


| Basic Information | |
|---|---|
| Family ID | F072057 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Number of Associated Samples | 60 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.34 % |
| % of genes near scaffold ends (potentially truncated) | 31.40 % |
| % of genes from short scaffolds (< 2000 bps) | 80.99 % |
| Associated GOLD sequencing projects | 50 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.678 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (46.281 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.562 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.893 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.67% β-sheet: 0.00% Coil/Unstructured: 61.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF02486 | Rep_trans | 20.00 |
| PF01507 | PAPS_reduct | 5.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG2946 | DNA relaxase NicK | Replication, recombination and repair [L] | 20.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.29 % |
| Unclassified | root | N/A | 34.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2010170002|BISONQ_C11480 | Not Available | 1417 | Open in IMG/M |
| 2015219002|YNP15_C8825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1157 | Open in IMG/M |
| 2016842003|YNP16_C4421 | Not Available | 863 | Open in IMG/M |
| 3300002493|JGI24185J35167_1029155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1363 | Open in IMG/M |
| 3300002493|JGI24185J35167_1045611 | Not Available | 926 | Open in IMG/M |
| 3300002493|JGI24185J35167_1046653 | Not Available | 908 | Open in IMG/M |
| 3300002493|JGI24185J35167_1067931 | Not Available | 660 | Open in IMG/M |
| 3300002493|JGI24185J35167_1072255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 628 | Open in IMG/M |
| 3300002510|JGI24186J35511_1007488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2576 | Open in IMG/M |
| 3300002510|JGI24186J35511_1008978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2273 | Open in IMG/M |
| 3300002510|JGI24186J35511_1022360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1126 | Open in IMG/M |
| 3300002510|JGI24186J35511_1027022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 963 | Open in IMG/M |
| 3300003688|Ga0061020_1037994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1258 | Open in IMG/M |
| 3300003688|Ga0061020_1040681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1192 | Open in IMG/M |
| 3300005240|Ga0068641_101321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 803 | Open in IMG/M |
| 3300005240|Ga0068641_101620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1982 | Open in IMG/M |
| 3300005240|Ga0068641_101910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 789 | Open in IMG/M |
| 3300005241|Ga0068642_101157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 633 | Open in IMG/M |
| 3300005242|Ga0068639_102728 | Not Available | 851 | Open in IMG/M |
| 3300005246|Ga0068638_196531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1130 | Open in IMG/M |
| 3300005247|Ga0068637_1002412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 792 | Open in IMG/M |
| 3300005247|Ga0068637_1015504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 834 | Open in IMG/M |
| 3300005248|Ga0068636_1007888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 861 | Open in IMG/M |
| 3300005248|Ga0068636_1063042 | Not Available | 856 | Open in IMG/M |
| 3300005249|Ga0068645_1139836 | Not Available | 662 | Open in IMG/M |
| 3300005251|Ga0068634_1007464 | Not Available | 973 | Open in IMG/M |
| 3300005390|Ga0068657_167390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 832 | Open in IMG/M |
| 3300005411|Ga0068647_1104766 | Not Available | 834 | Open in IMG/M |
| 3300005411|Ga0068647_1117510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 799 | Open in IMG/M |
| 3300005414|Ga0068646_1004503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 803 | Open in IMG/M |
| 3300005452|Ga0068706_1020049 | Not Available | 1506 | Open in IMG/M |
| 3300005452|Ga0068706_1027873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1175 | Open in IMG/M |
| 3300005452|Ga0068706_1059727 | Not Available | 684 | Open in IMG/M |
| 3300005452|Ga0068706_1067411 | Not Available | 634 | Open in IMG/M |
| 3300005453|Ga0068705_10029203 | All Organisms → Viruses → Predicted Viral | 2025 | Open in IMG/M |
| 3300005453|Ga0068705_10049526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1351 | Open in IMG/M |
| 3300005501|Ga0068650_1015446 | Not Available | 909 | Open in IMG/M |
| 3300005638|Ga0068669_1293439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 774 | Open in IMG/M |
| 3300006068|Ga0081428_113080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 651 | Open in IMG/M |
| 3300006068|Ga0081428_121380 | Not Available | 716 | Open in IMG/M |
| 3300006849|Ga0102029_1004417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 991 | Open in IMG/M |
| 3300006849|Ga0102029_1020935 | Not Available | 895 | Open in IMG/M |
| 3300007000|Ga0102499_1119796 | Not Available | 549 | Open in IMG/M |
| 3300007885|Ga0111098_10036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 4367 | Open in IMG/M |
| 3300007885|Ga0111098_10796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 996 | Open in IMG/M |
| 3300010023|Ga0130028_102349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 933 | Open in IMG/M |
| 3300010184|Ga0124920_1123423 | Not Available | 550 | Open in IMG/M |
| 3300010189|Ga0124915_1142954 | Not Available | 581 | Open in IMG/M |
| 3300010190|Ga0124925_1035987 | Not Available | 865 | Open in IMG/M |
| 3300010190|Ga0124925_1062903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 816 | Open in IMG/M |
| 3300010191|Ga0124914_1042203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 746 | Open in IMG/M |
| 3300010191|Ga0124914_1077370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 778 | Open in IMG/M |
| 3300010194|Ga0124921_1021168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 889 | Open in IMG/M |
| 3300010256|Ga0124939_1004771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 808 | Open in IMG/M |
| 3300010256|Ga0124939_1152038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 836 | Open in IMG/M |
| 3300026237|Ga0209750_1005800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 3410 | Open in IMG/M |
| 3300026237|Ga0209750_1015515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1730 | Open in IMG/M |
| 3300026237|Ga0209750_1018337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1538 | Open in IMG/M |
| 3300026278|Ga0209018_1093865 | Not Available | 583 | Open in IMG/M |
| 3300026280|Ga0209017_10041774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1093 | Open in IMG/M |
| 3300026280|Ga0209017_10084600 | Not Available | 623 | Open in IMG/M |
| 3300026509|Ga0209809_1061858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1087 | Open in IMG/M |
| 3300026509|Ga0209809_1107232 | Not Available | 698 | Open in IMG/M |
| 3300027279|Ga0209691_1011522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2702 | Open in IMG/M |
| 3300027279|Ga0209691_1028135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1251 | Open in IMG/M |
| 3300031245|Ga0308395_1053940 | Not Available | 1039 | Open in IMG/M |
| 3300031508|Ga0308394_1036725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1240 | Open in IMG/M |
| 3300031509|Ga0308399_1091149 | Not Available | 614 | Open in IMG/M |
| 3300031513|Ga0308412_1011889 | All Organisms → Viruses → Predicted Viral | 4044 | Open in IMG/M |
| 3300031513|Ga0308412_1020496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2763 | Open in IMG/M |
| 3300031513|Ga0308412_1027775 | All Organisms → Viruses → Predicted Viral | 2230 | Open in IMG/M |
| 3300031513|Ga0308412_1036699 | Not Available | 1818 | Open in IMG/M |
| 3300031513|Ga0308412_1038232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1764 | Open in IMG/M |
| 3300031513|Ga0308412_1054265 | Not Available | 1366 | Open in IMG/M |
| 3300031513|Ga0308412_1062265 | Not Available | 1233 | Open in IMG/M |
| 3300031513|Ga0308412_1071324 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300031513|Ga0308412_1085973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 971 | Open in IMG/M |
| 3300031513|Ga0308412_1103531 | Not Available | 850 | Open in IMG/M |
| 3300031516|Ga0308398_1061340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 896 | Open in IMG/M |
| 3300031517|Ga0308392_1019035 | Not Available | 1897 | Open in IMG/M |
| 3300031568|Ga0308393_1067524 | Not Available | 800 | Open in IMG/M |
| 3300031767|Ga0308401_1007470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2727 | Open in IMG/M |
| 3300031783|Ga0308418_1036794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1280 | Open in IMG/M |
| 3300031812|Ga0308411_10033779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2573 | Open in IMG/M |
| 3300031812|Ga0308411_10052413 | All Organisms → Viruses → Predicted Viral | 1838 | Open in IMG/M |
| 3300031812|Ga0308411_10056413 | All Organisms → Viruses → Predicted Viral | 1735 | Open in IMG/M |
| 3300031812|Ga0308411_10114593 | Not Available | 1007 | Open in IMG/M |
| 3300031875|Ga0308405_1051141 | Not Available | 1136 | Open in IMG/M |
| 3300031875|Ga0308405_1065442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 953 | Open in IMG/M |
| 3300031875|Ga0308405_1119558 | Not Available | 624 | Open in IMG/M |
| 3300031878|Ga0308404_1007105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2807 | Open in IMG/M |
| 3300031878|Ga0308404_1011504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2093 | Open in IMG/M |
| 3300031950|Ga0308417_1014266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 4217 | Open in IMG/M |
| 3300031950|Ga0308417_1035336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2245 | Open in IMG/M |
| 3300031950|Ga0308417_1035353 | All Organisms → Viruses → Predicted Viral | 2244 | Open in IMG/M |
| 3300031950|Ga0308417_1035353 | All Organisms → Viruses → Predicted Viral | 2244 | Open in IMG/M |
| 3300031950|Ga0308417_1069087 | Not Available | 1361 | Open in IMG/M |
| 3300031950|Ga0308417_1079303 | Not Available | 1228 | Open in IMG/M |
| 3300031950|Ga0308417_1239623 | Not Available | 550 | Open in IMG/M |
| 3300031958|Ga0308410_1018528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2914 | Open in IMG/M |
| 3300031958|Ga0308410_1060878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1175 | Open in IMG/M |
| 3300031958|Ga0308410_1096412 | Not Available | 835 | Open in IMG/M |
| 3300031958|Ga0308410_1180089 | Not Available | 539 | Open in IMG/M |
| 3300031980|Ga0308403_1027040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1292 | Open in IMG/M |
| 3300032049|Ga0308416_1007794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2991 | Open in IMG/M |
| 3300032049|Ga0308416_1010984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2418 | Open in IMG/M |
| 3300032056|Ga0308310_1043376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1308 | Open in IMG/M |
| 3300032057|Ga0308421_1014421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2798 | Open in IMG/M |
| 3300032058|Ga0308419_1040993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1723 | Open in IMG/M |
| 3300032058|Ga0308419_1128116 | Not Available | 686 | Open in IMG/M |
| 3300032356|Ga0308414_1038235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2149 | Open in IMG/M |
| 3300032356|Ga0308414_1088154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1132 | Open in IMG/M |
| 3300032356|Ga0308414_1095421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1063 | Open in IMG/M |
| 3300033886|Ga0308413_013533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 3087 | Open in IMG/M |
| 3300033886|Ga0308413_034586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1571 | Open in IMG/M |
| 3300033886|Ga0308413_034587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1571 | Open in IMG/M |
| 3300033886|Ga0308413_043211 | Not Available | 1332 | Open in IMG/M |
| 3300033886|Ga0308413_057039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1086 | Open in IMG/M |
| 3300033886|Ga0308413_068275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 953 | Open in IMG/M |
| 3300034646|Ga0372965_029399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 781 | Open in IMG/M |
| 3300034649|Ga0372972_037712 | Not Available | 678 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 46.28% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 38.84% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 8.26% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 2.48% |
| Hotsprings | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hotsprings | 1.65% |
| Planktonic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Planktonic | 1.65% |
| Terrestrial Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2010170002 | 4_050719Q | Environmental | Open in IMG/M |
| 2015219002 | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP15 Mushroom Spring | Environmental | Open in IMG/M |
| 2016842003 | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP16 Fairy Spring Red Layer | Environmental | Open in IMG/M |
| 3300002493 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 | Environmental | Open in IMG/M |
| 3300002510 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300003688 | Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300005240 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005241 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005242 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005246 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005247 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005248 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005249 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005251 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005390 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005411 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005414 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005452 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG | Environmental | Open in IMG/M |
| 3300005453 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG | Environmental | Open in IMG/M |
| 3300005501 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005638 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006068 | Hotspring Microbial Communities from Mammoth Norris Corridor Bijah Spring, Yellowstone National Park, Wyoming, USA ? Sample 4, Mini-Metagenomics | Environmental | Open in IMG/M |
| 3300006849 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007000 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007885 | Spring water viral communities from Black Pool hot spring in the West Thumb Geyser Basin, Yellowstone National Park, WY, USA | Environmental | Open in IMG/M |
| 3300010023 | Terrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly | Environmental | Open in IMG/M |
| 3300010184 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010189 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010190 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010191 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010194 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010256 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300026237 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026278 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant BLVA 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026280 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026509 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027279 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031245 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4 | Environmental | Open in IMG/M |
| 3300031508 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2 | Environmental | Open in IMG/M |
| 3300031509 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 | Environmental | Open in IMG/M |
| 3300031513 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer | Environmental | Open in IMG/M |
| 3300031516 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9 | Environmental | Open in IMG/M |
| 3300031517 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2 | Environmental | Open in IMG/M |
| 3300031568 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2 | Environmental | Open in IMG/M |
| 3300031767 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1 | Environmental | Open in IMG/M |
| 3300031783 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031875 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13 | Environmental | Open in IMG/M |
| 3300031878 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4 | Environmental | Open in IMG/M |
| 3300031950 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65 | Environmental | Open in IMG/M |
| 3300031958 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-MatCore | Environmental | Open in IMG/M |
| 3300031980 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3 | Environmental | Open in IMG/M |
| 3300032049 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60 | Environmental | Open in IMG/M |
| 3300032056 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65 | Environmental | Open in IMG/M |
| 3300032057 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS60 | Environmental | Open in IMG/M |
| 3300032058 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50 | Environmental | Open in IMG/M |
| 3300032356 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50 | Environmental | Open in IMG/M |
| 3300033886 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd | Environmental | Open in IMG/M |
| 3300034646 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0000_MSt4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034649 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BISONQ_272640 | 2010170002 | Hot Spring | MAAEKGRIERNGSNGNGQADMFCRTVMAAVVAVLALRLCQLIRRWLAE |
| YNP15172740 | 2015219002 | Hot Spring | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQYVRRWLQG |
| YNP16_111340 | 2016842003 | Hot Spring | MNERRNGQLGHSGPGSDGQADMFCRSVVAAIAAMLALRLCQYIRKWLQG |
| JGI24185J35167_10291553 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | MAAGKERIXXNGSNGNGQADMFCRTVIAAVAAMLALRLCQLVRRWLQG* |
| JGI24185J35167_10456113 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | MRAQRNGQLGHSEPGGNGQADMFCRTVIAAVAAMLALRLCQWVRKWLNG* |
| JGI24185J35167_10466533 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | NGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALKLCRIIRHWLQG* |
| JGI24185J35167_10679311 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | MSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQLLRRLL |
| JGI24185J35167_10722552 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWL |
| JGI24186J35511_10074883 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MKRGNGQIGQGNGNGSDVFCKSVVAAVAAMLALRLCXLLRRWLQG* |
| JGI24186J35511_10089783 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MSERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLCQWVRKWLNG* |
| JGI24186J35511_10223603 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | VNEXRNGQLGSGXPXGDGQADMFCRTFVAAVAAMLALRLCQYVRRWLQW* |
| JGI24186J35511_10270224 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWL |
| Ga0061020_10379943 | 3300003688 | Anoxygenic And Chlorotrophic Microbial Mat | VNERRNGQLGSGGPIGDGQADMFCRTFVAAVAAMLALRLCQYVRRWLQX* |
| Ga0061020_10406811 | 3300003688 | Anoxygenic And Chlorotrophic Microbial Mat | VVDMSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG* |
| Ga0068641_1013211 | 3300005240 | Anoxygenic And Chlorotrophic Microbial Mat | MADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRR |
| Ga0068641_1016203 | 3300005240 | Anoxygenic And Chlorotrophic Microbial Mat | MSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG* |
| Ga0068641_1019102 | 3300005240 | Anoxygenic And Chlorotrophic Microbial Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLR |
| Ga0068642_1011572 | 3300005241 | Anoxygenic And Chlorotrophic Microbial Mat | MSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRR |
| Ga0068639_1027282 | 3300005242 | Anoxygenic And Chlorotrophic Microbial Mat | MSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQLLRR |
| Ga0068638_1965313 | 3300005246 | Anoxygenic And Chlorotrophic Microbial Mat | MSEHRNGRLGSGGSIGDGQADMFCRTVIAALAAMLALRLCQYIRRLLQG* |
| Ga0068637_10024121 | 3300005247 | Anoxygenic And Chlorotrophic Microbial Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQ |
| Ga0068637_10155041 | 3300005247 | Anoxygenic And Chlorotrophic Microbial Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLVRRWLQG* |
| Ga0068636_10078882 | 3300005248 | Anoxygenic And Chlorotrophic Microbial Mat | VVDMSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRRLLQG* |
| Ga0068636_10630422 | 3300005248 | Anoxygenic And Chlorotrophic Microbial Mat | MADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG* |
| Ga0068645_11398361 | 3300005249 | Anoxygenic And Chlorotrophic Microbial Mat | MSERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLCQ |
| Ga0068634_10074641 | 3300005251 | Anoxygenic And Chlorotrophic Microbial Mat | VDAMERGNGQIGQGNGNGSDVFCKSVVAAVAAMLALRLCQLLRRLLQG* |
| Ga0068657_1673902 | 3300005390 | Anoxygenic And Chlorotrophic Microbial Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG* |
| Ga0068647_11047661 | 3300005411 | Anoxygenic And Chlorotrophic Microbial Mat | MERGNGQIGQGNGNGSDVFCKSVVAAVAAMLALRLCRILRRWLQG* |
| Ga0068647_11175102 | 3300005411 | Anoxygenic And Chlorotrophic Microbial Mat | MSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLR |
| Ga0068646_10045031 | 3300005414 | Anoxygenic And Chlorotrophic Microbial Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRR |
| Ga0068706_10200492 | 3300005452 | Anoxygenic And Chlorotrophic | LTVNREGVDMSERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLCQWVRKWLNG* |
| Ga0068706_10278731 | 3300005452 | Anoxygenic And Chlorotrophic | MADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLALKLCRIIRHWLQG* |
| Ga0068706_10597271 | 3300005452 | Anoxygenic And Chlorotrophic | KERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG* |
| Ga0068706_10674111 | 3300005452 | Anoxygenic And Chlorotrophic | NMGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG* |
| Ga0068705_100292032 | 3300005453 | Anoxygenic And Chlorotrophic | VNKRRNGQLGHSGPDGDGQQDMFCRTVIAALAAMLALRLCQYVRRWLQW* |
| Ga0068705_100495263 | 3300005453 | Anoxygenic And Chlorotrophic | MPILTVNREGVDMSERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLCQWVRKWLNG* |
| Ga0068650_10154463 | 3300005501 | Anoxygenic And Chlorotrophic Microbial Mat | MERGNGQIGQGNGNGSDVFCKSVVAAVAAMLALRLCQLLRRLLQG* |
| Ga0068669_12934392 | 3300005638 | Anoxygenic And Chlorotrophic Microbial Mat | MADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLAL |
| Ga0081428_1130801 | 3300006068 | Hotsprings | MSERRNGQLGHSSTGSEGQADMFCRSVVAALAAMLALRLC |
| Ga0081428_1213803 | 3300006068 | Hotsprings | LGHSSTGSEGQADMFCRSVVAALAAMLALRLCQYIRKWLQG* |
| Ga0102029_10044172 | 3300006849 | Anoxygenic And Chlorotrophic Microbial Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG* |
| Ga0102029_10209352 | 3300006849 | Anoxygenic And Chlorotrophic Microbial Mat | MKRGNGQIGQGNGNGSDVFCKSVVAAVAAMLALRLCQLLRRLLQG* |
| Ga0102499_11197961 | 3300007000 | Anoxygenic And Chlorotrophic Microbial Mat | MGDKGQIGKSGSNGNGQEDMFCRTVIAAVAAMLALRLCQLLRRLLQG* |
| Ga0111098_100362 | 3300007885 | Planktonic | MGGKGQIGQNGSNGNGQADMFCRTVIAAVAAMLALRLCQYLRRLLQG* |
| Ga0111098_107961 | 3300007885 | Planktonic | MVGRIGPGSDAKNGQGDTFCRTVIAALAAMLALKLCEYIRKW |
| Ga0130028_1023493 | 3300010023 | Terrestrial Hot Spring Microbial Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRW |
| Ga0124920_11234231 | 3300010184 | Anoxygenic And Chlorotrophic Microbial Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRR |
| Ga0124915_11429541 | 3300010189 | Anoxygenic And Chlorotrophic Microbial Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALKLCRIIRHWLQG* |
| Ga0124925_10359871 | 3300010190 | Anoxygenic And Chlorotrophic Microbial Mat | VVDMSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQLLRRLLQG* |
| Ga0124925_10629032 | 3300010190 | Anoxygenic And Chlorotrophic Microbial Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQ |
| Ga0124914_10422031 | 3300010191 | Anoxygenic And Chlorotrophic Microbial Mat | MADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLALRLCQYVR |
| Ga0124914_10773701 | 3300010191 | Anoxygenic And Chlorotrophic Microbial Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQYVRRWLQG* |
| Ga0124921_10211682 | 3300010194 | Anoxygenic And Chlorotrophic Microbial Mat | VNEHRNGQLGSGDPIGDGQADMFCRTFVAAVAAMLALRLCQYVRRWLQW* |
| Ga0124939_10047711 | 3300010256 | Anoxygenic And Chlorotrophic Microbial Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRLLQG* |
| Ga0124939_11520381 | 3300010256 | Anoxygenic And Chlorotrophic Microbial Mat | MSEHRNGRLGSGGSIGDGQADMFCRTVIAALAAMLALRLCQYIRRLLQG |
| Ga0209750_10058003 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MRAQRNGQLGHSEPGGNGQADMFCRTVIAAVAAMLALRLCQWVRKWLNG |
| Ga0209750_10155153 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | VVDMSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALKLCRIIRHWLQG |
| Ga0209750_10183373 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | VVDMSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQLLRRLLQG |
| Ga0209018_10938652 | 3300026278 | Anoxygenic And Chlorotrophic Microbial Mat | MSNRNGQLGHSGPGKGNGQEDMFCRSVIAAIAAMLALRLCQYVRSWLAGM |
| Ga0209017_100417741 | 3300026280 | Anoxygenic And Chlorotrophic Microbial Mat | MSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRRW |
| Ga0209017_100846001 | 3300026280 | Anoxygenic And Chlorotrophic Microbial Mat | GGHNMGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQYVRRWLQG |
| Ga0209809_10618583 | 3300026509 | Anoxygenic And Chlorotrophic | VVDMSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0209809_11072321 | 3300026509 | Anoxygenic And Chlorotrophic | AGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0209691_10115224 | 3300027279 | Anoxygenic And Chlorotrophic | MGDKGQIGKSGSNGNGQEDMFCRTVIAAVAAMLALRLCQLLRRLLQG |
| Ga0209691_10281353 | 3300027279 | Anoxygenic And Chlorotrophic | MADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLALKLCRIIRHWLQG |
| Ga0308395_10539402 | 3300031245 | Hot Spring Phototrophic Mat | MSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308394_10367251 | 3300031508 | Hot Spring Phototrophic Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRLLQG |
| Ga0308399_10911492 | 3300031509 | Hot Spring Phototrophic Mat | VVDMSDRNGQQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLVRRWLQG |
| Ga0308412_10118895 | 3300031513 | Hot Spring Phototrophic Mat | LTVNRKGVDMSERRNGQLGHNGSGSDGQGDMFCRSVIAAVAAMLALRLCQYLRKLLQG |
| Ga0308412_10204963 | 3300031513 | Hot Spring Phototrophic Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQYLRHLLQG |
| Ga0308412_10277754 | 3300031513 | Hot Spring Phototrophic Mat | MNERRNGQLGHSGPGDDGQADMFCRTVIAAVAAMLALRLCQWVRKWLQG |
| Ga0308412_10366992 | 3300031513 | Hot Spring Phototrophic Mat | LTVNRKGVDMSERRNGQLGHNGSGSDGQADMFCRSVIAAVAAMLALRLCQYVRKWLNG |
| Ga0308412_10382322 | 3300031513 | Hot Spring Phototrophic Mat | VVDMSDRDGQQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308412_10542651 | 3300031513 | Hot Spring Phototrophic Mat | VVDMSERNGQQTGRSSSVNGNGQADMFCRTVVAAVAAMLALRLCQLLRRWLQG |
| Ga0308412_10622653 | 3300031513 | Hot Spring Phototrophic Mat | VVDMSKRNNGQIGQSDSINGNGQADMFCRTVIAAVAAMLALRLCQLVRRWLQG |
| Ga0308412_10713242 | 3300031513 | Hot Spring Phototrophic Mat | MSERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLCQYIRKWLNG |
| Ga0308412_10859731 | 3300031513 | Hot Spring Phototrophic Mat | MAAEKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308412_11035312 | 3300031513 | Hot Spring Phototrophic Mat | MAAEKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLVRRWLQG |
| Ga0308398_10613403 | 3300031516 | Hot Spring Phototrophic Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLL |
| Ga0308392_10190353 | 3300031517 | Hot Spring Phototrophic Mat | VVDMSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308393_10675242 | 3300031568 | Hot Spring Phototrophic Mat | MGDKGQIGKSGSNGNGQEDMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308401_10074702 | 3300031767 | Hot Spring Phototrophic Mat | VVDMSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQYLRRLLQG |
| Ga0308418_10367941 | 3300031783 | Hot Spring Phototrophic Mat | VVDMSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRRLLQG |
| Ga0308411_100337794 | 3300031812 | Hot Spring Phototrophic Mat | MGDKGQIRQNGSNGNGQADMFCRTVVAAVAAMLALRLCQLVRRWLQG |
| Ga0308411_100524131 | 3300031812 | Hot Spring Phototrophic Mat | MSEHRNGRLGSGGSIGDGQADMFCRTVIAALAAMLALRLCQWVRKWLHG |
| Ga0308411_100564132 | 3300031812 | Hot Spring Phototrophic Mat | MSERRNGQLGHNGSGSDGQADMFCRSVIAAVAAMLALRLCQYLRKLLQG |
| Ga0308411_101145932 | 3300031812 | Hot Spring Phototrophic Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLQG |
| Ga0308405_10511412 | 3300031875 | Hot Spring Phototrophic Mat | RNGQLGSGGPVGDGQADMFCRTFVAAVAAMLALRLCQYVRRWLQG |
| Ga0308405_10654423 | 3300031875 | Hot Spring Phototrophic Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQ |
| Ga0308405_11195582 | 3300031875 | Hot Spring Phototrophic Mat | QIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQYVRRWLQG |
| Ga0308404_10071053 | 3300031878 | Hot Spring Phototrophic Mat | VVDMSERNGQQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308404_10115044 | 3300031878 | Hot Spring Phototrophic Mat | MSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308417_10142665 | 3300031950 | Hot Spring Phototrophic Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLVRRWLQG |
| Ga0308417_10353363 | 3300031950 | Hot Spring Phototrophic Mat | MSERRNGQLGHSDPGGDGQADMFCRTVIAALAAMLALRLCQYIRKWLNG |
| Ga0308417_10353531 | 3300031950 | Hot Spring Phototrophic Mat | MSERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLC |
| Ga0308417_10353535 | 3300031950 | Hot Spring Phototrophic Mat | DMSERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLCQYIRKWLNG |
| Ga0308417_10690872 | 3300031950 | Hot Spring Phototrophic Mat | MREQRNGQLGHSEPGGNGQADMFCRTVIAALAAMLALRLCQWARKWLHG |
| Ga0308417_10793033 | 3300031950 | Hot Spring Phototrophic Mat | MRAQRNGQLGHSETGGNGQADMFCRTVIAALAAMLALRLCQWARKWLHG |
| Ga0308417_12396231 | 3300031950 | Hot Spring Phototrophic Mat | SKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQLVRRWLQG |
| Ga0308410_10185284 | 3300031958 | Hot Spring Phototrophic Mat | MSERRNGQLGHNGSGSDGQADMFCRSVIAAVAAMLALRLCQYVRKWLNG |
| Ga0308410_10608782 | 3300031958 | Hot Spring Phototrophic Mat | MGERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLCQWVRKWLNG |
| Ga0308410_10964123 | 3300031958 | Hot Spring Phototrophic Mat | MGDKGQIRQNGSNGNGQADMFCRTVIAAVAAMLALRLCQLVRRWLQG |
| Ga0308410_11800891 | 3300031958 | Hot Spring Phototrophic Mat | MNERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLCQWVRKWLHG |
| Ga0308403_10270402 | 3300031980 | Hot Spring Phototrophic Mat | GQRDSINGNGQADMFCRTVIAAVAAMLALRLCQYLRRLLQG |
| Ga0308416_10077941 | 3300032049 | Hot Spring Phototrophic Mat | MSEHRNGRLGSGGSISDGQADMFCRTVIAALAAMLALRLCQYIRRLLQG |
| Ga0308416_10109844 | 3300032049 | Hot Spring Phototrophic Mat | VVDMSKRNNGQIGQRDSIGGNGQADTFCRTVVAALAAMLALRLCQWVRKWLQG |
| Ga0308310_10433763 | 3300032056 | Hot Spring Phototrophic Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLA |
| Ga0308421_10144213 | 3300032057 | Hot Spring Phototrophic Mat | MADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308419_10409931 | 3300032058 | Hot Spring Phototrophic Mat | DMADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLALKLCRIIRHWLQG |
| Ga0308419_11281161 | 3300032058 | Hot Spring Phototrophic Mat | MSERNNGQTGRSSSVNGNGQADMFCRTVIAAVAAMLALKLCRIIRHWLQG |
| Ga0308414_10382353 | 3300032356 | Hot Spring Phototrophic Mat | MADKGRIGQNGSNGNGQADMFCRTVIAAVAAMLALKLCQFLKRWLQG |
| Ga0308414_10881541 | 3300032356 | Hot Spring Phototrophic Mat | MGDKGQIGKNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308414_10954212 | 3300032356 | Hot Spring Phototrophic Mat | MNERRNGQLGHSGPGGDGQADMFCRTVIAALAAMLALRLCQWVRKWLQG |
| Ga0308413_013533_2634_2786 | 3300033886 | Hot Spring Phototrophic Mat | MSDRNGQQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLVRRWLQG |
| Ga0308413_034586_1349_1501 | 3300033886 | Hot Spring Phototrophic Mat | MSERNGQQTGRSSSVNGNGQADMFCRTVVAAVAAMLALRLCQYLRRLLQG |
| Ga0308413_034587_71_223 | 3300033886 | Hot Spring Phototrophic Mat | MSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQYLRRLLQG |
| Ga0308413_043211_1020_1166 | 3300033886 | Hot Spring Phototrophic Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308413_057039_918_1070 | 3300033886 | Hot Spring Phototrophic Mat | MSDRDGQQTGRSSSVNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWLQG |
| Ga0308413_068275_816_953 | 3300033886 | Hot Spring Phototrophic Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALRLCQLLRRWL |
| Ga0372965_029399_1_111 | 3300034646 | Hot Spring Phototrophic Mat | MAAGKERIERNGSNGNGQADMFCRTVIAAVAAMLALR |
| Ga0372972_037712_498_650 | 3300034649 | Hot Spring Phototrophic Mat | MSKRNNGQIGQRDSINGNGQADMFCRTVIAAVAAMLALRLCQLLRRLLQG |
| ⦗Top⦘ |