


| Basic Information | |
|---|---|
| Family ID | F072010 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 42 residues |
| Representative Sequence | SQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.52 % |
| % of genes from short scaffolds (< 2000 bps) | 87.60 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (61.983 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (14.876 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.107 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF09458 | H_lectin | 11.57 |
| PF03796 | DnaB_C | 2.48 |
| PF09479 | Flg_new | 1.65 |
| PF13662 | Toprim_4 | 0.83 |
| PF02811 | PHP | 0.83 |
| PF14579 | HHH_6 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 2.48 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 2.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.42 % |
| Unclassified | root | N/A | 30.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1013835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2027 | Open in IMG/M |
| 3300001282|B570J14230_10143144 | Not Available | 688 | Open in IMG/M |
| 3300001844|RCM35_1008245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 787 | Open in IMG/M |
| 3300001948|GOS2228_1027668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1534 | Open in IMG/M |
| 3300002195|metazooDRAFT_1224584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 737 | Open in IMG/M |
| 3300002408|B570J29032_109393767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 733 | Open in IMG/M |
| 3300002408|B570J29032_109787040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1323 | Open in IMG/M |
| 3300002408|B570J29032_109898915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2176 | Open in IMG/M |
| 3300002471|metazooDRAFT_1415764 | Not Available | 520 | Open in IMG/M |
| 3300004240|Ga0007787_10679942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 515 | Open in IMG/M |
| 3300005528|Ga0068872_10124596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1519 | Open in IMG/M |
| 3300005528|Ga0068872_10609085 | Not Available | 578 | Open in IMG/M |
| 3300005582|Ga0049080_10021210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2265 | Open in IMG/M |
| 3300005584|Ga0049082_10161694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 774 | Open in IMG/M |
| 3300005662|Ga0078894_10994306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 722 | Open in IMG/M |
| 3300007177|Ga0102978_1076593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1540 | Open in IMG/M |
| 3300007541|Ga0099848_1020380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2833 | Open in IMG/M |
| 3300007555|Ga0102817_1159213 | Not Available | 506 | Open in IMG/M |
| 3300008107|Ga0114340_1082923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1320 | Open in IMG/M |
| 3300008107|Ga0114340_1138734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 914 | Open in IMG/M |
| 3300008107|Ga0114340_1228074 | Not Available | 591 | Open in IMG/M |
| 3300008108|Ga0114341_10375853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 701 | Open in IMG/M |
| 3300008110|Ga0114343_1094224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1049 | Open in IMG/M |
| 3300008110|Ga0114343_1234396 | Not Available | 503 | Open in IMG/M |
| 3300008113|Ga0114346_1004451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9714 | Open in IMG/M |
| 3300008116|Ga0114350_1044626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1651 | Open in IMG/M |
| 3300008116|Ga0114350_1192537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 511 | Open in IMG/M |
| 3300008120|Ga0114355_1193286 | Not Available | 666 | Open in IMG/M |
| 3300008261|Ga0114336_1018307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6586 | Open in IMG/M |
| 3300008264|Ga0114353_1126557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1323 | Open in IMG/M |
| 3300008266|Ga0114363_1002527 | Not Available | 10209 | Open in IMG/M |
| 3300008450|Ga0114880_1125122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300008996|Ga0102831_1115945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 891 | Open in IMG/M |
| 3300009159|Ga0114978_10038917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3349 | Open in IMG/M |
| 3300009160|Ga0114981_10300477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 871 | Open in IMG/M |
| 3300010354|Ga0129333_10131255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2304 | Open in IMG/M |
| 3300010354|Ga0129333_10447342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1138 | Open in IMG/M |
| 3300010370|Ga0129336_10284670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 922 | Open in IMG/M |
| 3300011011|Ga0139556_1046451 | Not Available | 642 | Open in IMG/M |
| 3300011268|Ga0151620_1039556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1581 | Open in IMG/M |
| 3300012665|Ga0157210_1023596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 983 | Open in IMG/M |
| 3300012666|Ga0157498_1053984 | Not Available | 616 | Open in IMG/M |
| 3300012968|Ga0129337_1067128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1183 | Open in IMG/M |
| 3300013087|Ga0163212_1135623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 781 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10203073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1246 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10231907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1135 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10250813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1075 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10541556 | Not Available | 633 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10600837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 710 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10618014 | Not Available | 697 | Open in IMG/M |
| 3300013372|Ga0177922_10614245 | Not Available | 668 | Open in IMG/M |
| 3300013372|Ga0177922_10968772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2402 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10023594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5525 | Open in IMG/M |
| 3300017761|Ga0181356_1243937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 514 | Open in IMG/M |
| 3300017788|Ga0169931_10370638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1076 | Open in IMG/M |
| 3300020048|Ga0207193_1639923 | Not Available | 706 | Open in IMG/M |
| 3300020084|Ga0194110_10660772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 653 | Open in IMG/M |
| 3300020109|Ga0194112_10485791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 869 | Open in IMG/M |
| 3300020159|Ga0211734_10685416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1043 | Open in IMG/M |
| 3300020160|Ga0211733_11074797 | Not Available | 655 | Open in IMG/M |
| 3300020162|Ga0211735_10544914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1337 | Open in IMG/M |
| 3300020179|Ga0194134_10281443 | Not Available | 665 | Open in IMG/M |
| 3300020183|Ga0194115_10411182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 578 | Open in IMG/M |
| 3300020190|Ga0194118_10031581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3744 | Open in IMG/M |
| 3300020193|Ga0194131_10342171 | Not Available | 674 | Open in IMG/M |
| 3300020220|Ga0194119_10529658 | Not Available | 737 | Open in IMG/M |
| 3300020220|Ga0194119_10573898 | Not Available | 698 | Open in IMG/M |
| 3300020578|Ga0194129_10256847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1013 | Open in IMG/M |
| 3300021376|Ga0194130_10187619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1234 | Open in IMG/M |
| 3300021424|Ga0194117_10442223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 589 | Open in IMG/M |
| 3300021963|Ga0222712_10284650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1043 | Open in IMG/M |
| 3300023184|Ga0214919_10023505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6742 | Open in IMG/M |
| 3300024298|Ga0255178_1035683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 995 | Open in IMG/M |
| 3300024346|Ga0244775_10175790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1802 | Open in IMG/M |
| 3300024495|Ga0255164_1045608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 704 | Open in IMG/M |
| 3300024500|Ga0255143_1060799 | Not Available | 612 | Open in IMG/M |
| 3300024559|Ga0255284_1134668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 515 | Open in IMG/M |
| 3300024857|Ga0256339_1047535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 913 | Open in IMG/M |
| 3300024864|Ga0255271_1084034 | Not Available | 697 | Open in IMG/M |
| 3300024864|Ga0255271_1111421 | Not Available | 598 | Open in IMG/M |
| 3300025732|Ga0208784_1040150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1462 | Open in IMG/M |
| 3300026459|Ga0255170_1085267 | Not Available | 525 | Open in IMG/M |
| 3300026571|Ga0255289_1066622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 815 | Open in IMG/M |
| 3300026572|Ga0255270_1044727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1129 | Open in IMG/M |
| 3300027138|Ga0255064_1068123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 553 | Open in IMG/M |
| 3300027141|Ga0255076_1074199 | Not Available | 562 | Open in IMG/M |
| 3300027541|Ga0255158_1047606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 971 | Open in IMG/M |
| 3300027541|Ga0255158_1061073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 842 | Open in IMG/M |
| 3300027601|Ga0255079_1003877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3887 | Open in IMG/M |
| 3300027644|Ga0209356_1093662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 882 | Open in IMG/M |
| 3300027697|Ga0209033_1165521 | Not Available | 679 | Open in IMG/M |
| 3300027697|Ga0209033_1169386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 669 | Open in IMG/M |
| 3300027720|Ga0209617_10170268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 850 | Open in IMG/M |
| 3300027744|Ga0209355_1253551 | Not Available | 689 | Open in IMG/M |
| 3300027797|Ga0209107_10396554 | Not Available | 630 | Open in IMG/M |
| 3300027797|Ga0209107_10403992 | Not Available | 622 | Open in IMG/M |
| 3300027816|Ga0209990_10442921 | Not Available | 558 | Open in IMG/M |
| 3300027892|Ga0209550_10243070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1194 | Open in IMG/M |
| 3300027969|Ga0209191_1340977 | Not Available | 543 | Open in IMG/M |
| 3300028103|Ga0255172_1011705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1722 | Open in IMG/M |
| 3300028286|Ga0256331_1024842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1334 | Open in IMG/M |
| 3300028286|Ga0256331_1137671 | Not Available | 552 | Open in IMG/M |
| 3300031758|Ga0315907_10433925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1052 | Open in IMG/M |
| 3300031758|Ga0315907_10879380 | Not Available | 660 | Open in IMG/M |
| 3300031784|Ga0315899_10772577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 883 | Open in IMG/M |
| 3300031786|Ga0315908_11367234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 556 | Open in IMG/M |
| 3300031951|Ga0315904_10231811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1783 | Open in IMG/M |
| 3300031951|Ga0315904_10311573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1469 | Open in IMG/M |
| 3300031951|Ga0315904_11012545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 657 | Open in IMG/M |
| 3300032050|Ga0315906_11262767 | Not Available | 530 | Open in IMG/M |
| 3300032093|Ga0315902_10508081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1046 | Open in IMG/M |
| 3300032093|Ga0315902_10616643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 907 | Open in IMG/M |
| 3300032093|Ga0315902_10867341 | Not Available | 700 | Open in IMG/M |
| 3300033995|Ga0335003_0170772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1065 | Open in IMG/M |
| 3300034095|Ga0335022_0139214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1512 | Open in IMG/M |
| 3300034095|Ga0335022_0593570 | Not Available | 561 | Open in IMG/M |
| 3300034117|Ga0335033_0381016 | Not Available | 700 | Open in IMG/M |
| 3300034117|Ga0335033_0397536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 680 | Open in IMG/M |
| 3300034272|Ga0335049_0000668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23977 | Open in IMG/M |
| 3300034272|Ga0335049_0251750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1216 | Open in IMG/M |
| 3300034356|Ga0335048_0364361 | Not Available | 727 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.88% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 14.88% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.48% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.48% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.65% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.65% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.65% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.65% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.83% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.83% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.83% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.83% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.83% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.83% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
| 3300001948 | Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012 | Environmental | Open in IMG/M |
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026459 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027541 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_10138354 | 3300000736 | Freshwater And Sediment | MYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEILAHDLGENL* |
| B570J14230_101431442 | 3300001282 | Freshwater | KMYLVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGESI* |
| RCM35_10082451 | 3300001844 | Marine Plankton | IVDPDVFNKYGLDRSIIMEVSESETKAHELGENL* |
| GOS2228_10276684 | 3300001948 | Marine | GKIYLISQNKRRHIVSPDSFITYGLDRSKVIEVSEAETNMHEIGDNL* |
| metazooDRAFT_12245843 | 3300002195 | Lake | YLISQNKKRHIVSPDVFTKYGLDRSRLIEVSESEAAIHDLGENL* |
| B570J29032_1093937673 | 3300002408 | Freshwater | IVNPDSFSKYGLNRSNIVEVSESEINSHELGENL* |
| B570J29032_1097870401 | 3300002408 | Freshwater | KLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGESI* |
| B570J29032_1098989156 | 3300002408 | Freshwater | QNKRRHIVTPDSFTKYGLNRSSIVEVSESETNMHDLGENL* |
| metazooDRAFT_14157641 | 3300002471 | Lake | NKRRHITSPDVFERYGLDRSAIIEVSEAEINMHEQGEDLWQI* |
| Ga0007787_106799422 | 3300004240 | Freshwater Lake | VSQNKLRHIIDPDVFNRYGLDRSKVVEVSEKEILAHDLGENIQ* |
| Ga0068872_101245961 | 3300005528 | Freshwater Lake | RHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENI* |
| Ga0068872_106090851 | 3300005528 | Freshwater Lake | RHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL* |
| Ga0049080_100212101 | 3300005582 | Freshwater Lentic | LRHIVDPDSFSRYGLDRSKMIEVSEKEISVHDLGEII* |
| Ga0049082_101616943 | 3300005584 | Freshwater Lentic | LIKNLADGRMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEISAHDLGENL* |
| Ga0078894_109943063 | 3300005662 | Freshwater Lake | SQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL* |
| Ga0102978_10765933 | 3300007177 | Freshwater Lake | KMYLVSQNKLRHIVDPDIFDRYGLDRSNLIEVSDTEIKAHDIGEAL* |
| Ga0099848_10203801 | 3300007541 | Aqueous | NKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHTTGDNL* |
| Ga0102817_11592131 | 3300007555 | Estuarine | ADGRMYLVSQNKLRHIVDPDSFNRYGLDRSKVVEVSDKEISAHDLGENL* |
| Ga0114340_10829231 | 3300008107 | Freshwater, Plankton | GKIYLISQNKRRQIVDPDTFDRYGLDRSMTIEVSEAETNMHDLGENL* |
| Ga0114340_11387341 | 3300008107 | Freshwater, Plankton | PDVFERYGLDRSMIIEVSEAEINMHEQGEDLWQI* |
| Ga0114340_12280741 | 3300008107 | Freshwater, Plankton | IKNIADGKIYLLSQNKLRHIIDPDSFTKYGLDRSWIIEVSDNEINAHELGENL* |
| Ga0114341_103758532 | 3300008108 | Freshwater, Plankton | LVSQNKLRHIIDPDVFNRYGLDRSKVVEVSEKEILAHDLGENIQ* |
| Ga0114343_10942241 | 3300008110 | Freshwater, Plankton | IVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL* |
| Ga0114343_12343961 | 3300008110 | Freshwater, Plankton | KMYLVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL* |
| Ga0114346_100445113 | 3300008113 | Freshwater, Plankton | IADGKIYLISQNKRRHVVDPDTFDRYGLDRSKTIEVSEVETNMHDLGENL* |
| Ga0114350_10446264 | 3300008116 | Freshwater, Plankton | IKNIADGRIYLVSQNKLRHIVDPDSFTRYGLDRSNVIEVSETEVSAHDLGEKL* |
| Ga0114350_11925372 | 3300008116 | Freshwater, Plankton | YLVSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL* |
| Ga0114355_11932861 | 3300008120 | Freshwater, Plankton | QNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL* |
| Ga0114336_10183072 | 3300008261 | Freshwater, Plankton | MYLVSQNKLRHIIDPDSFTRYGLDRSKMIEVSEKEISAHDLGEKL* |
| Ga0114353_11265571 | 3300008264 | Freshwater, Plankton | DGKMYLVSQNKLRHIVDPDIFNKYGLDRTNLIEVSESEVKAHEIGDYL* |
| Ga0114363_100252713 | 3300008266 | Freshwater, Plankton | IADGKMYLVSQNKLRHIVDPDIFNKYGLDRTNLIEVSESEVKAHEIGDYL* |
| Ga0114880_11251222 | 3300008450 | Freshwater Lake | MYLVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL* |
| Ga0102831_11159451 | 3300008996 | Estuarine | ISQNKRRHIVDPDTFSKYGLNRSNIIEVSESEANMHELGENL* |
| Ga0114978_100389177 | 3300009159 | Freshwater Lake | HVVSPDIFIQYGLDRSSVLEVSDLEVNMHDLGENL* |
| Ga0114981_103004771 | 3300009160 | Freshwater Lake | DGKMYLVSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEILAHDLGENL* |
| Ga0129333_101312551 | 3300010354 | Freshwater To Marine Saline Gradient | KRHIVDPDSFDKFGLDRKAIIEVSEAEANMHDIGENL* |
| Ga0129333_104473421 | 3300010354 | Freshwater To Marine Saline Gradient | IADGKMYLVSQNKLRHIVDPDIFTKYGLDRSKLIEVSEAEVKAHDIGESL* |
| Ga0129336_102846703 | 3300010370 | Freshwater To Marine Saline Gradient | DGKIYLVSQNKLRHIVDPDSFTKYGLDRSKIIEVSEAEVSAHDLGESI* |
| Ga0139556_10464511 | 3300011011 | Freshwater | YLVSENKLRHIVDPDSFNQYGLDRSKVIEVSDKEISAHDLGENL* |
| Ga0151620_10395566 | 3300011268 | Freshwater | HIVDPDSFLKYGLDRSKVVEVSESEVNMHDLGDNL* |
| Ga0157210_10235961 | 3300012665 | Freshwater | GRMYLVSQNKKRHITSPDIFDKFGLDRNTMIEVSAVEVAAHELGEDL* |
| Ga0157498_10539842 | 3300012666 | Freshwater, Surface Ice | VSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGESI* |
| Ga0129337_10671283 | 3300012968 | Aqueous | NKLRHIVDPDIFDRYGLDRSNLIEVSEAEIKAHDIGETL* |
| Ga0163212_11356231 | 3300013087 | Freshwater | VSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKI* |
| (restricted) Ga0172367_102030731 | 3300013126 | Freshwater | KLRHIVDPDIFDRYGLDRSNLIEVSEAEINAHDIGETL* |
| (restricted) Ga0172367_102319073 | 3300013126 | Freshwater | ADGKMYLVSQNKLRHIIDPDIFNKYGLNRSKVVEVSEAEIKAHELGDVL* |
| (restricted) Ga0172367_102508133 | 3300013126 | Freshwater | ISQNKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHELGDNL* |
| (restricted) Ga0172367_105415561 | 3300013126 | Freshwater | RHIVDPDIFDRYGLDRSNLIEVSEAEINAHDIGEEL* |
| (restricted) Ga0172372_106008371 | 3300013132 | Freshwater | NKRRHIVDPDSFNKYGLNRSDIIEVSETEAGMHDLGENL* |
| (restricted) Ga0172372_106180142 | 3300013132 | Freshwater | VSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGEII* |
| Ga0177922_106142451 | 3300013372 | Freshwater | LRHIVDPDLFNRYGLDRSKMIEVSEKEISAHDLGESI* |
| Ga0177922_109687725 | 3300013372 | Freshwater | ISQNKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHELGDSL* |
| (restricted) Ga0172376_100235941 | 3300014720 | Freshwater | ISQNKKRHIVDPDSFDRYGLDRRLVIEVSEVEANMHTTGDNL* |
| Ga0181356_12439371 | 3300017761 | Freshwater Lake | DGRMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEISAHDLGENL |
| Ga0169931_103706383 | 3300017788 | Freshwater | ISQNKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHELGDNL |
| Ga0207193_16399231 | 3300020048 | Freshwater Lake Sediment | KMYLVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEVSAHDLGENL |
| Ga0194110_106607721 | 3300020084 | Freshwater Lake | KMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKI |
| Ga0194112_104857911 | 3300020109 | Freshwater Lake | KLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKI |
| Ga0211734_106854163 | 3300020159 | Freshwater | MYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEISAHDLGENL |
| Ga0211733_110747971 | 3300020160 | Freshwater | HIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGESI |
| Ga0211735_105449141 | 3300020162 | Freshwater | ISQNKKRHIVDPDSFTKYGLDRSKTIEVSEAESNAHDLGDNL |
| Ga0194134_102814431 | 3300020179 | Freshwater Lake | VSQNKLRHIVDPDSFDRYGLDRSRVVEVSEKEISAHELGDNI |
| Ga0194115_104111822 | 3300020183 | Freshwater Lake | DGKMYLVSQNKLRHIVDPDSFDRYGLDRSRVVEVSEKEILAHDLGENL |
| Ga0194118_100315818 | 3300020190 | Freshwater Lake | HIVNPDSFNRYGLDRLKVVEVSEKEILAHDLGEKL |
| Ga0194131_103421712 | 3300020193 | Freshwater Lake | QNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKI |
| Ga0194119_105296581 | 3300020220 | Freshwater Lake | TLIKNISDGRMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGENL |
| Ga0194119_105738981 | 3300020220 | Freshwater Lake | VSQNKLRHIVDPDSFDRYGLDRSRVVEVSEKEILAHDLGENL |
| Ga0194129_102568473 | 3300020578 | Freshwater Lake | ADGKMYLISQNKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHELGDNL |
| Ga0194130_101876191 | 3300021376 | Freshwater Lake | VSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKL |
| Ga0194117_104422232 | 3300021424 | Freshwater Lake | GKMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKL |
| Ga0222712_102846503 | 3300021963 | Estuarine Water | MYLLSQNKLRQIKDPDVFDLYGLDRSLLIEVAEYEVKAHELGEDL |
| Ga0214919_1002350513 | 3300023184 | Freshwater | LLSQNKLRHIVDPDSFDKYGLDRSKVIEVSEAEKQAHDLGEQL |
| Ga0255178_10356831 | 3300024298 | Freshwater | KKRHIIDPDSFNKYGLDRKSVLEVSQSEADMHQIGEDL |
| Ga0244775_101757901 | 3300024346 | Estuarine | VSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEISAHDLGENL |
| Ga0255164_10456083 | 3300024495 | Freshwater | LRHIVDPDIFNRYGLDRSNLIEVSEAEIKAHDIGEAL |
| Ga0255143_10607992 | 3300024500 | Freshwater | VSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL |
| Ga0255284_11346681 | 3300024559 | Freshwater | LISQNKKRHIVDPDAFDRYGLDRKSVIEVSDSEANMHELGDNL |
| Ga0256339_10475353 | 3300024857 | Freshwater | RHIVDPDAFDRYGLDRKSVIEVSEAEANMHELGDNL |
| Ga0255271_10840342 | 3300024864 | Freshwater | QNKKRHIIDPDSFNKYGLDRKSVLEVSQAEADMHQIGEDL |
| Ga0255271_11114211 | 3300024864 | Freshwater | KRHIVDPDAFDRYGLDRKSVIEVSDSEANMHELGDNL |
| Ga0208784_10401501 | 3300025732 | Aqueous | HIVDPDSFTKYGLDRSKVIEVSETEISAHDLGEKL |
| Ga0255170_10852672 | 3300026459 | Freshwater | HIVDPDSFDKYGLDRKSVLEVSESEANMHDIGENL |
| Ga0255289_10666221 | 3300026571 | Freshwater | DGKMYLVSQNKLRHIVDPDIFNRYGLDRSNLIEVSEAEIKAHDIGEAL |
| Ga0255270_10447271 | 3300026572 | Freshwater | KLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL |
| Ga0255064_10681232 | 3300027138 | Freshwater | IADGKIYLVSQNKLRHIVDPDSFTKYGLDRSKIIEVSEAEVSAHDLGENI |
| Ga0255076_10741991 | 3300027141 | Freshwater | HIVDPDSFTKYGLDRSKIIEVSEAEVSAHDLGENI |
| Ga0255158_10476063 | 3300027541 | Freshwater | KRHIIDPDSFNKYGLDRKSVLEVSQSEADMHQIGEDL |
| Ga0255158_10610733 | 3300027541 | Freshwater | SQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL |
| Ga0255079_10038777 | 3300027601 | Freshwater | IYLVSQNKLRHIVDPDSFTKYGLDRSKVIEVSEAEISAHDLGEKI |
| Ga0209356_10936623 | 3300027644 | Freshwater Lake | YLVSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEISAHDLGENL |
| Ga0209033_11655212 | 3300027697 | Freshwater Lake | GKIYLVSQNKLRHIVDPDSFTKYGLDRSKIIEVSEAEVSAHDLGENI |
| Ga0209033_11693862 | 3300027697 | Freshwater Lake | MYLVSQNKLRHIVDPDSFDRYGLDRSKMIEVSQKEISAHDLGENI |
| Ga0209617_101702681 | 3300027720 | Freshwater And Sediment | GRMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEILAHDLGENL |
| Ga0209355_12535513 | 3300027744 | Freshwater Lake | SQNKLRHIVDPDSFNRYGLDRSKVVEVSDKEILAHDLGENL |
| Ga0209107_103965541 | 3300027797 | Freshwater And Sediment | QNKKRHIVDPDTFNKYGLDRSQVVEVSAFEASMHELGEDL |
| Ga0209107_104039921 | 3300027797 | Freshwater And Sediment | KKRHIVDPDTFDKYGLDRASVIEVSAFEVSMHESGEDL |
| Ga0209990_104429211 | 3300027816 | Freshwater Lake | VSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENI |
| Ga0209550_102430701 | 3300027892 | Freshwater Lake | KMYLVSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEISAHDLGENL |
| Ga0209191_13409771 | 3300027969 | Freshwater Lake | KMYLVSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEILAHDLGENL |
| Ga0255172_10117054 | 3300028103 | Freshwater | DGKMYLVSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL |
| Ga0256331_10248421 | 3300028286 | Freshwater | KMYLVSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL |
| Ga0256331_11376712 | 3300028286 | Freshwater | QNKLRHIVDPDIFIKYGLDRSNLIEVSETEVKAHDIGEIL |
| Ga0315907_104339251 | 3300031758 | Freshwater | RHIVDPDSFNRYGLDRSKIIEVSQKEISAHDLGENI |
| Ga0315907_108793802 | 3300031758 | Freshwater | SHNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDIGEIL |
| Ga0315899_107725773 | 3300031784 | Freshwater | VSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL |
| Ga0315908_113672342 | 3300031786 | Freshwater | ADGKMYLVSQNKLRHIVDPDIFNRYGLDRSNLIEVSEAEVKAHDIGESL |
| Ga0315904_102318111 | 3300031951 | Freshwater | HIVSPDVFDKYGLDKYSVVEVSEAETNMHNLGEQLA |
| Ga0315904_103115731 | 3300031951 | Freshwater | NKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL |
| Ga0315904_110125451 | 3300031951 | Freshwater | YLVSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDIGEIL |
| Ga0315906_112627671 | 3300032050 | Freshwater | LRHIVDPDIFIKYGLDRSNLVEVSEAEIKAHDIGDIL |
| Ga0315902_105080813 | 3300032093 | Freshwater | LRHIVDPDIFNRYGLDRSNLIEVSEAEVKAHDIGESL |
| Ga0315902_106166433 | 3300032093 | Freshwater | SQNKRRHIVNPDSFDKYGLDRSNIVEVSDSETNMHDLGENL |
| Ga0315902_108673411 | 3300032093 | Freshwater | QNKLRHIVDPDSFNRYGLNRSKMIEVSEKEILAHDLGENI |
| Ga0335003_0170772_935_1063 | 3300033995 | Freshwater | ISQNKKRHIVDPDTFNKYGLDRSQVVEVSAFEASMHELGEDL |
| Ga0335022_0139214_3_113 | 3300034095 | Freshwater | RHIVDPDTFDKYGLDRSQVIEVSAFETSMHELGEEL |
| Ga0335022_0593570_3_140 | 3300034095 | Freshwater | IYLISQNKRRHVVSPDIFIQYGLDRSIILEVSDLEVNMHDLGENL |
| Ga0335033_0381016_2_115 | 3300034117 | Freshwater | KRHIVDPDTFNKYGLDRSQVVEVSAFEVSMHELGEDL |
| Ga0335033_0397536_3_155 | 3300034117 | Freshwater | IADGKLYLISQNKKRHIVDPDTFNKYGLDRSQVVEVSAFEASMHELGEDL |
| Ga0335049_0000668_5158_5295 | 3300034272 | Freshwater | MYLVSQNKLRHIIDPDSFTRYGLDRSKMIEVSEKEISAHDLGEKL |
| Ga0335049_0251750_3_122 | 3300034272 | Freshwater | NKRRHIVTPDSFTKYGLNRSSIVEVSESETNMHDLGENL |
| Ga0335048_0364361_586_726 | 3300034356 | Freshwater | KLYLISQNKKRHIVDPDTFNKYGLDRSQVVEVSAFEVSMHELGEDL |
| ⦗Top⦘ |