


| Basic Information | |
|---|---|
| Family ID | F072083 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNQNAKRNLQRRKRQATRLSKREYFRKKKEALNVSAAGKDKVA |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.17 % |
| % of genes near scaffold ends (potentially truncated) | 21.49 % |
| % of genes from short scaffolds (< 2000 bps) | 79.34 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.025 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.570 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.926 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF01434 | Peptidase_M41 | 4.96 |
| PF00248 | Aldo_ket_red | 4.13 |
| PF00155 | Aminotran_1_2 | 3.31 |
| PF06480 | FtsH_ext | 1.65 |
| PF08719 | NADAR | 1.65 |
| PF01636 | APH | 1.65 |
| PF02586 | SRAP | 1.65 |
| PF04909 | Amidohydro_2 | 1.65 |
| PF02604 | PhdYeFM_antitox | 0.83 |
| PF13458 | Peripla_BP_6 | 0.83 |
| PF12399 | BCA_ABC_TP_C | 0.83 |
| PF05598 | DUF772 | 0.83 |
| PF01042 | Ribonuc_L-PSP | 0.83 |
| PF01641 | SelR | 0.83 |
| PF00903 | Glyoxalase | 0.83 |
| PF09084 | NMT1 | 0.83 |
| PF02655 | ATP-grasp_3 | 0.83 |
| PF04773 | FecR | 0.83 |
| PF00975 | Thioesterase | 0.83 |
| PF08309 | LVIVD | 0.83 |
| PF02826 | 2-Hacid_dh_C | 0.83 |
| PF01467 | CTP_transf_like | 0.83 |
| PF01336 | tRNA_anti-codon | 0.83 |
| PF14497 | GST_C_3 | 0.83 |
| PF01258 | zf-dskA_traR | 0.83 |
| PF03602 | Cons_hypoth95 | 0.83 |
| PF13531 | SBP_bac_11 | 0.83 |
| PF01370 | Epimerase | 0.83 |
| PF06803 | DUF1232 | 0.83 |
| PF13328 | HD_4 | 0.83 |
| PF00561 | Abhydrolase_1 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 6.61 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.65 |
| COG3236 | N-glycosidase YbiA/RibX (riboflavin biosynthesis, damage control), NADAR superfamily | Defense mechanisms [V] | 1.65 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.83 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.83 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.83 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.83 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.83 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.83 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.83 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.83 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.02 % |
| Unclassified | root | N/A | 42.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_47866 | All Organisms → cellular organisms → Bacteria | 4810 | Open in IMG/M |
| 2209111006|2214746905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 916 | Open in IMG/M |
| 2209111006|2214775235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 781 | Open in IMG/M |
| 2228664022|INPgaii200_c1049836 | All Organisms → cellular organisms → Bacteria | 3339 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2139650 | Not Available | 865 | Open in IMG/M |
| 3300003991|Ga0055461_10196443 | Not Available | 545 | Open in IMG/M |
| 3300003991|Ga0055461_10213824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300003997|Ga0055466_10000244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4770 | Open in IMG/M |
| 3300004009|Ga0055437_10013825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1767 | Open in IMG/M |
| 3300004011|Ga0055460_10136317 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300004019|Ga0055439_10050530 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300004027|Ga0055459_10192257 | Not Available | 567 | Open in IMG/M |
| 3300004049|Ga0055493_10029716 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300004052|Ga0055490_10147007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300004114|Ga0062593_101016858 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300004156|Ga0062589_101675651 | Not Available | 633 | Open in IMG/M |
| 3300004156|Ga0062589_102718109 | Not Available | 515 | Open in IMG/M |
| 3300004463|Ga0063356_100513456 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1589 | Open in IMG/M |
| 3300004463|Ga0063356_100976743 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300004479|Ga0062595_101334081 | Not Available | 648 | Open in IMG/M |
| 3300004643|Ga0062591_101052876 | Not Available | 779 | Open in IMG/M |
| 3300004778|Ga0062383_10007845 | All Organisms → cellular organisms → Bacteria | 3400 | Open in IMG/M |
| 3300005294|Ga0065705_10010142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2836 | Open in IMG/M |
| 3300005332|Ga0066388_100829687 | Not Available | 1513 | Open in IMG/M |
| 3300005546|Ga0070696_100025980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3983 | Open in IMG/M |
| 3300005549|Ga0070704_100393480 | Not Available | 1181 | Open in IMG/M |
| 3300005830|Ga0074473_11176916 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005836|Ga0074470_10108593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12555 | Open in IMG/M |
| 3300005895|Ga0075277_1018611 | Not Available | 954 | Open in IMG/M |
| 3300006844|Ga0075428_100040739 | All Organisms → cellular organisms → Bacteria | 5109 | Open in IMG/M |
| 3300006845|Ga0075421_100679976 | Not Available | 1199 | Open in IMG/M |
| 3300006845|Ga0075421_101257766 | Not Available | 822 | Open in IMG/M |
| 3300006845|Ga0075421_101743776 | Not Available | 672 | Open in IMG/M |
| 3300006845|Ga0075421_102129413 | Not Available | 594 | Open in IMG/M |
| 3300006846|Ga0075430_100451159 | Not Available | 1061 | Open in IMG/M |
| 3300006852|Ga0075433_11368545 | Not Available | 613 | Open in IMG/M |
| 3300006853|Ga0075420_100624295 | Not Available | 930 | Open in IMG/M |
| 3300006880|Ga0075429_101082555 | Not Available | 700 | Open in IMG/M |
| 3300007004|Ga0079218_11634506 | Not Available | 709 | Open in IMG/M |
| 3300009087|Ga0105107_10174563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1509 | Open in IMG/M |
| 3300009091|Ga0102851_11266854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300009111|Ga0115026_11598507 | Not Available | 546 | Open in IMG/M |
| 3300009147|Ga0114129_12499442 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300009162|Ga0075423_10894365 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 941 | Open in IMG/M |
| 3300009162|Ga0075423_11886095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300009167|Ga0113563_10919959 | Not Available | 1000 | Open in IMG/M |
| 3300009553|Ga0105249_11187060 | Not Available | 834 | Open in IMG/M |
| 3300009609|Ga0105347_1008017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3688 | Open in IMG/M |
| 3300009610|Ga0105340_1046240 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300010373|Ga0134128_11586135 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300011414|Ga0137442_1041999 | Not Available | 899 | Open in IMG/M |
| 3300011436|Ga0137458_1135703 | Not Available | 728 | Open in IMG/M |
| 3300011441|Ga0137452_1089113 | Not Available | 1008 | Open in IMG/M |
| 3300011443|Ga0137457_1146443 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 782 | Open in IMG/M |
| 3300011444|Ga0137463_1367994 | Not Available | 513 | Open in IMG/M |
| 3300012035|Ga0137445_1062837 | Not Available | 734 | Open in IMG/M |
| 3300012113|Ga0137328_1030363 | Not Available | 544 | Open in IMG/M |
| 3300012133|Ga0137329_1010395 | Not Available | 1003 | Open in IMG/M |
| 3300012200|Ga0137382_10070701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2236 | Open in IMG/M |
| 3300012473|Ga0157340_1022044 | Not Available | 544 | Open in IMG/M |
| 3300012513|Ga0157326_1002669 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300012891|Ga0157305_10185188 | Not Available | 587 | Open in IMG/M |
| 3300012931|Ga0153915_11002655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 973 | Open in IMG/M |
| 3300012989|Ga0164305_11584877 | Not Available | 584 | Open in IMG/M |
| 3300013297|Ga0157378_12194907 | Not Available | 603 | Open in IMG/M |
| 3300013306|Ga0163162_11036305 | Not Available | 928 | Open in IMG/M |
| 3300014296|Ga0075344_1059825 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300014304|Ga0075340_1053640 | Not Available | 712 | Open in IMG/M |
| 3300014317|Ga0075343_1017685 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300015245|Ga0137409_10746128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300015371|Ga0132258_13402243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1092 | Open in IMG/M |
| 3300015372|Ga0132256_103761555 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 510 | Open in IMG/M |
| 3300015373|Ga0132257_100172714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2546 | Open in IMG/M |
| 3300015373|Ga0132257_100932686 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300017930|Ga0187825_10029881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1834 | Open in IMG/M |
| 3300017936|Ga0187821_10422919 | Not Available | 548 | Open in IMG/M |
| 3300018074|Ga0184640_10259367 | Not Available | 789 | Open in IMG/M |
| 3300018079|Ga0184627_10509295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 619 | Open in IMG/M |
| 3300018083|Ga0184628_10038105 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
| 3300018084|Ga0184629_10011042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3513 | Open in IMG/M |
| 3300018422|Ga0190265_10075987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3054 | Open in IMG/M |
| 3300018422|Ga0190265_13335796 | Not Available | 536 | Open in IMG/M |
| 3300018469|Ga0190270_10131683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1991 | Open in IMG/M |
| 3300018481|Ga0190271_10050280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3545 | Open in IMG/M |
| 3300020003|Ga0193739_1013003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2178 | Open in IMG/M |
| 3300021560|Ga0126371_13019845 | Not Available | 570 | Open in IMG/M |
| 3300025324|Ga0209640_10082637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2775 | Open in IMG/M |
| 3300025537|Ga0210061_1022524 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300025912|Ga0207707_10005952 | All Organisms → cellular organisms → Bacteria | 10669 | Open in IMG/M |
| 3300025933|Ga0207706_10810496 | Not Available | 795 | Open in IMG/M |
| 3300025936|Ga0207670_10669598 | Not Available | 857 | Open in IMG/M |
| 3300025959|Ga0210116_1005303 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300025961|Ga0207712_11025429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300025988|Ga0208141_1002503 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300026535|Ga0256867_10007540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4780 | Open in IMG/M |
| 3300027364|Ga0209967_1042372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300027695|Ga0209966_1150322 | Not Available | 542 | Open in IMG/M |
| 3300027778|Ga0209464_10026275 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300027876|Ga0209974_10186743 | Not Available | 761 | Open in IMG/M |
| 3300027907|Ga0207428_10035024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4107 | Open in IMG/M |
| 3300027909|Ga0209382_10314763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → unclassified Mycoplasmatota → Tenericutes bacterium ADurb.BinA155 | 1762 | Open in IMG/M |
| 3300028587|Ga0247828_11068704 | Not Available | 532 | Open in IMG/M |
| 3300030619|Ga0268386_10033375 | All Organisms → cellular organisms → Bacteria | 4073 | Open in IMG/M |
| 3300030620|Ga0302046_11399329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10053917 | Not Available | 1051 | Open in IMG/M |
| 3300031226|Ga0307497_10194287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| (restricted) 3300031237|Ga0255334_1042096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1126659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300031547|Ga0310887_11048126 | Not Available | 522 | Open in IMG/M |
| 3300031720|Ga0307469_11363417 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300032004|Ga0307414_11863220 | Not Available | 561 | Open in IMG/M |
| 3300032144|Ga0315910_11426070 | Not Available | 540 | Open in IMG/M |
| 3300033412|Ga0310810_10021885 | All Organisms → cellular organisms → Bacteria | 7724 | Open in IMG/M |
| 3300033413|Ga0316603_12336155 | Not Available | 504 | Open in IMG/M |
| 3300033433|Ga0326726_10338909 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300033480|Ga0316620_10163612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1805 | Open in IMG/M |
| 3300033513|Ga0316628_102288902 | Not Available | 715 | Open in IMG/M |
| 3300033513|Ga0316628_104251953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300033551|Ga0247830_10599364 | Not Available | 872 | Open in IMG/M |
| 3300034149|Ga0364929_0001726 | All Organisms → cellular organisms → Bacteria | 5116 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.74% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 9.09% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.13% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.13% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 4.13% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.48% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.48% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.48% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.65% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.65% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.65% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.83% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.83% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.83% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004027 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012113 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT100_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031237 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_00495180 | 2199352025 | Soil | MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVA |
| 2213757312 | 2209111006 | Arabidopsis Rhizosphere | MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVLAAG |
| 2213796119 | 2209111006 | Arabidopsis Rhizosphere | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEAANXSAGXDKVD |
| INPgaii200_10498363 | 2228664022 | Soil | MNQNAKRNLQRRKRQATRLSKREYFKQKKEAINVSAAGKDKVS |
| ICChiseqgaiiDRAFT_21396503 | 3300000033 | Soil | MNQNAKRNSQRRKRQANRLSKREYFKTKKEALNVAAAAKDXAP* |
| Ga0055461_101964431 | 3300003991 | Natural And Restored Wetlands | MNQNAKRNLQRRKRQAARLSQREYFKSKKEAALKVPAEDKPKAA* |
| Ga0055461_102138242 | 3300003991 | Natural And Restored Wetlands | MNQNAKRNLQRRKRQATRFSKREYFRKKKEAAIGSATGKSL* |
| Ga0055466_100002443 | 3300003997 | Natural And Restored Wetlands | MNQNAKRNLQRRKRQAMRLAKREYFKKKKAAADPTSAVKNKVA* |
| Ga0055437_100138252 | 3300004009 | Natural And Restored Wetlands | MNQNAKRNLQRRKRQATRLSKREYFRKKKEALNVSAAGKDKVG* |
| Ga0055460_101363173 | 3300004011 | Natural And Restored Wetlands | MNQNAKRNLQRRKRQATRLSQREYFKSKKEAALKVPAEAKPKAA* |
| Ga0055439_100505302 | 3300004019 | Natural And Restored Wetlands | MNQNAKRNLQRRKRQATRLSKREYFRKKKEAISVSAAGKDKVG* |
| Ga0055459_101922572 | 3300004027 | Natural And Restored Wetlands | MNQNAKRNLQRRKRQAARLSQREYFKSKKEAALKVPAEAKPKAA* |
| Ga0055493_100297163 | 3300004049 | Natural And Restored Wetlands | MNQNAKRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDGTA* |
| Ga0055490_101470072 | 3300004052 | Natural And Restored Wetlands | MNQNAKRNLQRRKRQATRLSKREYFRKKKEAAIGSATGKSL* |
| Ga0062593_1010168582 | 3300004114 | Soil | MNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATAVKAKTE* |
| Ga0062589_1016756511 | 3300004156 | Soil | MNQNAKRNSQRRKRQANRLSKREYFKTKKEALNVAAAAKDRVA* |
| Ga0062589_1027181091 | 3300004156 | Soil | GGHPVNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATAVKAKTE* |
| Ga0063356_1005134562 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVSAAGKGKVA* |
| Ga0063356_1009767433 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDTAAAGKDNVAKPPSERK* |
| Ga0062595_1013340811 | 3300004479 | Soil | MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVA* |
| Ga0062591_1010528762 | 3300004643 | Soil | MNQNAKRNSQRRKRQANRLSKREYFKTKKEALNVAAAAKDRAP* |
| Ga0062383_100078453 | 3300004778 | Wetland Sediment | MNQNAKRNLHRRKQLAIRLSKRDYFRKKKEAALTVPAAEPIKVA* |
| Ga0065705_100101423 | 3300005294 | Switchgrass Rhizosphere | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALSVPAAGKDKVA* |
| Ga0066388_1008296871 | 3300005332 | Tropical Forest Soil | MNQNAKHNLQRRKRQAIRLSRREYFRKKKEAANQSAGKDKVD* |
| Ga0070680_1000097128 | 3300005336 | Corn Rhizosphere | MNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATATTTKTN* |
| Ga0070696_1000259804 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQNAKRNLPRRKRQAARLSKREYFRKKKEALEAATATTTKTN* |
| Ga0070704_1003934802 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQNAKRNLQHRKRQVARLAKREYFKKKKEALNAPAAGKDKVV* |
| Ga0074473_111769162 | 3300005830 | Sediment (Intertidal) | MNQNAKRNLQRRKRQASRLSKREYFRQKKEAANVSAAGKDNVKK* |
| Ga0074470_1010859313 | 3300005836 | Sediment (Intertidal) | MNQNAKRNLQRRKRQATRLSKREYFRQKKEALKVSTPGQKDKAG* |
| Ga0075277_10186112 | 3300005895 | Rice Paddy Soil | MNQNAKRNLQRRKRQANRLSKREYFRKKKETLTAAAAGKDKVA* |
| Ga0075428_1000407395 | 3300006844 | Populus Rhizosphere | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALNVPAAGKDKFV* |
| Ga0075421_1006799762 | 3300006845 | Populus Rhizosphere | MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPVTEKDKVT* |
| Ga0075421_1012577662 | 3300006845 | Populus Rhizosphere | MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKVKSV* |
| Ga0075421_1017437762 | 3300006845 | Populus Rhizosphere | MNQNAKRNLQHRKRQVARLAKREYFKKKKEALTAPAAGKDKVV* |
| Ga0075421_1021294132 | 3300006845 | Populus Rhizosphere | MNQNAKRNLQRRKRQAIRLSRREYFRKKKEATNVPAAGKDKVD* |
| Ga0075430_1004511592 | 3300006846 | Populus Rhizosphere | MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKDKSA* |
| Ga0075433_113685452 | 3300006852 | Populus Rhizosphere | MNQNAKRNLQRRKRQATRLSKREYFKQKKEAINVSAAGKDKVS* |
| Ga0075420_1006242952 | 3300006853 | Populus Rhizosphere | MNQNAKRNLQHRKRQVARLVKREYFRKKKEALNVPVTEKDKVA* |
| Ga0075429_1010825552 | 3300006880 | Populus Rhizosphere | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALNVPPAGKDKFV* |
| Ga0079218_116345062 | 3300007004 | Agricultural Soil | MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKDKSV* |
| Ga0105107_101745632 | 3300009087 | Freshwater Sediment | MNQNAKRNSQRRKRQANRLSKREYFKTKKEALNVAAAGKVKTA* |
| Ga0102851_112668542 | 3300009091 | Freshwater Wetlands | MNQNAKRNSQRRKRQANRLSKREYFKAKKEALNVAAAGKSKPA* |
| Ga0115026_115985071 | 3300009111 | Wetland | MNQNAKRNSQRRKRQANRLSKREYFKAKKEALNAAAA |
| Ga0114129_124994421 | 3300009147 | Populus Rhizosphere | MNQNAKRNLQRRKRQAIRLSRREYFRKKKEATNVPAAGKDK |
| Ga0075423_108943652 | 3300009162 | Populus Rhizosphere | MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKDKVA* |
| Ga0075423_118860952 | 3300009162 | Populus Rhizosphere | RNLQRRKRQAMRLSKREYFRKKKEALNVPAAGKDKFV* |
| Ga0113563_109199592 | 3300009167 | Freshwater Wetlands | MNQNAKRNSQRRKRQANRLSKREYFKTKKEALKVAAAAKDRAA* |
| Ga0105249_111870603 | 3300009553 | Switchgrass Rhizosphere | MNQNAKRNLQHRKRQVARLAKREYFRNKKEALNVSAAGKGKLA* |
| Ga0105347_10080171 | 3300009609 | Soil | MNQNAKRNSQRRKRQATRLSNREYFRKKKEAVDVSAAGQNKAA* |
| Ga0105340_10462402 | 3300009610 | Soil | MNQNARRNSQRRKRQATRLSNREYFRKKKEAVDMSAAGQNKAA* |
| Ga0134128_115861352 | 3300010373 | Terrestrial Soil | VNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATAVKAKTE* |
| Ga0137442_10419991 | 3300011414 | Soil | MNQIAQRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKGKVA* |
| Ga0137458_11357031 | 3300011436 | Soil | MNQNAKRNSQRRKRQATRLSKREYFRKKKEALNVSAAGKAKVA* |
| Ga0137452_10891131 | 3300011441 | Soil | VNQNAKRNSQRRKRQANRLSKREYFKAKKEALNVAAAGKDKAA* |
| Ga0137457_11464431 | 3300011443 | Soil | MNQIAKRNLQRRKRHATRASKREYFRKKKEAINVSAAG |
| Ga0137463_13679942 | 3300011444 | Soil | MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNGAAAGKDKVA* |
| Ga0137445_10628371 | 3300012035 | Soil | MNQIAQRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKDKVA* |
| Ga0137328_10303631 | 3300012113 | Soil | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALNVSAAGKAKVA* |
| Ga0137329_10103952 | 3300012133 | Soil | MNQNAKRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKDKVA* |
| Ga0137382_100707013 | 3300012200 | Vadose Zone Soil | MNQNAKSNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVA* |
| Ga0157340_10220441 | 3300012473 | Arabidopsis Rhizosphere | MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNMPAAGKDKVA* |
| Ga0157326_10026692 | 3300012513 | Arabidopsis Rhizosphere | MNQNAKRNLQRRKRQSIRLSKREYFRKKKEALNVPAAGKDKVA* |
| Ga0157305_101851882 | 3300012891 | Soil | KMNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVSAAGKGKVA* |
| Ga0153915_110026552 | 3300012931 | Freshwater Wetlands | MNQNAKRNLQRRKRQATRLAKREYFRKKKEALNAAAGKVKAG* |
| Ga0164305_115848771 | 3300012989 | Soil | MNQNAKRNLQRRKRQAIRLSKREYFRKKKETLNVPAAGKDKVA* |
| Ga0157378_121949073 | 3300013297 | Miscanthus Rhizosphere | LQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVA* |
| Ga0163162_110363052 | 3300013306 | Switchgrass Rhizosphere | MDQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAVGKDKVA* |
| Ga0075344_10598252 | 3300014296 | Natural And Restored Wetlands | KRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDRTA* |
| Ga0075340_10536402 | 3300014304 | Natural And Restored Wetlands | MNQNAKRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDRTA* |
| Ga0075343_10176851 | 3300014317 | Natural And Restored Wetlands | NQNAKRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDRTA* |
| Ga0137409_107461281 | 3300015245 | Vadose Zone Soil | MNQNAKRNLQRRKRQAIRLSRREYFRKKKEATNVPAAGK |
| Ga0132258_134022431 | 3300015371 | Arabidopsis Rhizosphere | MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKFV* |
| Ga0132256_1037615552 | 3300015372 | Arabidopsis Rhizosphere | MNQNAKRNLQRRKRQATRAAKREYFRKKKEAINASAPGKDT |
| Ga0132257_1001727143 | 3300015373 | Arabidopsis Rhizosphere | MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAAGKDKVG* |
| Ga0132257_1009326863 | 3300015373 | Arabidopsis Rhizosphere | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEAANPSAG |
| Ga0187825_100298813 | 3300017930 | Freshwater Sediment | MNQNAKRNLQRRKRQATRLAKREYFRKKKEALNAAAAGKVKAG |
| Ga0187821_104229192 | 3300017936 | Freshwater Sediment | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEAANQSAG |
| Ga0184640_102593671 | 3300018074 | Groundwater Sediment | MNQNAKRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKDKVA |
| Ga0184627_105092951 | 3300018079 | Groundwater Sediment | MNQNAKRNLQRRKRQATRLSKREYFRKKKEALNVSAAGKDKVA |
| Ga0184628_100381051 | 3300018083 | Groundwater Sediment | RNSQRRKRQATRLSNREYFRKKKEAVDMSAAGQNKAA |
| Ga0184629_100110424 | 3300018084 | Groundwater Sediment | MNQNAQRNLQRRKRQATRLSKREYFRKKKEALSVSAAGKAKVA |
| Ga0190265_100759874 | 3300018422 | Soil | MNQIAKRNLQRRKRQATRLAKREYFKKKKEALNAVAAGKDKVI |
| Ga0190265_133357962 | 3300018422 | Soil | NQNAKRNLQRRKRQAIRLSKREYFRKKQEAANPPAAGKEKSA |
| Ga0190270_101316832 | 3300018469 | Soil | MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKDKSA |
| Ga0190271_100502802 | 3300018481 | Soil | MNQNAKRNSQRRKRLATRLSNREYFRKKKEAVAVSAAGQDKAA |
| Ga0193739_10130034 | 3300020003 | Soil | MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPAAGKEKVA |
| Ga0126371_130198451 | 3300021560 | Tropical Forest Soil | RNVSNGGTNMNQNAKHNLQRRKRQAIRLSRREYFRKKKEAANQSAGKDKVD |
| Ga0209640_100826373 | 3300025324 | Soil | MNQNAKRNLQRRKRQAIRLSRREYFKKKQEAVIVPAAEKKKVG |
| Ga0210061_10225242 | 3300025537 | Natural And Restored Wetlands | MNQNAKRNLQRRKRQAMRLAKREYFKKKKAAADPTSAVKNKVA |
| Ga0207707_100059529 | 3300025912 | Corn Rhizosphere | MNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATATTTKTN |
| Ga0207706_108104961 | 3300025933 | Corn Rhizosphere | MNQNAKRNLQRRKRQAIRLSKREYFRKKKEALNVPAVGKDKVA |
| Ga0207670_106695983 | 3300025936 | Switchgrass Rhizosphere | MNQNAKRNLQRRKRQATRAAKREYFRKKKEASNVSAAGKDKTT |
| Ga0210116_10053031 | 3300025959 | Natural And Restored Wetlands | MNQNAKRNSQRRKRQANRLSKREYFKAKKEALKVAAAAKDRTA |
| Ga0207712_110254292 | 3300025961 | Switchgrass Rhizosphere | MNQNAKRNLQRRKRQAIRLSKREYFRKKKKALNVPAAGKDKVA |
| Ga0208141_10025032 | 3300025988 | Rice Paddy Soil | MNQNAKRNLQRRKRQANRLSKREYFRKKKETLTAAAAGKDKVA |
| Ga0256867_100075401 | 3300026535 | Soil | MNQNAKRNLQRRKRQATRLSKREYFRKKKEAINVSAAGKD |
| Ga0209967_10423721 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDTAAAGKDNVAKPPSERK |
| Ga0209966_11503221 | 3300027695 | Arabidopsis Thaliana Rhizosphere | TEGLNMNENAKRNLQRRKRQATRLSKREYFRKKKEAVDTAAAGKDNVAKPPSERK |
| Ga0209464_100262752 | 3300027778 | Wetland Sediment | MNQNAKRNLHRRKQLAIRLSKRDYFRKKKEAALTVPAAEPIKVA |
| Ga0209974_101867432 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDAAAAGKDNVAKP |
| Ga0207428_100350242 | 3300027907 | Populus Rhizosphere | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALNVPAAGKDKFV |
| Ga0209382_103147632 | 3300027909 | Populus Rhizosphere | MNQNAKRNLQHRKRQVARLAKREYFRKKKEALNVPVTEKDKVT |
| Ga0247828_110687041 | 3300028587 | Soil | MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDAAAAGKDNVAKPSLERK |
| Ga0268386_100333755 | 3300030619 | Soil | MNQNAKRNLQRRKRQATRLSKREYFRKKKEAINVSAAGKDKVG |
| Ga0302046_113993292 | 3300030620 | Soil | NLQRRKRQATRLSKREYFRKKKEAINVSAAGKDKVD |
| (restricted) Ga0255310_100539172 | 3300031197 | Sandy Soil | MNQNAKRNLQRRKRQATRLSKREYFRKKKEALSMPAVGKDKVT |
| Ga0307497_101942872 | 3300031226 | Soil | VFHGGTRMNQNAKRNLQRRKRQANRLSKREYFKTKKDTLNVTAAGKDKAA |
| (restricted) Ga0255334_10420962 | 3300031237 | Sandy Soil | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALSVPAAGKDKVA |
| (restricted) Ga0255312_11266592 | 3300031248 | Sandy Soil | MNQNAKRNLQRRKRQAMRLSKREYFRKKKEALSVPTAGKDKVA |
| Ga0310887_110481261 | 3300031547 | Soil | MIQNAKRNSQRRKRQANRLSKREYFKAKKEALNVAAAAKDKAA |
| Ga0307469_113634171 | 3300031720 | Hardwood Forest Soil | MNQNAKRNLQRRKRQATRLSKREYFKQKKEAINVS |
| Ga0307414_118632201 | 3300032004 | Rhizosphere | MNQNAKRNLQRRKRQAMRLAKREYFKKKKEAGNPAAAEKSTTGGTNQ |
| Ga0315910_114260701 | 3300032144 | Soil | MNQIAKRNLQRRKRQAMRLAKREYFRKKKEAVIAAAAGTDKAS |
| Ga0310810_100218855 | 3300033412 | Soil | VNQNAKRNLQRRKRQAARLSKREYFRKKKEALEAATAVKAKTE |
| Ga0316603_123361552 | 3300033413 | Soil | MNQNAKRNSQRRKRQANRLSKREYFKTKKEALKVAAAAKDRAA |
| Ga0326726_103389092 | 3300033433 | Peat Soil | MNQIAKRNLQRRKRQANRLSKREYFRTKKDALNIAAAGKDKAA |
| Ga0316620_101636123 | 3300033480 | Soil | MNQNAKRNLQRRKRQATRLAKREYFRKKKEALNAAAGKVKAG |
| Ga0316628_1022889021 | 3300033513 | Soil | MNQNAKRNLQRRKRQATRLAKREYFRKKKEALNAAAAGKVKAD |
| Ga0316628_1042519531 | 3300033513 | Soil | RMNQNAKRNLQRRKRQANRLSKREYFRAKKDALNVTAAGKDKAA |
| Ga0247830_105993642 | 3300033551 | Soil | MNENAKRNLQRRKRQATRLSKREYFRKKKEAVDTAPAGKNNVAKPPLERK |
| Ga0364929_0001726_817_948 | 3300034149 | Sediment | MNQNARRNSQRRKRQATRLSNREYFRKKKEAVDASAAGQNKAA |
| ⦗Top⦘ |