


| Basic Information | |
|---|---|
| Family ID | F072085 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALR |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.17 % |
| % of genes from short scaffolds (< 2000 bps) | 88.43 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.893 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.264 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.099 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.058 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF01916 | DS | 12.40 |
| PF01625 | PMSR | 11.57 |
| PF09084 | NMT1 | 4.13 |
| PF01717 | Meth_synt_2 | 3.31 |
| PF09601 | DUF2459 | 2.48 |
| PF03795 | YCII | 2.48 |
| PF02775 | TPP_enzyme_C | 2.48 |
| PF02826 | 2-Hacid_dh_C | 1.65 |
| PF03401 | TctC | 0.83 |
| PF13531 | SBP_bac_11 | 0.83 |
| PF07355 | GRDB | 0.83 |
| PF04909 | Amidohydro_2 | 0.83 |
| PF02913 | FAD-oxidase_C | 0.83 |
| PF00378 | ECH_1 | 0.83 |
| PF13683 | rve_3 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 12.40 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 11.57 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.13 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.13 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 3.31 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.48 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.83 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.89 % |
| Unclassified | root | N/A | 47.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_24790 | Not Available | 1286 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101848750 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1070539 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10151122 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10071365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300000891|JGI10214J12806_10143539 | Not Available | 710 | Open in IMG/M |
| 3300000955|JGI1027J12803_103087574 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300003997|Ga0055466_10104794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300004019|Ga0055439_10197061 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300004057|Ga0055496_10029564 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300004463|Ga0063356_100619305 | Not Available | 1468 | Open in IMG/M |
| 3300004463|Ga0063356_102068471 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300004463|Ga0063356_102175261 | Not Available | 844 | Open in IMG/M |
| 3300004480|Ga0062592_101304301 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300004808|Ga0062381_10244850 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005218|Ga0068996_10104054 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005290|Ga0065712_10001717 | All Organisms → cellular organisms → Bacteria | 6631 | Open in IMG/M |
| 3300005332|Ga0066388_101938626 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300005347|Ga0070668_100064177 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
| 3300005445|Ga0070708_101846154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300005445|Ga0070708_102223465 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005457|Ga0070662_101029646 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005459|Ga0068867_100535701 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300005713|Ga0066905_100479504 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300005713|Ga0066905_102293520 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005719|Ga0068861_100826879 | Not Available | 871 | Open in IMG/M |
| 3300005764|Ga0066903_103591288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300005764|Ga0066903_104354297 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005840|Ga0068870_11019500 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005879|Ga0075295_1027885 | Not Available | 694 | Open in IMG/M |
| 3300005885|Ga0075284_1059314 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005887|Ga0075292_1001426 | All Organisms → cellular organisms → Bacteria | 2978 | Open in IMG/M |
| 3300005981|Ga0081538_10299007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300006806|Ga0079220_10925709 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006844|Ga0075428_100556833 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300006852|Ga0075433_10108120 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
| 3300006854|Ga0075425_100550693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1328 | Open in IMG/M |
| 3300006894|Ga0079215_11515507 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009111|Ga0115026_11347880 | Not Available | 588 | Open in IMG/M |
| 3300009156|Ga0111538_10153432 | All Organisms → cellular organisms → Bacteria | 2926 | Open in IMG/M |
| 3300009156|Ga0111538_13193637 | Not Available | 571 | Open in IMG/M |
| 3300009162|Ga0075423_10062188 | Not Available | 3865 | Open in IMG/M |
| 3300009162|Ga0075423_11392016 | Not Available | 751 | Open in IMG/M |
| 3300009609|Ga0105347_1406422 | Not Available | 586 | Open in IMG/M |
| 3300009777|Ga0105164_10034551 | All Organisms → cellular organisms → Bacteria | 2767 | Open in IMG/M |
| 3300009820|Ga0105085_1060149 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010043|Ga0126380_10103920 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300010043|Ga0126380_10373005 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1048 | Open in IMG/M |
| 3300010047|Ga0126382_12543204 | Not Available | 500 | Open in IMG/M |
| 3300010304|Ga0134088_10077514 | Not Available | 1550 | Open in IMG/M |
| 3300010362|Ga0126377_11479221 | Not Available | 753 | Open in IMG/M |
| 3300010398|Ga0126383_12016379 | Not Available | 664 | Open in IMG/M |
| 3300011420|Ga0137314_1152320 | Not Available | 564 | Open in IMG/M |
| 3300011439|Ga0137432_1024456 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300012034|Ga0137453_1017812 | Not Available | 1099 | Open in IMG/M |
| 3300012133|Ga0137329_1041800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300012189|Ga0137388_10775924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300012208|Ga0137376_10186067 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300012209|Ga0137379_11537283 | Not Available | 566 | Open in IMG/M |
| 3300012210|Ga0137378_10162473 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300012350|Ga0137372_10502590 | Not Available | 902 | Open in IMG/M |
| 3300012493|Ga0157355_1040223 | Not Available | 521 | Open in IMG/M |
| 3300012911|Ga0157301_10095248 | Not Available | 865 | Open in IMG/M |
| 3300012930|Ga0137407_10144212 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300012931|Ga0153915_11013191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
| 3300012931|Ga0153915_13334849 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012948|Ga0126375_10423687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 969 | Open in IMG/M |
| 3300013306|Ga0163162_10153518 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
| 3300014154|Ga0134075_10231195 | Not Available | 798 | Open in IMG/M |
| 3300014254|Ga0075312_1000399 | All Organisms → cellular organisms → Bacteria | 6453 | Open in IMG/M |
| 3300014255|Ga0075320_1039126 | Not Available | 827 | Open in IMG/M |
| 3300014497|Ga0182008_10387503 | Not Available | 748 | Open in IMG/M |
| 3300014968|Ga0157379_10627909 | Not Available | 1004 | Open in IMG/M |
| 3300015373|Ga0132257_100316393 | Not Available | 1879 | Open in IMG/M |
| 3300015374|Ga0132255_101474162 | Not Available | 1029 | Open in IMG/M |
| 3300017936|Ga0187821_10516546 | Not Available | 500 | Open in IMG/M |
| 3300018000|Ga0184604_10002211 | All Organisms → cellular organisms → Bacteria | 3033 | Open in IMG/M |
| 3300018028|Ga0184608_10020255 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
| 3300018052|Ga0184638_1218691 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300018056|Ga0184623_10327548 | Not Available | 689 | Open in IMG/M |
| 3300018072|Ga0184635_10042613 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300018081|Ga0184625_10266170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 897 | Open in IMG/M |
| 3300018089|Ga0187774_10491222 | Not Available | 771 | Open in IMG/M |
| 3300018422|Ga0190265_12633807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter soli | 600 | Open in IMG/M |
| 3300018920|Ga0190273_11986850 | Not Available | 538 | Open in IMG/M |
| 3300019377|Ga0190264_11835235 | Not Available | 547 | Open in IMG/M |
| 3300021063|Ga0206227_1107282 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300021081|Ga0210379_10557037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300021344|Ga0193719_10169358 | Not Available | 939 | Open in IMG/M |
| 3300025537|Ga0210061_1005419 | Not Available | 1999 | Open in IMG/M |
| 3300025550|Ga0210098_1027368 | Not Available | 883 | Open in IMG/M |
| 3300025558|Ga0210139_1083231 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300025911|Ga0207654_10486366 | Not Available | 870 | Open in IMG/M |
| 3300025930|Ga0207701_11056691 | Not Available | 674 | Open in IMG/M |
| 3300025931|Ga0207644_11136204 | Not Available | 656 | Open in IMG/M |
| 3300026118|Ga0207675_100889516 | Not Available | 906 | Open in IMG/M |
| 3300026536|Ga0209058_1095942 | Not Available | 1514 | Open in IMG/M |
| 3300027252|Ga0209973_1055412 | Not Available | 603 | Open in IMG/M |
| 3300027543|Ga0209999_1040270 | Not Available | 875 | Open in IMG/M |
| 3300027778|Ga0209464_10065074 | Not Available | 1215 | Open in IMG/M |
| 3300027831|Ga0209797_10228771 | Not Available | 785 | Open in IMG/M |
| 3300027874|Ga0209465_10119858 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10659431 | Not Available | 502 | Open in IMG/M |
| 3300028802|Ga0307503_10333869 | Not Available | 772 | Open in IMG/M |
| 3300030006|Ga0299907_10662587 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300030620|Ga0302046_10224542 | Not Available | 1545 | Open in IMG/M |
| 3300031229|Ga0299913_11392394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1202896 | Not Available | 501 | Open in IMG/M |
| 3300031740|Ga0307468_100710532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300031744|Ga0306918_10402873 | Not Available | 1066 | Open in IMG/M |
| 3300031820|Ga0307473_10916731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300032012|Ga0310902_11192852 | Not Available | 536 | Open in IMG/M |
| 3300032017|Ga0310899_10239022 | Not Available | 821 | Open in IMG/M |
| 3300032075|Ga0310890_10641835 | Not Available | 826 | Open in IMG/M |
| 3300032157|Ga0315912_10131156 | Not Available | 1964 | Open in IMG/M |
| 3300033412|Ga0310810_10053642 | All Organisms → cellular organisms → Bacteria | 4904 | Open in IMG/M |
| 3300033414|Ga0316619_11895822 | Not Available | 541 | Open in IMG/M |
| 3300033486|Ga0316624_11701603 | Not Available | 582 | Open in IMG/M |
| 3300034147|Ga0364925_0104650 | Not Available | 1006 | Open in IMG/M |
| 3300034178|Ga0364934_0344807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300034820|Ga0373959_0027176 | Not Available | 1135 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.26% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.13% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 4.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.31% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.48% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.48% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.65% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.83% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.83% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004057 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025550 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_03442890 | 2199352025 | Soil | VVGTTHVGLTFHFGGLSQEKVLKSMERCARLVLPELR |
| INPhiseqgaiiFebDRAFT_1018487501 | 3300000364 | Soil | TTHIGLVFHFGGLSQEKVLKSMQRFARFVMPALRNT* |
| AP72_2010_repI_A01DRAFT_10705392 | 3300000579 | Forest Soil | DVVGTTHIGLTFHFGGLSQDKVLKSMERFARSVMPQFR* |
| AF_2010_repII_A1DRAFT_101511221 | 3300000597 | Forest Soil | LKRIIDVVGTTHIGLTFHFGGLSQDKVLKSMERFARSVMPQFR* |
| AF_2010_repII_A001DRAFT_100713653 | 3300000793 | Forest Soil | VGTTHIGLVFHFGGLSQEKVLQSMERFARFVMPALR* |
| JGI10214J12806_101435391 | 3300000891 | Soil | ILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR* |
| JGI1027J12803_1030875741 | 3300000955 | Soil | IIEVVGTTHIGLVFHFGGLSQEKVLKSMQRFARFVMPALRNT* |
| Ga0055466_101047941 | 3300003997 | Natural And Restored Wetlands | TQRIIETIGPTHIGLVFHFGGLTQQQVLKSMERFARVVAPALR* |
| Ga0055439_101970612 | 3300004019 | Natural And Restored Wetlands | CVKILKSIIDVVGTTHIGLVFHFGGLGQERVLKSMERFARFVMPVLKHSPA* |
| Ga0055496_100295642 | 3300004057 | Natural And Restored Wetlands | IIDTVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR* |
| Ga0063356_1006193052 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IEVVGTTHVGLTFHFGGLSQDKVLKSMERCSDSVLPALR* |
| Ga0063356_1020684712 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LKRISETVGTTHIGLTFHFGGLSQDKVLKSMQRCAKSVLPALR* |
| Ga0063356_1021752612 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IEVVGTTHIGLTFHFGGLSQDKVLGSMERSARSVLPALRQH* |
| Ga0062592_1013043012 | 3300004480 | Soil | RIIEVVGTTHIGLTFHFGGLSQERVLKSMDRCAKLVLPGLR* |
| Ga0062381_102448501 | 3300004808 | Wetland Sediment | SCVRILKRIIEIIGTNHIGLTFHFGGLSQDKALKSMERFAKLVMPALR* |
| Ga0068996_101040541 | 3300005218 | Natural And Restored Wetlands | GVFGGPETCARILKRIIEVVGTTHIGLTFHFGGLGQDKVLKSMERCAKLVLPALR* |
| Ga0065712_100017177 | 3300005290 | Miscanthus Rhizosphere | PETCVRILKRIIEIVGTSHVGLTFHFGGLSQNQVLQSMERCARAVLPAFR* |
| Ga0066388_1019386261 | 3300005332 | Tropical Forest Soil | ETCARILKRIIDVVGATHIGLTFHFGGLSQNKVLKSMERFARSVMPQFR* |
| Ga0070668_1000641771 | 3300005347 | Switchgrass Rhizosphere | IIEVVGTAHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR* |
| Ga0070708_1018461541 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GPTHIGLVFHFGGLSQEKVLKSMERFARSVMPALRTANS* |
| Ga0070708_1022234651 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GGPETCARIIKRIIEVVGTTHIGLTFHFGGLAQDKVLKSMERCAKVVLAGLR* |
| Ga0070662_1010296462 | 3300005457 | Corn Rhizosphere | PETCVRILKRVIEVVGTTHVGLTFHFGGLSQAKVLKSMERCARLVLPALR* |
| Ga0068867_1005357011 | 3300005459 | Miscanthus Rhizosphere | CVRILKQIIAVMGTTHIGLTFHFGGLSQDKILKSMQRCARNVLPGLR* |
| Ga0066905_1004795042 | 3300005713 | Tropical Forest Soil | TCTRILKRIIEIVGTTHIGLTFHFGGLRQDKVLKSMERFARLVMPALK* |
| Ga0066905_1022935202 | 3300005713 | Tropical Forest Soil | GTTHIGLTFHFGGLSQDKVLKSMERFARSVMPQFR* |
| Ga0068861_1008268791 | 3300005719 | Switchgrass Rhizosphere | RILKQIIAVMGTTHIGLTFHFGGLSQDKILKSMQRCARNVLPGLR* |
| Ga0066903_1035912881 | 3300005764 | Tropical Forest Soil | RIIEVVGTTHIGLVFHFGGLSQEKVLKSMERFARFVMPGLRNT* |
| Ga0066903_1043542971 | 3300005764 | Tropical Forest Soil | ILKRIIDVVGATHIGLTFHFGGLSQDKVLKSMERFARSVMPHFR* |
| Ga0068870_110195002 | 3300005840 | Miscanthus Rhizosphere | CARILKQIIAVMGTTHIGLTFHFGGLSQDKILKSMQRCARNVLPGLR* |
| Ga0075295_10278851 | 3300005879 | Rice Paddy Soil | RIIEVVGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH* |
| Ga0075284_10593142 | 3300005885 | Rice Paddy Soil | VFGGPQTCARILKRIIEVVGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH* |
| Ga0075292_10014261 | 3300005887 | Rice Paddy Soil | VVGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH* |
| Ga0081538_102990071 | 3300005981 | Tabebuia Heterophylla Rhizosphere | GPDTCVAVLRKIISLVGATHIGLTFHFGGLSQDKVLQSMNRFASQVKPALVT* |
| Ga0079220_109257091 | 3300006806 | Agricultural Soil | CVEILQSIREVLAPTHVGIVFHFGGLSQQKVLKSMERFARYVMPALQSN* |
| Ga0075428_1005568331 | 3300006844 | Populus Rhizosphere | RILKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALK* |
| Ga0075433_101081201 | 3300006852 | Populus Rhizosphere | VFGGPETCVRILKRIIDVVGTTHIGFTFHFGGLSQEKVLKSMERCARFVLPALR* |
| Ga0075425_1005506931 | 3300006854 | Populus Rhizosphere | THIGLVFHFGGLSQEKVLKSMERFARSVMPALRTANS* |
| Ga0079215_115155072 | 3300006894 | Agricultural Soil | LGTTHIGLTFHFGGLNQQKVLKSMERFARQVRPALG* |
| Ga0115026_113478802 | 3300009111 | Wetland | FGGPESCVRILKRIIETVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR* |
| Ga0111538_101534323 | 3300009156 | Populus Rhizosphere | ILKRIIEIVGTSHVGLTFHFGGLSQNQVLQSMERCARAVLPAFR* |
| Ga0111538_131936371 | 3300009156 | Populus Rhizosphere | VFGGPEACVRILKRIIETVATNHVGLTFHFGGLSQERVLGSMERCARAVLPALR* |
| Ga0075423_100621881 | 3300009162 | Populus Rhizosphere | RGIFGGPETCVRILKRVIEVVGTTHVGLTFHFGGLSQEKVLKSMERCARLVLPELR* |
| Ga0075423_113920162 | 3300009162 | Populus Rhizosphere | RGVFGGPETCVRILKRIIDVVGTTHIGLTFHFGGLSQEKVLKSMERCARFVLPALR* |
| Ga0105347_14064221 | 3300009609 | Soil | SCVRILKRIVETVGTTHIGLTFHFGGLSQDKVLKSMERCAKLVLAGLR* |
| Ga0105164_100345513 | 3300009777 | Wastewater | IGLVFHFGGLGQDKILKSMERFARFVAPAFKEQQG* |
| Ga0105085_10601492 | 3300009820 | Groundwater Sand | CTRILKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARWVMPALR* |
| Ga0126380_101039201 | 3300010043 | Tropical Forest Soil | IIDVVGTTHIGLTFHFGGLRQDKVLKSMERFARLVMPALK* |
| Ga0126380_103730051 | 3300010043 | Tropical Forest Soil | PETCVRQLKRAQDILQPSHVGLVFHFGGMKQDKVLKSMERFARLVAPALR* |
| Ga0126382_125432042 | 3300010047 | Tropical Forest Soil | ETCAHILKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR* |
| Ga0134088_100775142 | 3300010304 | Grasslands Soil | CVRILKRIIDVGAWSHIGLTFHFGGLSQEKVLKSMERCARLVLPALR* |
| Ga0126377_114792211 | 3300010362 | Tropical Forest Soil | LKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR* |
| Ga0126383_120163791 | 3300010398 | Tropical Forest Soil | ILKRIIEIVGTTHIGLTFHFGGLRQDKVLKSMERFARLVMPALK* |
| Ga0137314_11523202 | 3300011420 | Soil | VGTTHIGLTFHFGGLGQDKVLKSMERCAKLVLAGLR* |
| Ga0137432_10244564 | 3300011439 | Soil | VRQIIDVVGTTHIGLTFHFGGLGQDKVLKSMERFARLVMPALK* |
| Ga0137453_10178122 | 3300012034 | Soil | RILQRIIDVVGTTHIGLTFHFVGLGQDKVLKSMERCAKLVVPALRSALKS* |
| Ga0137329_10418001 | 3300012133 | Soil | ILRKIIDVVGVTHIGLTFHFGGLSQKKALKSMERFARQVRPAF* |
| Ga0137388_107759242 | 3300012189 | Vadose Zone Soil | GLVFHFGGLSQEKVLKSMERFARFVMPALRTANS* |
| Ga0137376_101860674 | 3300012208 | Vadose Zone Soil | LKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALR* |
| Ga0137379_115372832 | 3300012209 | Vadose Zone Soil | VGTTHIGLTFHFGGLSQEKVLKSMERCARFVLPALR* |
| Ga0137378_101624733 | 3300012210 | Vadose Zone Soil | RMLKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALK* |
| Ga0137372_105025901 | 3300012350 | Vadose Zone Soil | ARILKRIIDVVGTTHIGLTFHFGGLSQERVLKSMERCARFVLPALR* |
| Ga0157355_10402231 | 3300012493 | Unplanted Soil | ETCVRILKRVIEVVGTTHVGLTFHFGGLSQAKVLKSMERCARLVLPELR* |
| Ga0157301_100952481 | 3300012911 | Soil | SCVRILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR* |
| Ga0137407_101442121 | 3300012930 | Vadose Zone Soil | TCARILKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALK* |
| Ga0153915_110131911 | 3300012931 | Freshwater Wetlands | RGVFGGPETCVRILKRIIEVVGPTHIGLVFHFGGLSQDKVLKSMERCARQAMPALR* |
| Ga0153915_133348491 | 3300012931 | Freshwater Wetlands | IIDTIGPTHIGLVFHFGGLSQQKVLKSMERFARVIAPTPR* |
| Ga0126375_104236873 | 3300012948 | Tropical Forest Soil | CVRILKRIIEVVGTTHIGLVFHFGGLSQEKVLKSVERFARFVMPALR* |
| Ga0163162_101535183 | 3300013306 | Switchgrass Rhizosphere | LKRVIEVVGTTHVGLTFHFGGLSQAKVLKSMERCARLVLPVLR* |
| Ga0134075_102311952 | 3300014154 | Grasslands Soil | IDVVGTTHIGLTFHFGGLSQEKVLKSMERCARLVLPALR* |
| Ga0075312_10003991 | 3300014254 | Natural And Restored Wetlands | TCKHILRRIGEIVGTTHVGLTFHFGGLGQDKVLRSMERCVRYVLPALR* |
| Ga0075320_10391262 | 3300014255 | Natural And Restored Wetlands | GPQTCARILKRIIEVLGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH* |
| Ga0182008_103875031 | 3300014497 | Rhizosphere | VVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR* |
| Ga0157379_106279092 | 3300014968 | Switchgrass Rhizosphere | VFGGPESCVRILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR* |
| Ga0132257_1003163932 | 3300015373 | Arabidopsis Rhizosphere | VFGGPETCVRILKRIIEIVGTSHVGLTFHFGGLSQNQVLQSMERCARAVLPAFR* |
| Ga0132255_1014741621 | 3300015374 | Arabidopsis Rhizosphere | CVRILKRVIEVVGTTHVGLTFHFGGLSQAKVLKSMERCSRLVLPELR* |
| Ga0187821_105165462 | 3300017936 | Freshwater Sediment | RMLKRIIEVVGTTHVGLTFHFGGLGQEKILRSMERCARAVLPVLR |
| Ga0184604_100022111 | 3300018000 | Groundwater Sediment | QIIDVVGTTHIGLTFHFGGLSQDKILKSLQRCARNVLPGLR |
| Ga0184608_100202553 | 3300018028 | Groundwater Sediment | CVRILKRIIDVVGTTHIGLTFHFGGLSQEKILRSMERCARLVLPALR |
| Ga0184638_12186911 | 3300018052 | Groundwater Sediment | GPETCARILQRIIDVVGTTHIGLTFHFGGLGQDKVLKSMERCARQVLPQVR |
| Ga0184623_103275481 | 3300018056 | Groundwater Sediment | PETCARIFKRIIEVVGTTHIGLTFHFGGLGQDKVLKSMERCAKSVLVGLR |
| Ga0184635_100426131 | 3300018072 | Groundwater Sediment | IEVVGTTHIGLTFHYGGLSQDKVLKSMERFARWVMPQFR |
| Ga0184625_102661701 | 3300018081 | Groundwater Sediment | TCAQILRKIIDVIGVTHIGLTFHFGGLSQKKVLKSMERFARQVRPTF |
| Ga0187774_104912222 | 3300018089 | Tropical Peatland | KRIIKVVGATHIGLTFHFGGLSQDKVLKSMERFARWVMPALK |
| Ga0190265_126338071 | 3300018422 | Soil | VEVVGTTHIGLTFHFGGLSQEKVLKSMERFARQVRPALG |
| Ga0190273_119868501 | 3300018920 | Soil | RILKRIVETVGTTHIGLTFHFGGLSQGKVLQSMERCAKSVLPALR |
| Ga0190264_118352352 | 3300019377 | Soil | IVEVVGTTHIGLTFHFGGLSQDKVLSSMERCARSVLPALR |
| Ga0206227_11072821 | 3300021063 | Deep Subsurface Sediment | TCARILQRIIDVVRTTHIGLTFHFGGLGQDKVLKSMERCAKLVVPALRSALKS |
| Ga0210379_105570371 | 3300021081 | Groundwater Sediment | EACAKILKKIIETVGPTHIGLVFHFGGLSQDKVLKSMERCARQVMPALR |
| Ga0193719_101693581 | 3300021344 | Soil | VGTTHVGLTFHFGGLSQAKVLKSMERCARLVLPELR |
| Ga0210061_10054193 | 3300025537 | Natural And Restored Wetlands | QTCARILKRIIEVVGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH |
| Ga0210098_10273682 | 3300025550 | Natural And Restored Wetlands | GPESCVGILKRIVDVVGTTHIGLTFHFGGLGQHKALKSIERFAKLVMPALR |
| Ga0210139_10832311 | 3300025558 | Natural And Restored Wetlands | CVKILKSIIDVVGTTHIGLVFHFGGLGQERVLKSMERFARFVMPVLKHSPA |
| Ga0207654_104863661 | 3300025911 | Corn Rhizosphere | FGGPESCVSILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR |
| Ga0207701_110566911 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | KRIIEIVGAIHVGLTFHFGGLPQNRVLQSMERCARVVLPAFR |
| Ga0207644_111362042 | 3300025931 | Switchgrass Rhizosphere | RIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR |
| Ga0207675_1008895161 | 3300026118 | Switchgrass Rhizosphere | ESCVRILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR |
| Ga0209058_10959422 | 3300026536 | Soil | RIIDVVGTTHIGLTFHFGGLSQEKVLKSMERCARLVLPALR |
| Ga0209973_10554122 | 3300027252 | Arabidopsis Thaliana Rhizosphere | GVFGGPQTCARILKRIIEVVGTTHIGLTFHFGGLSQDKVLGSMERSARSVLPALRQH |
| Ga0209999_10402701 | 3300027543 | Arabidopsis Thaliana Rhizosphere | EVVGTTHIGLTFHFGGLSQEKVLSSMERCARSVLPALR |
| Ga0209464_100650742 | 3300027778 | Wetland Sediment | SCVRILKRIIEIIGTNHIGLTFHFGGLSQDKALKSMERFAKLVMPALR |
| Ga0209797_102287712 | 3300027831 | Wetland Sediment | ETVGTDHIGLTFHFGGLSQDKVLKSMERFAESVMPALR |
| Ga0209465_101198583 | 3300027874 | Tropical Forest Soil | RIIEIVGTTHIGLTFHFGGLRQDKVLKSMERFARSVMAQFR |
| (restricted) Ga0233417_106594312 | 3300028043 | Sediment | VVGTTHIGLTFHFAGLSQDKVLKSMERCATLVLPSLR |
| Ga0307503_103338692 | 3300028802 | Soil | VRILRRIIDTVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALG |
| Ga0299907_106625872 | 3300030006 | Soil | VRILKRIIDVLRPTQIGLVFHFGGLGQDKVLRSMERFANSVAPVLR |
| Ga0302046_102245422 | 3300030620 | Soil | GPESCARILKRIIEVVGTTHIGLTFHFGGLGQDRVLKSMERCARLVLPALR |
| Ga0299913_113923941 | 3300031229 | Soil | EKIVEVVGTTHIGLTFHFGGLSQDKVLKSIERFARLVRPALGA |
| (restricted) Ga0255312_12028961 | 3300031248 | Sandy Soil | CVRMLRSIIDTVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR |
| Ga0307468_1007105322 | 3300031740 | Hardwood Forest Soil | GTTHIGLVFHFGGLSQKKVLKSMERFARFVMPALRTANS |
| Ga0306918_104028731 | 3300031744 | Soil | TCARILKDIIETVGTNHIGLTFHFGGLSQERVLRSMQRCARVVLPALR |
| Ga0307473_109167312 | 3300031820 | Hardwood Forest Soil | GPETCVRILKRIIEVVGTTHIGLTFHFGGLAQDKVLKSMERFARVVMPPLK |
| Ga0310902_111928521 | 3300032012 | Soil | IFGGPETCARILKRVIEVVGTTHVGLTFHFGGLSQEKVLKSMERCARLVLPELR |
| Ga0310899_102390222 | 3300032017 | Soil | TTHIGLTFHFGGLSQDKVLKSMARCSDSVLPALRSQPSRTKT |
| Ga0310890_106418352 | 3300032075 | Soil | RILKRVIEIVGASHVGLTFHFGGLPQNRVLQSMERCVRVVLPAFR |
| Ga0315912_101311562 | 3300032157 | Soil | IIDTVGTTHIGLTFHFGGLSQDKVLKSMERCAKFVLPGLR |
| Ga0310810_100536421 | 3300033412 | Soil | RGVFGGPETCVRILKRIIEIVGTSHVGLTFHFGGLSQNQVLQSMERCARAVLPAFR |
| Ga0316619_118958222 | 3300033414 | Soil | KRISETVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR |
| Ga0316624_117016032 | 3300033486 | Soil | IEVVGTTHVGLTFHFGGLGQEKILRSMERCARAVLPALR |
| Ga0364925_0104650_13_177 | 3300034147 | Sediment | VFGGPASCVRILKRIVETVGTTHIGLTFHFGGLSQDKVLKSMERCAESVLPALR |
| Ga0364934_0344807_3_131 | 3300034178 | Sediment | LRKIIDLVGATHIGLTFHFGGLSQKNVLKSMERFARQVRPAF |
| Ga0373959_0027176_2_136 | 3300034820 | Rhizosphere Soil | ILKRIIEVVGTTHIGLTFHFGGLGQDKVLKSMERFARSVMPALK |
| ⦗Top⦘ |