


| Basic Information | |
|---|---|
| Family ID | F072067 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTSNYALERSVRGSSERAAGAQTIIAPAARVSRLARPAQRGR |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 47.50 % |
| % of genes near scaffold ends (potentially truncated) | 60.33 % |
| % of genes from short scaffolds (< 2000 bps) | 76.86 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.372 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.570 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.058 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (24.793 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 5.88 |
| PF04365 | BrnT_toxin | 2.52 |
| PF05016 | ParE_toxin | 2.52 |
| PF14384 | BrnA_antitoxin | 2.52 |
| PF05973 | Gp49 | 2.52 |
| PF03473 | MOSC | 1.68 |
| PF01872 | RibD_C | 1.68 |
| PF12973 | Cupin_7 | 0.84 |
| PF03734 | YkuD | 0.84 |
| PF10675 | DUF2489 | 0.84 |
| PF10861 | DUF2784 | 0.84 |
| PF14119 | DUF4288 | 0.84 |
| PF11746 | DUF3303 | 0.84 |
| PF03703 | bPH_2 | 0.84 |
| PF00583 | Acetyltransf_1 | 0.84 |
| PF07007 | LprI | 0.84 |
| PF05901 | Excalibur | 0.84 |
| PF06271 | RDD | 0.84 |
| PF14078 | DUF4259 | 0.84 |
| PF09951 | DUF2185 | 0.84 |
| PF16826 | DUF5076 | 0.84 |
| PF03500 | Cellsynth_D | 0.84 |
| PF01551 | Peptidase_M23 | 0.84 |
| PF09720 | Unstab_antitox | 0.84 |
| PF06315 | AceK_kinase | 0.84 |
| PF04828 | GFA | 0.84 |
| PF08974 | DUF1877 | 0.84 |
| PF07087 | DUF1353 | 0.84 |
| PF00753 | Lactamase_B | 0.84 |
| PF02810 | SEC-C | 0.84 |
| PF11342 | DUF3144 | 0.84 |
| PF03061 | 4HBT | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 2.52 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 2.52 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 2.52 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.68 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.68 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.84 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.84 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.84 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.84 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.84 |
| COG4579 | Isocitrate dehydrogenase kinase/phosphatase | Signal transduction mechanisms [T] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.37 % |
| Unclassified | root | N/A | 44.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_14388979 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300000956|JGI10216J12902_102753823 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300000956|JGI10216J12902_104035533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2108 | Open in IMG/M |
| 3300003990|Ga0055455_10160011 | Not Available | 692 | Open in IMG/M |
| 3300004006|Ga0055453_10183136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Sideroxydans → Sideroxydans lithotrophicus | 652 | Open in IMG/M |
| 3300004013|Ga0055465_10026028 | Not Available | 1401 | Open in IMG/M |
| 3300004022|Ga0055432_10159343 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300004022|Ga0055432_10239105 | Not Available | 532 | Open in IMG/M |
| 3300004024|Ga0055436_10320194 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300004025|Ga0055433_10090471 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300004052|Ga0055490_10070599 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300004114|Ga0062593_100243949 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300004114|Ga0062593_100428577 | Not Available | 1195 | Open in IMG/M |
| 3300004156|Ga0062589_100021038 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
| 3300004156|Ga0062589_100021038 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
| 3300004156|Ga0062589_101256915 | Not Available | 712 | Open in IMG/M |
| 3300004157|Ga0062590_101225805 | Not Available | 733 | Open in IMG/M |
| 3300004463|Ga0063356_102213254 | Not Available | 837 | Open in IMG/M |
| 3300004463|Ga0063356_102356870 | Not Available | 813 | Open in IMG/M |
| 3300004463|Ga0063356_102537615 | Not Available | 786 | Open in IMG/M |
| 3300004463|Ga0063356_103045000 | Not Available | 722 | Open in IMG/M |
| 3300004463|Ga0063356_103458537 | Not Available | 680 | Open in IMG/M |
| 3300004463|Ga0063356_103571847 | Not Available | 670 | Open in IMG/M |
| 3300004463|Ga0063356_104133170 | Not Available | 625 | Open in IMG/M |
| 3300004463|Ga0063356_105148162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter | 562 | Open in IMG/M |
| 3300004463|Ga0063356_105500100 | Not Available | 544 | Open in IMG/M |
| 3300004479|Ga0062595_101417032 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin06 | 634 | Open in IMG/M |
| 3300005183|Ga0068993_10195839 | Not Available | 701 | Open in IMG/M |
| 3300005459|Ga0068867_101880914 | Not Available | 564 | Open in IMG/M |
| 3300005543|Ga0070672_100722122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300006845|Ga0075421_100035074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6351 | Open in IMG/M |
| 3300006846|Ga0075430_101519319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. 28-63-22 | 550 | Open in IMG/M |
| 3300006852|Ga0075433_11483669 | Not Available | 586 | Open in IMG/M |
| 3300006871|Ga0075434_102522719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 515 | Open in IMG/M |
| 3300006918|Ga0079216_10361711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 892 | Open in IMG/M |
| 3300007004|Ga0079218_10010641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4520 | Open in IMG/M |
| 3300007004|Ga0079218_10019579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3648 | Open in IMG/M |
| 3300007004|Ga0079218_10360061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300007004|Ga0079218_10633930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 985 | Open in IMG/M |
| 3300007004|Ga0079218_11120575 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300009087|Ga0105107_10985030 | Not Available | 587 | Open in IMG/M |
| 3300009610|Ga0105340_1004663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5650 | Open in IMG/M |
| 3300009678|Ga0105252_10002278 | All Organisms → cellular organisms → Bacteria | 7896 | Open in IMG/M |
| 3300009870|Ga0131092_10428868 | Not Available | 1218 | Open in IMG/M |
| 3300009870|Ga0131092_10573917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 992 | Open in IMG/M |
| 3300009870|Ga0131092_11503784 | Not Available | 510 | Open in IMG/M |
| 3300009873|Ga0131077_10043172 | All Organisms → cellular organisms → Bacteria | 6545 | Open in IMG/M |
| 3300009873|Ga0131077_10066447 | All Organisms → cellular organisms → Bacteria | 7508 | Open in IMG/M |
| 3300009873|Ga0131077_11522368 | Not Available | 549 | Open in IMG/M |
| 3300010362|Ga0126377_10354107 | Not Available | 1466 | Open in IMG/M |
| 3300010362|Ga0126377_10447417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1313 | Open in IMG/M |
| 3300010362|Ga0126377_11086180 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300010362|Ga0126377_11373510 | Not Available | 779 | Open in IMG/M |
| 3300010362|Ga0126377_12295319 | Not Available | 616 | Open in IMG/M |
| 3300010362|Ga0126377_12895984 | Not Available | 554 | Open in IMG/M |
| 3300010362|Ga0126377_13269989 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300011405|Ga0137340_1010163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agariperforans | 1690 | Open in IMG/M |
| 3300011420|Ga0137314_1086307 | Not Available | 767 | Open in IMG/M |
| 3300011435|Ga0137426_1081102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 893 | Open in IMG/M |
| 3300012133|Ga0137329_1058815 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012173|Ga0137327_1115074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300012179|Ga0137334_1000717 | All Organisms → cellular organisms → Bacteria | 5804 | Open in IMG/M |
| 3300012225|Ga0137434_1012391 | Not Available | 1009 | Open in IMG/M |
| 3300014296|Ga0075344_1134390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300014299|Ga0075303_1024290 | Not Available | 912 | Open in IMG/M |
| 3300014299|Ga0075303_1130502 | Not Available | 518 | Open in IMG/M |
| 3300014312|Ga0075345_1088808 | Not Available | 685 | Open in IMG/M |
| 3300014876|Ga0180064_1037507 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300018084|Ga0184629_10176279 | Not Available | 1096 | Open in IMG/M |
| 3300018429|Ga0190272_10396911 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300018429|Ga0190272_11542354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas soli | 678 | Open in IMG/M |
| 3300018429|Ga0190272_12754481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp18 | 541 | Open in IMG/M |
| 3300018481|Ga0190271_12371563 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300019356|Ga0173481_10622684 | Not Available | 571 | Open in IMG/M |
| 3300019360|Ga0187894_10473377 | Not Available | 547 | Open in IMG/M |
| 3300019458|Ga0187892_10014928 | Not Available | 8557 | Open in IMG/M |
| 3300019458|Ga0187892_10014928 | Not Available | 8557 | Open in IMG/M |
| 3300019458|Ga0187892_10067429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Pelagibius → Pelagibius marinus | 2309 | Open in IMG/M |
| 3300019487|Ga0187893_10240436 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300019487|Ga0187893_10241802 | Not Available | 1339 | Open in IMG/M |
| 3300019487|Ga0187893_10253148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 1295 | Open in IMG/M |
| 3300019487|Ga0187893_10333130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 1061 | Open in IMG/M |
| 3300019487|Ga0187893_10339328 | Not Available | 1047 | Open in IMG/M |
| 3300019487|Ga0187893_10405127 | Not Available | 922 | Open in IMG/M |
| 3300019487|Ga0187893_10481459 | Not Available | 815 | Open in IMG/M |
| 3300019487|Ga0187893_10518469 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300019487|Ga0187893_10581280 | Not Available | 714 | Open in IMG/M |
| 3300019487|Ga0187893_10760657 | Not Available | 592 | Open in IMG/M |
| 3300020221|Ga0194127_10788766 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300022204|Ga0224496_10003900 | All Organisms → cellular organisms → Bacteria | 8501 | Open in IMG/M |
| 3300022214|Ga0224505_10000593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 24451 | Open in IMG/M |
| 3300025106|Ga0209398_1011462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2905 | Open in IMG/M |
| 3300027362|Ga0208320_1000897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera → Methylotenera sp. | 3557 | Open in IMG/M |
| 3300027513|Ga0208685_1003817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4368 | Open in IMG/M |
| 3300027533|Ga0208185_1006191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3014 | Open in IMG/M |
| 3300027573|Ga0208454_1001244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10781 | Open in IMG/M |
| 3300027717|Ga0209998_10113512 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300027886|Ga0209486_10035200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2435 | Open in IMG/M |
| 3300027886|Ga0209486_10753780 | Not Available | 633 | Open in IMG/M |
| 3300027907|Ga0207428_11087945 | Not Available | 559 | Open in IMG/M |
| 3300028648|Ga0268299_1003964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12479 | Open in IMG/M |
| 3300028648|Ga0268299_1012219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 4095 | Open in IMG/M |
| 3300028648|Ga0268299_1014564 | All Organisms → cellular organisms → Bacteria | 3520 | Open in IMG/M |
| 3300030606|Ga0299906_10962241 | Not Available | 626 | Open in IMG/M |
| 3300030620|Ga0302046_10433459 | Not Available | 1079 | Open in IMG/M |
| 3300030620|Ga0302046_10650966 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300030620|Ga0302046_11260708 | Not Available | 579 | Open in IMG/M |
| 3300031455|Ga0307505_10035245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter silvisoli | 2252 | Open in IMG/M |
| 3300031576|Ga0247727_10560529 | Not Available | 869 | Open in IMG/M |
| 3300031731|Ga0307405_10554126 | Not Available | 931 | Open in IMG/M |
| 3300031858|Ga0310892_10347535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 951 | Open in IMG/M |
| 3300031995|Ga0307409_102726457 | Not Available | 522 | Open in IMG/M |
| 3300032002|Ga0307416_100178786 | Not Available | 1986 | Open in IMG/M |
| 3300032017|Ga0310899_10040077 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300032144|Ga0315910_10166326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1646 | Open in IMG/M |
| 3300032144|Ga0315910_10390544 | Not Available | 1065 | Open in IMG/M |
| 3300032157|Ga0315912_10043976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3548 | Open in IMG/M |
| 3300032157|Ga0315912_10888730 | Not Available | 708 | Open in IMG/M |
| 3300034169|Ga0370480_0279979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300034194|Ga0370499_0130234 | Not Available | 644 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 11.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.57% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 9.09% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 9.09% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 7.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.79% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 4.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.13% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.48% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 2.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.48% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 2.48% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.65% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.83% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300027362 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028648 | Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor | Engineered | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| 3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_143889795 | 3300000363 | Soil | MSETSNYALERLVMAWQGRAAGAGTIIAPAARGPGFLRPAQRGR* |
| JGI10216J12902_1027538231 | 3300000956 | Soil | MPNYALERSVKGWWGRAAGAQTIIAPAARVSRLARPAQ |
| JGI10216J12902_1040355334 | 3300000956 | Soil | MGVVMPNYTLERAVTCSSERAAGARTIMAPAAPGECLARPAQRGR* |
| Ga0055455_101600112 | 3300003990 | Natural And Restored Wetlands | MSRLPNYALERSVRGSSERAAGAQTIIAPAARVSRLARPAQRG |
| Ga0055453_101831363 | 3300004006 | Natural And Restored Wetlands | MTAIQFATSNYALERAVKSWSERTAGAQKIIAPAARRPGSAAAAQRGR* |
| Ga0055465_100260281 | 3300004013 | Natural And Restored Wetlands | MSNYALERTVKSPSKRAAGAQKIIAPAARRSGSCPAAQRGR* |
| Ga0055432_101593432 | 3300004022 | Natural And Restored Wetlands | NYALERSVKSWSERAAGARTIIAPAARWLRSCAAAQRGRWA* |
| Ga0055432_102391051 | 3300004022 | Natural And Restored Wetlands | MPNYALERSVKGLGERAAGARNIVAPAARVSRVARPAQRGR* |
| Ga0055436_103201941 | 3300004024 | Natural And Restored Wetlands | PLDRASGASGITGLMPNYALERSVKSSSERAAGAQKIIAPAARWPGSRAAAQRGR* |
| Ga0055433_100904712 | 3300004025 | Natural And Restored Wetlands | MMPNYALERPVRSSSERAAGAQNIIAPAARWPGSRAAAQRGR* |
| Ga0055490_100705991 | 3300004052 | Natural And Restored Wetlands | MPPELPNYALERSVTALSERAAGAQRDFTPAARWNSLARP |
| Ga0062593_1002439491 | 3300004114 | Soil | SNYALERSVTALSERAAGAQKIVLPAARVSRLARPAQRGR* |
| Ga0062593_1004285773 | 3300004114 | Soil | MTRRAAYGVTPNYALERSVTALSVRAAGARRDFAPTARWRHITRPAQRGR* |
| Ga0062589_1000210383 | 3300004156 | Soil | MTRRAAYGVTPNYALERSVTALSVRAAGACRDFAPTARWRHITRPARRGR* |
| Ga0062589_1000210385 | 3300004156 | Soil | VSLQSNYALERSVTALSERAAGAQKIVLPAARVSRLARPAQRGR* |
| Ga0062589_1012569152 | 3300004156 | Soil | MGWLPNYALERSVTGFSERAAGARINIAPAARRPRCARPDQRGRLAADCARDN* |
| Ga0062590_1012258051 | 3300004157 | Soil | MGWLPNYALERSVTGFSERAAGARINIAPAARRPRCARPDQRGRLAAD |
| Ga0063356_1022132541 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AMTPNYALERSETGSNERAAGAQKIIAPAARGNGPARPAQRGRLAP* |
| Ga0063356_1023568702 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MMWPNYALESVKGFGWRAAGAPEEFAAAARWLRLARPAQRGR* |
| Ga0063356_1025376153 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VLRSNYALERSVRGLSERAAGARTIFAPAARRPCLARPAQRGRWA |
| Ga0063356_1030450002 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TPNYALERAVRALSERTAGARRDFTPAARWPRLALPAQRGR* |
| Ga0063356_1034585372 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIAAPPNNALERSVRGLQERAAGARTIIAPAARVSRLTRPAQRERWASIS |
| Ga0063356_1035718472 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPSNYALERAVGALSERAVRVQNDSTLAARRLRVARPAQRGR* |
| Ga0063356_1041331702 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTPNNALERSVMGLKERAAGAQKIIAPAAHIGRLARPAQRGR |
| Ga0063356_1051481621 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKPNYALERAAKACGWRAAGAQNIIAPAARWLRLARPAQRGRWASL* |
| Ga0063356_1055001002 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MFLAVTTLLPNNALERSVRGFSERAAGARTIVAPAARVSRLARP |
| Ga0062595_1014170322 | 3300004479 | Soil | MSSNYALERSEKESRKRAAGARNIVAPAARVSRLARPAQRGR* |
| Ga0068993_101958391 | 3300005183 | Natural And Restored Wetlands | RAVVTPNYALERSVKSSSKRAAGARKIIAPGARLPRLARPAQRGR* |
| Ga0068867_1018809141 | 3300005459 | Miscanthus Rhizosphere | MVRPNYALERSVKGSSERAAGARTIIAPAARGPRLARPAQRGR |
| Ga0070672_1007221223 | 3300005543 | Miscanthus Rhizosphere | RSVRGSSERAAGALEIVALAAPIGGEPRPAQRGR* |
| Ga0075421_10003507410 | 3300006845 | Populus Rhizosphere | MPARLPNYALERSVTRWLWRAAGARTIIAPAARWPRLARPAQRGR* |
| Ga0075430_1015193192 | 3300006846 | Populus Rhizosphere | MPSNYALERSVVGSSKRAAGARKIIAFAARILRLARPAQRGR* |
| Ga0075433_114836692 | 3300006852 | Populus Rhizosphere | MLPNYALERSVTDSSERAAGAQTIITPAARRPRCARPAQR |
| Ga0075434_1025227192 | 3300006871 | Populus Rhizosphere | MLPNYALERSVTSLSERATGAQTITAPAARRPRCAR |
| Ga0079216_103617112 | 3300006918 | Agricultural Soil | MDARSNYALERSVTGWIKRAAGARAMIAPAARIMRRARPAQRGR* |
| Ga0079218_100106414 | 3300007004 | Agricultural Soil | MMPNYALERSVTAWSERAAGAPEKFALAARWFGLARPAQRGR* |
| Ga0079218_100195793 | 3300007004 | Agricultural Soil | MDARSNYALERSVTGWIKRAAGARAMIAPAARIMRRTRPAQRGR* |
| Ga0079218_103600613 | 3300007004 | Agricultural Soil | MMPNYALELSVTGFSERAAGAQTIIAPAARRSGWPQPAKRGR* |
| Ga0079218_106339304 | 3300007004 | Agricultural Soil | LERSVRALSERAAGAQNIIAPAARWPRLARPAQRGR* |
| Ga0079218_111205753 | 3300007004 | Agricultural Soil | MRSNYALERSVTGSSERAAGAQTIIAPAARRPRLAR |
| Ga0105107_109850301 | 3300009087 | Freshwater Sediment | MRSNYALERSVKGSSERAAGAQTIVAPAARRPRLAR |
| Ga0105340_100466311 | 3300009610 | Soil | MPPNNALERSVTALSERAAGARTIVAPAVRRPRTARPAQRGR* |
| Ga0105252_100022781 | 3300009678 | Soil | PNYALERAVRALSERAAGAPEEFAPATRCNGLARPAQRGR* |
| Ga0131092_104288681 | 3300009870 | Activated Sludge | CGFQLAMTPNYALERAVKSRSERAAGARTIIAPAARRPRSAAAAQRGR* |
| Ga0131092_105739173 | 3300009870 | Activated Sludge | MTPNYALERAVKSWSERAAGAQKIIAPAARWPRSAAAAQRGR* |
| Ga0131092_115037841 | 3300009870 | Activated Sludge | NYALERSVKSWSERAAGAQKIIAPAARRPGSAAAAQRGR* |
| Ga0131077_1004317212 | 3300009873 | Wastewater | MLPNFALERSGTALSVRAAVALAILAPAARWPRRARPAQRGR* |
| Ga0131077_100664472 | 3300009873 | Wastewater | MDLALGLAPPNYALERSVTRSSMRAAGAQKIIAPAARFSRRARPAQRGR* |
| Ga0131077_115223681 | 3300009873 | Wastewater | VTSNYALERSVRALSERAAGARTIIAPAARWPRLARPAQ |
| Ga0126377_103541074 | 3300010362 | Tropical Forest Soil | GITGLMPNYALERSGTALSERAAGAQEIIAPAARRPRLARPAQRGR* |
| Ga0126377_104474174 | 3300010362 | Tropical Forest Soil | MTANYALERSLKGLWERAAGARKIIVPAARRPRPARP |
| Ga0126377_110861804 | 3300010362 | Tropical Forest Soil | NYALERSGTALSERAARVRNDFTLAARRPRGARPAQRGR* |
| Ga0126377_113735101 | 3300010362 | Tropical Forest Soil | ALERSVTALSLRAAGARKIIAPAARGPRFTRPAQRGR* |
| Ga0126377_122953191 | 3300010362 | Tropical Forest Soil | MLPNYALERSGTALSLRAAGARNIIAPAARCPGCARTAQ |
| Ga0126377_128959841 | 3300010362 | Tropical Forest Soil | SNYALERSVTALSQRAAGAQKIIAPAARRPRRARPAQRGR* |
| Ga0126377_132699892 | 3300010362 | Tropical Forest Soil | MTDLTSNYALERSGTALSERAAGARKIIAPAARGPGCARTAQRG |
| Ga0137340_10101634 | 3300011405 | Soil | VVRMRPNNALERSVKDCGWRAAGARTIIAPAARQMRFVRPAQ |
| Ga0137314_10863071 | 3300011420 | Soil | MPPNNALERSVTALSERAAGARTIVAPAVRRPRTARPAQR |
| Ga0137426_10811021 | 3300011435 | Soil | GIVVEMGVWSNYALERSVRAVSERAAAARRHFTPAARWPRIVRPAQRGR* |
| Ga0137329_10588152 | 3300012133 | Soil | ALERAVRALSERAAGAPEEFAPATRCNGLARPAQRGR* |
| Ga0137327_11150742 | 3300012173 | Soil | SNYALERSVTGFRERAAGARTIIAPTTRRPRLARPAQRGR* |
| Ga0137334_100071712 | 3300012179 | Soil | MTNCLLSNYALERSVTALSERAAGAWTIVAPAARRPRFARPAQRGR* |
| Ga0137434_10123914 | 3300012225 | Soil | VPPNYALERAVRALSERAAGAPEEFAPATRCNGLARPAQRGR* |
| Ga0075344_11343901 | 3300014296 | Natural And Restored Wetlands | VTSNYALERSVTGSSERAAGARKEFTPAARWNSFARPAQRGR |
| Ga0075303_10242903 | 3300014299 | Natural And Restored Wetlands | SNYALERAVKSWSERAAGARRDFTPAARWNGLARPAQRGR* |
| Ga0075303_11305022 | 3300014299 | Natural And Restored Wetlands | ALERSVTALSERAAGAPEEFAPAARWNGLARPAQRGR* |
| Ga0075345_10888081 | 3300014312 | Natural And Restored Wetlands | LPNNALERPVNGHPLCAAGAQTIIAPAALGKGLARPAQRGR* |
| Ga0180064_10375071 | 3300014876 | Soil | IKMPNYALERSVTGFSERAAGAQTIIAPAARRPRLARPAQRGR* |
| Ga0184629_101762792 | 3300018084 | Groundwater Sediment | MRCHKMFELRSNYALERSVKGLSVRAAGARNHYAPAARWLRLARPAQRGR |
| Ga0190272_103969112 | 3300018429 | Soil | MQIYARACSNNALERSVTGLSEGTAGARTIIAHAARVMRLARPAQRGR |
| Ga0190272_115423541 | 3300018429 | Soil | MRPNNALERSVKGQSERAAGAQTIIAPAARWLRLARPAQRGR |
| Ga0190272_127544812 | 3300018429 | Soil | LLSTENRLHLVYEFASSNNALERSVTGLSERAAGAQTIIAPAARWFGLARPAQRGR |
| Ga0190271_123715631 | 3300018481 | Soil | MNPMSVWSNYAFERSVRGLSERAAGAQTIIAPAARWFGLARPAQRG |
| Ga0173481_106226842 | 3300019356 | Soil | VSLQSNYALERSVTALSERAAGAQKIVLPAARVSRLARPAQRGR |
| Ga0187894_104733771 | 3300019360 | Microbial Mat On Rocks | MDNVSGASGITGLMPNYALERSVTALSKRAAGAQIIIIAPAARWPRIARPAQRGL |
| Ga0187892_100149281 | 3300019458 | Bio-Ooze | MAVARLMSNYALERSVKSWGRRAAGARTIFAPAARYPRSTAAAQRGR |
| Ga0187892_1001492816 | 3300019458 | Bio-Ooze | MGTIAPPNYALERSVRDWSERAAGARTIIAPAARVVRLARSAQRGR |
| Ga0187892_100674296 | 3300019458 | Bio-Ooze | SNYALERSVTQLSERAAGARKIIAPAVRCPGCARTAQRGR |
| Ga0187893_102404361 | 3300019487 | Microbial Mat On Rocks | MNACNEQLPNYALERTVIALSERAAGALTIIAPAARWPRIARPAQRGR |
| Ga0187893_102418022 | 3300019487 | Microbial Mat On Rocks | MRSNYAFERSVKGWSERAAGAPTIIAPAARRLRCTAAAQRER |
| Ga0187893_102531482 | 3300019487 | Microbial Mat On Rocks | MMPNYAFERSVTRMSLRAAGAQAIFAPAARWPRLARPAQRGR |
| Ga0187893_103331302 | 3300019487 | Microbial Mat On Rocks | MSNYALERSVRDWSERAAGARTIIAPAARRPGCARPAQRGR |
| Ga0187893_103393281 | 3300019487 | Microbial Mat On Rocks | TFLSESGMSFGIVPSNYALERSVTQLSERAAGARKIIAPAVRCPGCARTAQRGR |
| Ga0187893_104051273 | 3300019487 | Microbial Mat On Rocks | MPNYAFERSVTRMSLRAAGARTIIAPAARRPRFARTAQRGRYAAL |
| Ga0187893_104814591 | 3300019487 | Microbial Mat On Rocks | NYAFERSVTGLLERAAGVQYDFTPAARRPRFARPAQRGR |
| Ga0187893_105184692 | 3300019487 | Microbial Mat On Rocks | NYALERSVTALSKRAAGAQKIIAPAARRPRFARPAQRGR |
| Ga0187893_105812801 | 3300019487 | Microbial Mat On Rocks | SNYALERSVKSWSERAAGARTIIAPAARRQSFAQPAQRKR |
| Ga0187893_107606572 | 3300019487 | Microbial Mat On Rocks | TFLSESGMSFGIVPSNYALERSVTQLSERAAGARKIIAPAARRRGRARSAQRGR |
| Ga0194127_107887662 | 3300020221 | Freshwater Lake | PNYALERTVKGSSKRAAGAPEEFAPAARWNGLARPAQRGR |
| Ga0224496_100039003 | 3300022204 | Sediment | MPNNALERTVRSWSEHAAGARTIFAPAARVSRLARPAQRGRYTPPKLFLNA |
| Ga0224505_1000059330 | 3300022214 | Sediment | VMPNNALERTVRSWSEHAAGARTIFAPAARVSRLARPAQRGRYTPPKLFLNA |
| Ga0209398_10114624 | 3300025106 | Groundwater | MLPNFALERSGTALSVRAAVALEILAPAARWPRRARPAQRGR |
| Ga0208320_10008974 | 3300027362 | Soil | MSNYALERSVRDSSERAAGAQTIIAPAARRPGCARPAQRGR |
| Ga0208685_10038179 | 3300027513 | Soil | MTNCLLSNYALERSVTALSERAAGAWTIVAPAARRPRFARPAQRGR |
| Ga0208185_10061918 | 3300027533 | Soil | NYALERAVRALSERAAGAPEEFAPATRCNGLARPAQRGR |
| Ga0208454_100124421 | 3300027573 | Soil | MPPNNALERSVTALSERAAGARTIVAPAVRRPRTARPAQRGR |
| Ga0209971_11530281 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MSNYALERSMTGSAVGAAGAPEIIAPAAPAIRRAR |
| Ga0209998_101135122 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MSETSNYALERLVMAWQGRAAGAGTIIAPAARGPGFPRPAQRER |
| Ga0209486_100352006 | 3300027886 | Agricultural Soil | MMPNYALELSVTGFSERAVGAQTIIAPAARRSGWPQPAKRGR |
| Ga0209486_107537802 | 3300027886 | Agricultural Soil | VPPNYALERSVRGWSERAAGAQTIIAPAARRPGCARPAQRGR |
| Ga0207428_110879451 | 3300027907 | Populus Rhizosphere | MPARLPNYALERSVTRWLWRAAGARTIIAPAARWPRLA |
| Ga0268299_100396413 | 3300028648 | Activated Sludge | MPNYALERAVRALSERAAGAQKIVAPAARWPRVARPAQRGR |
| Ga0268299_10122193 | 3300028648 | Activated Sludge | MNAMRSNYALERAVRALSERAAGAQKIVAPAARRPRVARPAQRGR |
| Ga0268299_10145641 | 3300028648 | Activated Sludge | PNYALERSVKALSERAAGAPEKFAPAARWPRYARPAQRGR |
| Ga0299906_109622411 | 3300030606 | Soil | MQSNYALERSVKGLSERAAGAQTIIAPAARWLRLARPA |
| Ga0302046_104334593 | 3300030620 | Soil | MQSNYALERSVKGLSERAAGAQTIIAPAARWLRLARPAQRG |
| Ga0302046_106509661 | 3300030620 | Soil | PNYALERAVKGSSERAAGARTIFAPAARRLRLARPAQRGR |
| Ga0302046_112607081 | 3300030620 | Soil | MTPNYALERSVRGSSERATGARTIFAPAARWNGLAR |
| Ga0307505_100352454 | 3300031455 | Soil | MDLISNYALERPVKGLCERAAGARTIIAPAARRSFCARTAQRGR |
| Ga0247727_105605293 | 3300031576 | Biofilm | ESTFTLIVTTMTSNYALERSVKGFRERAAGAQTIIAPAARQPGCARPAQRGR |
| Ga0307405_105541263 | 3300031731 | Rhizosphere | TNLEGHPSQMMPNYALERAVKGSRERAAGARKIIAPAARGPGCDRPAQRGR |
| Ga0310892_103475353 | 3300031858 | Soil | PNYALERAVRALSERAAGAPEEFAPAARWPRCARPAQRGR |
| Ga0307409_1027264571 | 3300031995 | Rhizosphere | NYALVRSVCGFRERAAGARTIIAPAARWPRIARPAQRGR |
| Ga0307416_1001787862 | 3300032002 | Rhizosphere | MKLRTPNYALERSVKRLHERAAGAQKIIAPAARRPRFARTAQRGR |
| Ga0310899_100400774 | 3300032017 | Soil | ERAVKGCGWRAAGAPEEFAPVARWPRLARPAQRGR |
| Ga0315910_101663261 | 3300032144 | Soil | MTSNYALERSVRGSSERAAGAQTIIAPAARVSRLARPAQRGR |
| Ga0315910_103905442 | 3300032144 | Soil | MVMSNYALERSVTGFRERAAGAQKIIAPAARVSRRARPAQRGR |
| Ga0315912_100439763 | 3300032157 | Soil | MSNYALERSVRGLCERAAGAQTIIAPAARVSRLARPAQRGR |
| Ga0315912_108887301 | 3300032157 | Soil | SQLNQGNDPLATSNYALERTVKGLCERAAGAQTIIAPAARCPRLARPAQRGR |
| Ga0370480_0279979_425_559 | 3300034169 | Untreated Peat Soil | MKTVRSNVMTSNYALERSVKTCGSRAAGARSDFTPAARLPRLARP |
| Ga0370499_0130234_3_110 | 3300034194 | Untreated Peat Soil | MPNYALERSVKGCGWRAAGAQKILSPAARCNGLARP |
| ⦗Top⦘ |