVATIAFAFTLQ |
| Ga0129333_112775052 | 3300010354 | Freshwater To Marine Saline Gradient | MTHHTTPTLLEVLSYLTDPVFTTVIVLTIGTFAALLFINKIGGAR* |
| Ga0129333_113926492 | 3300010354 | Freshwater To Marine Saline Gradient | MTNTTPTLLEVLGYITDPVFTTVVVLTVGTFAALTAINRIGGRP* |
| Ga0129333_116475962 | 3300010354 | Freshwater To Marine Saline Gradient | MSALEVFSYLTDPTFTAVIVLTIGTFVALQFIDRIGGAQ* |
| Ga0129336_102417952 | 3300010370 | Freshwater To Marine Saline Gradient | MPSFAFLMTHHTTPTLLEVLSYLTDPVFTTVVVLTVGTFAALTAINRIGGRP* |
| Ga0129336_102950982 | 3300010370 | Freshwater To Marine Saline Gradient | MPRFAFLMTPHHTPTLLEVLSYLTDPVFTTVIVLTIGTFAALQFINRIGGAQ* |
| Ga0119931_10372133 | 3300011984 | Drinking Water Treatment Plant | MTSLEVLSYLTDSTFTTVVILVVGTFAALQAIHRIGGAK* |
| Ga0119951_10425595 | 3300012000 | Freshwater | MTHTTHTTLEVLSILTDPTFTAVVVLVVGTFAALTAIHKIGGAR* |
| (restricted) Ga0172373_101166793 | 3300013131 | Freshwater | MTPLEVLSYLTDTTFTTIVLLVVGTFVALEAINKIGGAK* |
| Ga0181358_11949372 | 3300017774 | Freshwater Lake | MTPTPLEVLSYLTDATFMSLVVLLVIGFIALSAINKIGGRR |
| Ga0181358_12588412 | 3300017774 | Freshwater Lake | MTHPTPLEVLSYLTDATFVSLVVLLVVGFIALNAINKIGGRR |
| Ga0181359_10139326 | 3300019784 | Freshwater Lake | MTPTPLEVLSYLTDATFVSLVVLLVVGFVALNAINKIGGQR |
| Ga0181359_10489955 | 3300019784 | Freshwater Lake | MTPTPLEVISYLTDATFVSLVVLLVIGFIALNAINKIGGRR |
| Ga0181359_10582774 | 3300019784 | Freshwater Lake | MSALEVLSYLTDPVFCTVVALAVGTFVALEIINKIGGAR |
| Ga0181359_10774072 | 3300019784 | Freshwater Lake | MTPHHTPTLLEVLSYLTDPVFATVIVLTIGTFVALEIINKIGGAR |
| Ga0207193_11155164 | 3300020048 | Freshwater Lake Sediment | MTPTPLEVLSYLTDATFVSLVVLLVIGFIALNAINKIGGRR |
| Ga0208091_10189202 | 3300020506 | Freshwater | MSALEVLSYLTDPVFCTVVVLSVGTFVALEIINKIGGAR |
| Ga0208089_10059142 | 3300020543 | Freshwater | MSALEALSYLTDATFVSLVVLLVIGFIALNAINKIGGRR |
| Ga0208855_10021356 | 3300020553 | Freshwater | MTNTTHTTLEVLSYLADPTFTVVVVLVVGAFAALTAINKIGGAR |
| Ga0208599_10055254 | 3300020554 | Freshwater | MSALEVFSYLTDTTFTTVVLLTIGTFAALQFINKIGGAR |
| Ga0208486_10180904 | 3300020556 | Freshwater | MSALEVLSYLTDPVFCTVVVLSVGTFVALEIINKIGGAK |
| Ga0212031_10719822 | 3300022176 | Aqueous | QRHQASMTHHTTPTLLEVMSYLTDATFTSVVVATIAFAFTLQAINRIGGAK |
| Ga0181354_10154184 | 3300022190 | Freshwater Lake | MPRFAFLMTPHHTPTLLEVLSYLTDPVFATVIVLTIGTFVALEIINKIGGAR |
| Ga0181354_11267442 | 3300022190 | Freshwater Lake | MTPTPLEVLSYLTDATFVSLVVLLVIGFIAINAINKIGGRR |
| Ga0196905_11073103 | 3300022198 | Aqueous | MTHHTTPTVLEVMSYLTDATFTSVVVATIAFAFTLQVINRIGGAR |
| Ga0214921_1002190414 | 3300023174 | Freshwater | MTHTTPTLLEVLSYLTDPTFTSVVVLVVGTFAALTAINKIGGAR |
| Ga0208160_11100812 | 3300025647 | Aqueous | MTHTTPTLLEVLSYLTDATFTSVVVATIAFAFTLQAINRIGGAR |
| Ga0208795_10495612 | 3300025655 | Aqueous | MTHHTTPTLLEVLSYLTDATFTSVVVATIAFAFTLQAINRIGGAR |
| Ga0208019_12059412 | 3300025687 | Aqueous | MTHTTPTMLEVLSYLTDATFTSVVVATIAFAFTLQAINRIGGAR |
| Ga0209972_100985294 | 3300027793 | Freshwater Lake | MTQPTLLEVLSYITDPVFTTVVVLTIGTFAALNAINKIGGAK |
| Ga0209229_100043004 | 3300027805 | Freshwater And Sediment | MTTPTLLEVLSYITDPVFTTVIVITIGTFAALNAINKIGGAR |
| Ga0209229_100212977 | 3300027805 | Freshwater And Sediment | MSTLEVLTYLTDSTFTSVVVVAVATFAALQAIHRIGGQR |
| Ga0209229_100671611 | 3300027805 | Freshwater And Sediment | ETTKHTTSMTQPTLLEVLSYITDPVFTTVVVLTIGTFAALNAINRIGGSK |
| Ga0209229_101158724 | 3300027805 | Freshwater And Sediment | MTPHHTPTLLEVLSYLTDPVFTTVIVLTIGTFAALQFINKIGGAR |
| Ga0209229_101336373 | 3300027805 | Freshwater And Sediment | MTTPTLLEVLSYITDPVFTTVVVLAVGTFAALNAINRIGGAK |
| Ga0209229_102745682 | 3300027805 | Freshwater And Sediment | MTQSTLLEVLSYLTDPVFTTVVVLVVGTFAALNAINRIGGAK |
| Ga0209229_102961103 | 3300027805 | Freshwater And Sediment | MTQPTLLEVLSYLTDPVFATVVVLTIGTFAALNAINKIGGAK |
| Ga0119944_10185072 | 3300029930 | Aquatic | MSTLEVLSYLTDPTFTTVLLLVFGTFGALQAIHRIGGAK |
| Ga0119945_10312012 | 3300029933 | Aquatic | MSTLEVLSYLTDSTFTTVVIFVVGAFAALNAIHKIGGAK |
| Ga0315900_1001854412 | 3300031787 | Freshwater | MTQPTLLEVLSYLTDTVFTTVVVLTIGTFAALNAINKIGGAK |
| Ga0315900_102043455 | 3300031787 | Freshwater | MTPHHTPTLLEVMSYLTDPVFTTVVVLTVGTFAALQFINKIGGAR |
| Ga0315900_102984012 | 3300031787 | Freshwater | MTQPTLLEVLSYITDPVFTTVVVITIGTFAALNAINRIGGAK |
| Ga0315909_104184013 | 3300031857 | Freshwater | MTIIEALTYLTDSTFTSVVVVAVATFAALQAIHRIGGRQ |
| Ga0334980_0000446_597_731 | 3300033816 | Freshwater | MTNTTHTTLEVLSYLTDPTFTVVVVLVVGAFAALTAINKIGGAR |
| Ga0334980_0047520_370_504 | 3300033816 | Freshwater | MTNTTHTLLEVLSYLTDPTFTVVVVLVVGAFAALTAINKIGGAR |
| Ga0334980_0093516_301_459 | 3300033816 | Freshwater | MPSFAFSMTHHTTPTLLEVLSYITDPVFTTVVVLTVGTFAALQFINKIGGAK |
| Ga0334982_0145100_231_389 | 3300033981 | Freshwater | MPSFAFLMTPHHTPTLLEVLSYLTDPVFTTVIVLTIGTFAALQFINKIGGAR |
| Ga0334982_0153682_346_480 | 3300033981 | Freshwater | MTNTTPTTLEVLSYLTDPTFTAVVVLVVGTFAALTAINKIGGAR |
| Ga0334982_0212503_147_281 | 3300033981 | Freshwater | MTNTTPTLLEVLGYLTDPVFTTVIVLTIGTFAALQFINKIGGAR |
| Ga0334994_0336132_632_751 | 3300033993 | Freshwater | MSALEALSYLTDTTFTTVVLLTIGTFAALQFINKIGGAR |
| Ga0334994_0384450_362_481 | 3300033993 | Freshwater | MSALEVFSYLTDPVFCTVVVLSVGTFVALELINKIGGAR |
| Ga0335003_0000132_5270_5395 | 3300033995 | Freshwater | MTPTPLEVLSYLTDATFMSLTGLLVVGFILLNAINKIGGRR |
| Ga0334986_0275005_554_673 | 3300034012 | Freshwater | MSALEVFSYLTDPVFCTVVVLAVGTFVALEIINKIGGAR |
| Ga0334986_0390027_304_423 | 3300034012 | Freshwater | MSALEVLSYLTDATFTTVVLLTIGTFAALQFINRIGGAK |
| Ga0334998_0253038_621_758 | 3300034019 | Freshwater | MTHHTTPTLLEVLSYLTDPVFTTVAVLTIGTFAALQFINKIGGAR |
| Ga0334987_0135336_1448_1582 | 3300034061 | Freshwater | MTNTTPTLLEVLSYLTDPTFTAVIVITIGTFAALQFINRIGGAR |
| Ga0334995_0003686_1310_1471 | 3300034062 | Freshwater | MPTDAIRLSMTNTTPTLLEVLSYLTDPTFTAVVVLVVGTFAALTAINKIGGAR |
| Ga0334995_0052434_385_543 | 3300034062 | Freshwater | MPRFAFLMTPHHTPTLLEVLSYLTDPVFTTVVVLTVGTFAALTAIHKIGGRP |
| Ga0334995_0068892_2408_2527 | 3300034062 | Freshwater | MSALEVLSYLTDPVFCTVVVLSVGTFVALELINKIGGAR |
| Ga0334995_0330410_2_115 | 3300034062 | Freshwater | ALEALSYLTDTTVTTVVLLTIGTFAALQFINKIGGAR |
| Ga0310130_0018543_1294_1452 | 3300034073 | Fracking Water | MPSFAFLMTPHHTPTLLEVLGYLTDPVFTTVIVLTIGTFAALQFINKIGGAQ |
| Ga0310130_0214535_459_596 | 3300034073 | Fracking Water | MTHHTTPTLLEVLSYLTDATFTSVVVATIAVAFTLQLINRIGGAR |
| Ga0335020_0001322_3736_3855 | 3300034082 | Freshwater | MSALEALSYLTDATFVSLVVLLVVGFVAFNAINKIGGRR |
| Ga0335020_0008147_3507_3632 | 3300034082 | Freshwater | MTPTPLEVLSYLTDATFVSLVVLLVVGFVALNAINKIGGRR |
| Ga0335010_0141125_2_112 | 3300034092 | Freshwater | MSALEVLSYLTDPVFCTVVVLSVGTFVALEIINKIGG |
| Ga0335010_0201539_979_1098 | 3300034092 | Freshwater | MSALEALSYLTDTTFTTVVLLTIGTFAALQFINRIGGAK |
| Ga0335010_0544424_1_144 | 3300034092 | Freshwater | MPSFAFLMTPHTTPTLLEVLSYLTDPTFTAVVVLVVGTFAALTAINKI |
| Ga0335025_0015912_2171_2290 | 3300034096 | Freshwater | MSALEVLSYLTDSTFTAVVVLIAGAFAALTAINKIGGAR |
| Ga0335025_0040230_2937_3074 | 3300034096 | Freshwater | MTPHHTPTLLEVLSHLTDPTFTVVVVLVVGAFAALTAINKIGGAE |
| Ga0335027_0016249_2657_2776 | 3300034101 | Freshwater | MSALEVLSYLTDTTFTTVVLLTIGTFAALQFINRIGGAQ |
| Ga0335027_0026530_1226_1363 | 3300034101 | Freshwater | MTHHTTPTLLEVLSYLTDPTFTAVIVITIGTFAALQFINKIGGAK |
| Ga0335027_0066274_2013_2132 | 3300034101 | Freshwater | MSALEVLSYLTDSTFTTVVLLTIGTFAALQFISRIGGAK |
| Ga0335027_0091752_2205_2336 | 3300034101 | Freshwater | TNTTPTLLEVLSYLTDPVFTTVIVLTIGTFAALQFINKIGGAR |
| Ga0335027_0135042_187_321 | 3300034101 | Freshwater | MTNTTPTLLEVMGYLTDPVFTTVVVLTIGTFAALQFINRIGGAR |
| Ga0335027_0698584_53_211 | 3300034101 | Freshwater | MPSFAFLMTPHTTPTLLEVLSYLTDPTFTAVVVLVVGTFAALTAINKIGGAR |
| Ga0335027_0822801_98_235 | 3300034101 | Freshwater | MTHHTTPTLLEVLSYITDPVFTTVVVLTVGTFAALTAINRIGGRP |
| Ga0335027_0857491_1_108 | 3300034101 | Freshwater | EVLSYLTDPVFCTVVVLAVGTFVALEIINKIGGAR |
| Ga0335031_0169035_3_131 | 3300034104 | Freshwater | MTNTTPTTLEVLSYLTDPTFTVVVVLVVGAFAALTAINKIGGA |
| Ga0335031_0227466_1117_1248 | 3300034104 | Freshwater | TNTTHTTLEVLSHLTDPTFTVVVVLVVGAFAALTAINKIGGAR |
| Ga0335036_0025060_3361_3480 | 3300034106 | Freshwater | MSALEVLSYLTDPVFCTVVVLAVGTFVALEAINKIGGAR |
| Ga0335036_0653907_173_292 | 3300034106 | Freshwater | MSALEVLSYLTDPVFCTVVALAVGTFVALEIINKIGGAK |
| Ga0335036_0820252_309_467 | 3300034106 | Freshwater | MPSFAFPMTHHTTPTLLEVLSYLTDPTFTAVIVITIGTFAALQFINKIGGAR |
| Ga0335066_0205701_517_636 | 3300034112 | Freshwater | MSALEVLSYLTDPVFCTVVLLTIGTFAALQFINRIGGAK |
| Ga0335066_0334552_1_120 | 3300034112 | Freshwater | PTLLEVLGYLTDPVFTTVIVLTIGTFAALQFINKIGGAR |
| Ga0335016_0271292_2_136 | 3300034166 | Freshwater | MTPHTTPTLLEVLSYLTDPTFTAVIVLTIGTFAALQFINRIGGAR |
| ⦗Top⦘ |