


| Basic Information | |
|---|---|
| Family ID | F071587 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 36 residues |
| Representative Sequence | VLDLNAHGIKNTAALLGGWNGWNEAKLPIEATSKK |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 13.93 % |
| % of genes near scaffold ends (potentially truncated) | 5.74 % |
| % of genes from short scaffolds (< 2000 bps) | 80.33 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.164 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.934 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.426 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.541 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.11% β-sheet: 0.00% Coil/Unstructured: 88.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00581 | Rhodanese | 53.28 |
| PF03952 | Enolase_N | 9.84 |
| PF10502 | Peptidase_S26 | 8.20 |
| PF00990 | GGDEF | 2.46 |
| PF02082 | Rrf2 | 2.46 |
| PF00005 | ABC_tran | 1.64 |
| PF02223 | Thymidylate_kin | 1.64 |
| PF01175 | Urocanase | 1.64 |
| PF02518 | HATPase_c | 1.64 |
| PF12704 | MacB_PCD | 1.64 |
| PF01464 | SLT | 1.64 |
| PF00072 | Response_reg | 0.82 |
| PF09992 | NAGPA | 0.82 |
| PF12802 | MarR_2 | 0.82 |
| PF13474 | SnoaL_3 | 0.82 |
| PF01569 | PAP2 | 0.82 |
| PF00154 | RecA | 0.82 |
| PF10387 | DUF2442 | 0.82 |
| PF15975 | Flot | 0.82 |
| PF12840 | HTH_20 | 0.82 |
| PF07813 | LTXXQ | 0.82 |
| PF01266 | DAO | 0.82 |
| PF00884 | Sulfatase | 0.82 |
| PF00171 | Aldedh | 0.82 |
| PF01458 | SUFBD | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 9.84 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 3.28 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 2.46 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 2.46 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 2.46 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 2.46 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 2.46 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 2.46 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 2.46 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 2.46 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 1.64 |
| COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 1.64 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.82 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.82 |
| COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.82 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.98 % |
| Unclassified | root | N/A | 9.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001372|YBBDRAFT_1171787 | Not Available | 928 | Open in IMG/M |
| 3300001536|A1565W1_10571401 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300002155|JGI24033J26618_1013593 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005340|Ga0070689_100110874 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300005445|Ga0070708_100439748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
| 3300005537|Ga0070730_10346986 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300005552|Ga0066701_10542645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300005553|Ga0066695_10892593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300005554|Ga0066661_10529498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300005561|Ga0066699_10141463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1633 | Open in IMG/M |
| 3300005561|Ga0066699_10736897 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005564|Ga0070664_100716102 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005564|Ga0070664_101757867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300005566|Ga0066693_10101792 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005566|Ga0066693_10136442 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005569|Ga0066705_10175351 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300005575|Ga0066702_10062853 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300005587|Ga0066654_10280368 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005587|Ga0066654_10834311 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005836|Ga0074470_10145897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10779 | Open in IMG/M |
| 3300005840|Ga0068870_10019344 | All Organisms → cellular organisms → Bacteria | 3303 | Open in IMG/M |
| 3300005842|Ga0068858_100000223 | All Organisms → cellular organisms → Bacteria | 61546 | Open in IMG/M |
| 3300005842|Ga0068858_101713031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300005892|Ga0075275_1013288 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300006028|Ga0070717_10000068 | All Organisms → cellular organisms → Bacteria | 86088 | Open in IMG/M |
| 3300006032|Ga0066696_10161033 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300006173|Ga0070716_100024017 | All Organisms → cellular organisms → Bacteria | 3241 | Open in IMG/M |
| 3300006237|Ga0097621_100429110 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300006358|Ga0068871_100593529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300006358|Ga0068871_100608058 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300006358|Ga0068871_101441089 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300006854|Ga0075425_100000007 | All Organisms → cellular organisms → Bacteria | 223104 | Open in IMG/M |
| 3300006903|Ga0075426_10001219 | All Organisms → cellular organisms → Bacteria | 18203 | Open in IMG/M |
| 3300006903|Ga0075426_10382057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
| 3300009012|Ga0066710_102331576 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300009088|Ga0099830_10539306 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300009088|Ga0099830_10639280 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300009093|Ga0105240_12725652 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009098|Ga0105245_10000010 | All Organisms → cellular organisms → Bacteria | 278233 | Open in IMG/M |
| 3300009098|Ga0105245_10000376 | All Organisms → cellular organisms → Bacteria | 41489 | Open in IMG/M |
| 3300009098|Ga0105245_10070195 | All Organisms → cellular organisms → Bacteria | 3178 | Open in IMG/M |
| 3300009098|Ga0105245_11202070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300009143|Ga0099792_10189306 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300010044|Ga0126310_10307947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
| 3300010229|Ga0136218_1017934 | Not Available | 769 | Open in IMG/M |
| 3300010335|Ga0134063_10635419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300010337|Ga0134062_10694750 | Not Available | 534 | Open in IMG/M |
| 3300010397|Ga0134124_11524923 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300010403|Ga0134123_10217351 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300011269|Ga0137392_11053717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 667 | Open in IMG/M |
| 3300011270|Ga0137391_10280332 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300011998|Ga0120114_1100326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300012189|Ga0137388_10185613 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
| 3300012189|Ga0137388_10576354 | Not Available | 1046 | Open in IMG/M |
| 3300012204|Ga0137374_10053605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4123 | Open in IMG/M |
| 3300012212|Ga0150985_102390790 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012212|Ga0150985_107418006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300012212|Ga0150985_113322185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300012285|Ga0137370_10296153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300012353|Ga0137367_10076588 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300012353|Ga0137367_10981224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300012355|Ga0137369_10913300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300012375|Ga0134034_1063357 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012384|Ga0134036_1173947 | Not Available | 570 | Open in IMG/M |
| 3300012406|Ga0134053_1326360 | Not Available | 617 | Open in IMG/M |
| 3300012469|Ga0150984_113094577 | Not Available | 553 | Open in IMG/M |
| 3300012685|Ga0137397_10980162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300012907|Ga0157283_10242808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300012927|Ga0137416_11465745 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012944|Ga0137410_10857584 | Not Available | 766 | Open in IMG/M |
| 3300012960|Ga0164301_11576145 | Not Available | 544 | Open in IMG/M |
| 3300012961|Ga0164302_10969961 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300013308|Ga0157375_10000191 | All Organisms → cellular organisms → Bacteria | 57524 | Open in IMG/M |
| 3300013503|Ga0120127_10028504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1031 | Open in IMG/M |
| 3300013764|Ga0120111_1055643 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300014052|Ga0120109_1004400 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
| 3300014745|Ga0157377_11050554 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300015171|Ga0167648_1011810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2165 | Open in IMG/M |
| 3300017659|Ga0134083_10389827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300018059|Ga0184615_10040812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2578 | Open in IMG/M |
| 3300018468|Ga0066662_10117984 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300018468|Ga0066662_12677474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300018468|Ga0066662_13005311 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300020215|Ga0196963_10146985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
| 3300021358|Ga0213873_10213296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300021377|Ga0213874_10043928 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592 | 1348 | Open in IMG/M |
| 3300021384|Ga0213876_10499530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300022756|Ga0222622_10676650 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300023046|Ga0233356_1011198 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300023268|Ga0247765_1017766 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300024177|Ga0247686_1004099 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300024246|Ga0247680_1000372 | All Organisms → cellular organisms → Bacteria | 13025 | Open in IMG/M |
| 3300025481|Ga0208079_1023235 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300025908|Ga0207643_10014998 | All Organisms → cellular organisms → Bacteria | 4216 | Open in IMG/M |
| 3300025909|Ga0207705_10032504 | All Organisms → cellular organisms → Bacteria | 3729 | Open in IMG/M |
| 3300025912|Ga0207707_10410088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1162 | Open in IMG/M |
| 3300025918|Ga0207662_10257288 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300025918|Ga0207662_10531270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
| 3300025919|Ga0207657_10933325 | Not Available | 668 | Open in IMG/M |
| 3300025922|Ga0207646_10329171 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300025925|Ga0207650_10000035 | All Organisms → cellular organisms → Bacteria | 215488 | Open in IMG/M |
| 3300025927|Ga0207687_10025965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3921 | Open in IMG/M |
| 3300025936|Ga0207670_10277408 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300025939|Ga0207665_11080778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300025944|Ga0207661_10283861 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300026089|Ga0207648_10541202 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300026335|Ga0209804_1062953 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300026550|Ga0209474_10190194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
| 3300027164|Ga0208994_1004294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1624 | Open in IMG/M |
| 3300027459|Ga0207505_100527 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
| 3300027496|Ga0208987_1046309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300027831|Ga0209797_10216613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300027875|Ga0209283_10149696 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300028536|Ga0137415_10521275 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300029636|Ga0222749_10192143 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300029636|Ga0222749_10833354 | Not Available | 504 | Open in IMG/M |
| 3300031366|Ga0307506_10482509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300031446|Ga0170820_16499106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031720|Ga0307469_12058879 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031949|Ga0214473_10886906 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300034143|Ga0334961_000011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 127936 | Open in IMG/M |
| 3300034164|Ga0364940_0161833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.28% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 3.28% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.28% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.46% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.82% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.82% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.82% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.82% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.82% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.82% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.82% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.82% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.82% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010229 | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1 | Engineered | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300023268 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6 | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027459 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| YBBDRAFT_11717871 | 3300001372 | Marine Estuarine | VLDLNAHGIENTAALLGGWNGWLEAKLATESSTVKE* |
| A1565W1_105714013 | 3300001536 | Permafrost | VLDLNAHGVKNTAALLGGWNQWVSLGLPTESNIGKKKK* |
| JGI24033J26618_10135933 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | VLDLNAKGIKNTAALLGGWNEWKSHNLPTATTTKK* |
| Ga0070689_1001108742 | 3300005340 | Switchgrass Rhizosphere | VLDLNAHKIMNTAALLGGWNEWKAAGLPTQSATPTATKK* |
| Ga0070708_1004397481 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ARAVLDMNAHNIKNAAALLGGWSGWQQAKLPVEATAVKKN* |
| Ga0070730_103469863 | 3300005537 | Surface Soil | VLDLNAHGIKNTAALLGGWNGWIQAKLPIVTGPNKNGPEKK* |
| Ga0066701_105426451 | 3300005552 | Soil | MNAHNIKNAAALLGGWSGWQQAKLPVESTAVKKK* |
| Ga0066695_108925931 | 3300005553 | Soil | MNAHNIKNAAALLGGWSGWQQAKLPVEATPVKKN* |
| Ga0066661_105294982 | 3300005554 | Soil | MNAHNIKNAAALLGGWSGWQQAKLPVESAAVKKK* |
| Ga0066699_101414632 | 3300005561 | Soil | VLDLNAHGIKNTAALLGGWNAWLAAGLPTEKTAEKK* |
| Ga0066699_107368971 | 3300005561 | Soil | VLDLNAHGIKNAAALTGGWNGWNEARLPIEATSKK* |
| Ga0070664_1007161022 | 3300005564 | Corn Rhizosphere | VLDLNAHGIKNAAALLGGWNGWNEARLPIESTPKK* |
| Ga0070664_1017578672 | 3300005564 | Corn Rhizosphere | RAVLDLNAHGIKNTAALLGGWNSWVEAKLPTEKTPTK* |
| Ga0066693_101017922 | 3300005566 | Soil | VLNLNAHKIMNTAALLGGWNDWKAAGLPTESAIAKK* |
| Ga0066693_101364422 | 3300005566 | Soil | VLDLNAHGVKNTAALLGGWNGWLAAGLPTEKTIEKK* |
| Ga0066705_101753512 | 3300005569 | Soil | VLDLNAHGIKNTADLLGGWNAWLAAGLPTEKTAEKK* |
| Ga0066702_100628533 | 3300005575 | Soil | VLDLNAHGIKNAAALLGGWNGWNEAKLPIESTSKK* |
| Ga0066654_102803682 | 3300005587 | Soil | VLDLNAHGIKNAAALLGGWSGWNEARLPVEATPRK* |
| Ga0066654_108343111 | 3300005587 | Soil | VLDLNAHNVKNTAALLGGWNGWIAAGLPTAKTPIK* |
| Ga0074470_101458976 | 3300005836 | Sediment (Intertidal) | VLDLNAHGIENTAALLGGWNGWLEAKQATESSTAKAQP* |
| Ga0068870_100193441 | 3300005840 | Miscanthus Rhizosphere | ARAVLDLNAKGIKNTAALLGGWNEWKSHNLPTATTTKK* |
| Ga0068858_10000022347 | 3300005842 | Switchgrass Rhizosphere | VLDLNSKGIKNTACLLGGWNAWTAANMPIEKGSK* |
| Ga0068858_1017130311 | 3300005842 | Switchgrass Rhizosphere | VLDLNAHGVKNTAALLGGWNDWKAKGLPTESGLPKK* |
| Ga0075275_10132883 | 3300005892 | Rice Paddy Soil | VLDLNAHKIKNTAALLGGWNGWVAAGLPTETTPMK* |
| Ga0070717_1000006882 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VLDMNTHGIKNAAALLGGWNGWLQAKEPTVATPKKK* |
| Ga0066696_101610332 | 3300006032 | Soil | VLDLNAHGIKNTAALLGGWNGWNEAKLPIEATSKK* |
| Ga0070716_1000240172 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VLDLNAHGIKNTAALLGGWNGWVAAGLPTEPTKK* |
| Ga0097621_1004291103 | 3300006237 | Miscanthus Rhizosphere | VLDLNAHGIKNTAALLGGWTGWTEAKLPTESSVKK* |
| Ga0068871_1005935293 | 3300006358 | Miscanthus Rhizosphere | VLDLNAHGIKNTAALLGGWNGWTEAKLPTESSVKK* |
| Ga0068871_1006080583 | 3300006358 | Miscanthus Rhizosphere | VLDLNAHGIKNTAALLGGWNSWVEAKLPTEKTPTK* |
| Ga0068871_1014410892 | 3300006358 | Miscanthus Rhizosphere | VLDLNAHGIKNAAALTGGWNGWNEARLPIEATTKK* |
| Ga0075425_10000000757 | 3300006854 | Populus Rhizosphere | MNAHGIKNAAALLGGWNGWQQAKLPTVSAAAAKKP* |
| Ga0075426_1000121917 | 3300006903 | Populus Rhizosphere | VLDMNAHGIKNAAALLGGWNGWQQAKLPTVSAAAAKKP* |
| Ga0075426_103820572 | 3300006903 | Populus Rhizosphere | VLDLNAHGVKKTAALLGGWTGWVAANLPTEKTPIK* |
| Ga0066710_1023315762 | 3300009012 | Grasslands Soil | VLDLNAHGIKETAALLGGWNGWKDAGLPVEVTPVKK |
| Ga0099830_105393063 | 3300009088 | Vadose Zone Soil | VLDLNAHGVKNTAALLGGWNGWVAAGLPVTKTPIK* |
| Ga0099830_106392802 | 3300009088 | Vadose Zone Soil | MNAHGIKNAAALLDGWNGWKDAHLPVTAAKKKVAT* |
| Ga0105240_127256522 | 3300009093 | Corn Rhizosphere | VLDLNAHGVKNTAALLGGWNEWKAKGLPTESGLPKK* |
| Ga0105245_10000010223 | 3300009098 | Miscanthus Rhizosphere | VLDLNAHGIKNTAALLGGWNGWVEAKLPTEKAETK* |
| Ga0105245_100003765 | 3300009098 | Miscanthus Rhizosphere | VLDLNAHGIKNTAALLGGWNGWLAAKMPVETTAVKK* |
| Ga0105245_100701953 | 3300009098 | Miscanthus Rhizosphere | VLDLNAHGVKNTAALLGGWNGWTAAGLPVEKTPIK* |
| Ga0105245_112020702 | 3300009098 | Miscanthus Rhizosphere | VLDLNAHGIKNTAALLGGWSGWNEAKLPIESSVKK* |
| Ga0099792_101893062 | 3300009143 | Vadose Zone Soil | VLDLNAHGIKNTAALLGGWNSWVEAKLPTEKTKTK* |
| Ga0126310_103079471 | 3300010044 | Serpentine Soil | VLDLNAHQIKNAAALLGGWNEWKAAGLPTESKKK* |
| Ga0136218_10179342 | 3300010229 | Soil | VLDLKGHGNNNATALLGGWNEWTALGLPVEKTKLK* |
| Ga0134063_106354191 | 3300010335 | Grasslands Soil | VLDLNAHGVKKTAALLGGWNGWVAANLPTEKTPIK* |
| Ga0134062_106947501 | 3300010337 | Grasslands Soil | MNAHNIKNAAALLGGWSGWQQAKLPVEATPVKKK* |
| Ga0134124_115249232 | 3300010397 | Terrestrial Soil | VLDLNAHGVKNTAALLGGWNEWKAKGLPTDTGLPKK* |
| Ga0134123_102173512 | 3300010403 | Terrestrial Soil | VQELNAHGVKNTAALLGGWNEWAALGLPTESNIGKKK* |
| Ga0137392_110537172 | 3300011269 | Vadose Zone Soil | VLDLNAHGIKNTAALLGGWNGWNEAHLPIETAVKK* |
| Ga0137391_102803322 | 3300011270 | Vadose Zone Soil | VLDLNKRGIKNTAALRGGWNEWKAAGLPVEQTAVK* |
| Ga0120114_11003262 | 3300011998 | Permafrost | VLDLNAHGVKNTAALLGGWNQWVALGLPTESNIGKKKK* |
| Ga0137388_101856132 | 3300012189 | Vadose Zone Soil | MNAHGIKNAAALLDGWNEWKDAHLPVTAPKKKVAT* |
| Ga0137388_105763543 | 3300012189 | Vadose Zone Soil | VLDLNAHGVKKTAALLGGWNGWVAAGLPVTKTPIK* |
| Ga0137374_100536055 | 3300012204 | Vadose Zone Soil | MNAHNLKNAAALLGGWNGWQQAKLAVESTAVKKK* |
| Ga0150985_1023907901 | 3300012212 | Avena Fatua Rhizosphere | VLDLNAHGIKNTAALLGGWNGWKDAKLPTEVTIVKMQ* |
| Ga0150985_1074180062 | 3300012212 | Avena Fatua Rhizosphere | VLDLNARGIKNTAALLGGWNGWIGAGLPTEKSELK* |
| Ga0150985_1133221853 | 3300012212 | Avena Fatua Rhizosphere | VLDLNAHGVKNAAALLGGWNGWRDAKLPTEVTIVKMQ* |
| Ga0137370_102961532 | 3300012285 | Vadose Zone Soil | MNAHNVKNAAALLGGWSGWQQAKLPVESAAVKKK* |
| Ga0137367_100765884 | 3300012353 | Vadose Zone Soil | MNAHGITHAAALLGGWNGWQQAKLPIETTAVKKK* |
| Ga0137367_109812241 | 3300012353 | Vadose Zone Soil | VLDLNAHGIKNTAALLGGWSGWTAAKLPIESSVKK* |
| Ga0137369_109133002 | 3300012355 | Vadose Zone Soil | MNAPNLKNAAALLGGWNGWQQAKLPVESAVVKKK* |
| Ga0134034_10633572 | 3300012375 | Grasslands Soil | VLDLNAHGIKNTAALKDGWNGWNEAKLPIEATPKK* |
| Ga0134036_11739471 | 3300012384 | Grasslands Soil | VLDLNAHGVKNTAALLGGWNEWKAAGMPVEVTGLKR* |
| Ga0134053_13263602 | 3300012406 | Grasslands Soil | VLDLNAHGVKNTAALLGGWNGWKAANLPTESSLKK* |
| Ga0150984_1130945772 | 3300012469 | Avena Fatua Rhizosphere | VLDLNAHVVKNTAALLGGWNEWKAKGLPTESGLPKK* |
| Ga0137397_109801622 | 3300012685 | Vadose Zone Soil | VLDLNAHGIKNTAALLGGWHAWIAAGLPTEQAPVPATTP |
| Ga0157283_102428082 | 3300012907 | Soil | VLDLKGHGNNNAAALLGGWNEWTALGLPVEKTKLK* |
| Ga0137416_114657452 | 3300012927 | Vadose Zone Soil | MNAHGIKNAAALLGGWNGWNDAHLPVAAAKKKVAT* |
| Ga0137410_108575842 | 3300012944 | Vadose Zone Soil | VLDLNAHGIKNAAALLGGWNGWNEAKLPIESSVKK* |
| Ga0164301_115761452 | 3300012960 | Soil | VLDLNAHGIKNTAALLGGWNGWNEARLPIEATKK* |
| Ga0164302_109699612 | 3300012961 | Soil | VLDLNAHGVTNAAALLGGWNQWAALGLPTESNLGKKK* |
| Ga0157375_1000019149 | 3300013308 | Miscanthus Rhizosphere | VLDLNAHGIKNTAALLGGWSGWNEAKLPVESSVKK* |
| Ga0120127_100285043 | 3300013503 | Permafrost | VLDLNEHGITNTAALLGGWNGWKDAKLPIAVSKKK* |
| Ga0120111_10556433 | 3300013764 | Permafrost | VLDLNKHGIKNTAALRGGWNEWKAAGLPMEQATLK* |
| Ga0120109_10044002 | 3300014052 | Permafrost | VLDLNAHGVKNTAALLGGWNQWAALGLPTESNVGKPKKN* |
| Ga0157377_110505542 | 3300014745 | Miscanthus Rhizosphere | VLDLNAHGVKNTAALLGGWNQWAALGLPTESNIGKKK* |
| Ga0167648_10118102 | 3300015171 | Glacier Forefield Soil | MNAHGIKNAAALLGGWSGWKEAKLPTEITKVKKK* |
| Ga0134083_103898272 | 3300017659 | Grasslands Soil | MNAHGIKNAAALLGGWSGWQQAKLPVEATPVKKKN |
| Ga0184615_100408122 | 3300018059 | Groundwater Sediment | VVLDLNAHGIKNTAALLGGWNEWKAAGLPVEKPEMK |
| Ga0066662_101179842 | 3300018468 | Grasslands Soil | VLDLNAHGIKNTAALKDGWNGWNEAKLPIEATPKK |
| Ga0066662_126774742 | 3300018468 | Grasslands Soil | VLDLNAHGIKNTAALLGGWNAWLAAGLPTEKTAEKK |
| Ga0066662_130053112 | 3300018468 | Grasslands Soil | VLDLNAHGIKNTAALLGGWSGWNEAKLPIEATRRK |
| Ga0196963_101469852 | 3300020215 | Soil | VLDLKPKGIENTAALLGGWHAWTEKKLPTEKSSQKQ |
| Ga0213873_102132962 | 3300021358 | Rhizosphere | VLDLNAHNVTNTAALLGGWNAWKEAKLPTETTPPPKPTTKK |
| Ga0213874_100439283 | 3300021377 | Plant Roots | VLELNAHGVKNTAALLGGWNGWTVANLPVEMTPPPK |
| Ga0213876_104995302 | 3300021384 | Plant Roots | VLDLNAHGIKNTAALLGGWNGWKDAKLPIETAAEKK |
| Ga0222622_106766501 | 3300022756 | Groundwater Sediment | VLELNAHGVTNTAALIGGWNEWSALGLPTESTFSKKK |
| Ga0233356_10111981 | 3300023046 | Soil | LSVLELNAHGVKNTAALVDGWKGWLAARLPTETGSN |
| Ga0247765_10177662 | 3300023268 | Plant Litter | VLDLNAHGVKNTAALLGGWNEWKAANLPTQKTITKK |
| Ga0247686_10040994 | 3300024177 | Soil | VLDLNAHGIKNTAALLGGWNGWTQAHLPIETAVKK |
| Ga0247680_100037211 | 3300024246 | Soil | VLDLNAHGIKNTAALLGGWNGWTQAHLPTETAVKK |
| Ga0208079_10232352 | 3300025481 | Arctic Peat Soil | VLDLNAVGIKNTAALLGGWNEWLAAKEPTESTSAKKK |
| Ga0207643_100149984 | 3300025908 | Miscanthus Rhizosphere | VLDLNAKGIKNTAALLGGWNEWKSHNLPTATTTKK |
| Ga0207705_100325044 | 3300025909 | Corn Rhizosphere | VLDLNAHGIKNTAALLGGWSGWNEAKLPIESSVKK |
| Ga0207707_104100883 | 3300025912 | Corn Rhizosphere | VLDLNAHGIKNTAALLGGWNGWTEAKLPTESSVKK |
| Ga0207662_102572882 | 3300025918 | Switchgrass Rhizosphere | VLDLNAHGVKNTAALLGGWNGWTAAGLPVEKTPIK |
| Ga0207662_105312702 | 3300025918 | Switchgrass Rhizosphere | VLDLNAHGVKNTAALLGGWNSWRDAKLPIEVTKTK |
| Ga0207657_109333251 | 3300025919 | Corn Rhizosphere | VLDLNAHGIKNTACLLGGWNGWTAAKLPTETTPMK |
| Ga0207646_103291711 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAHGIKNAAALLGGWNGWKDAHLPVTAAKKKVAT |
| Ga0207650_10000035159 | 3300025925 | Switchgrass Rhizosphere | VLDLNAHGIKNAAALLGGWNGWNEARLPIESTPKK |
| Ga0207687_100259653 | 3300025927 | Miscanthus Rhizosphere | VLDLNAHGIKNTAALLGGWNGWLAAKMPVETTAVKK |
| Ga0207670_102774083 | 3300025936 | Switchgrass Rhizosphere | VLDLNAHKIMNTAALLGGWNEWKAAGLPTQSATPTATKK |
| Ga0207665_110807782 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VLDLNAHGIKNTAALEGGWNGWNEARLPIESTPLKK |
| Ga0207661_102838612 | 3300025944 | Corn Rhizosphere | VLDLNAHGVKNTAALLGGWNDWKAKGLPTESGLPKK |
| Ga0207648_105412023 | 3300026089 | Miscanthus Rhizosphere | VLDLNAHKIMNTAALLGGWNEWKAAGLPTESAAATAKK |
| Ga0209804_10629532 | 3300026335 | Soil | VLDLNAHGIKNAAALLGGWNGWNEARLPIEPTSKK |
| Ga0209474_101901942 | 3300026550 | Soil | VLDLNAHGIKNTAALLGGWNGWNEAKLPIEATSKK |
| Ga0208994_10042944 | 3300027164 | Forest Soil | VLDLNAHGNKNTAALLGGWNGWNEARLPVETAANVKK |
| Ga0207505_1005272 | 3300027459 | Soil | VLDLNAHGVKNTAALLGGWNGWIAANLPTEKTPIK |
| Ga0208987_10463092 | 3300027496 | Forest Soil | VLDLNAHGIKNTAALLGGWSGWNEAHLPIETSAPK |
| Ga0209797_102166132 | 3300027831 | Wetland Sediment | VLDLNALGIKNTAALLGGWNEWKAAGLPIEKPELK |
| Ga0209283_101496964 | 3300027875 | Vadose Zone Soil | VLDLNAHGIKNAAALLSGWNGWKDAGLPIATAKKRP |
| Ga0137415_105212752 | 3300028536 | Vadose Zone Soil | MNAHGIKNAAALLGGWNGWNDAHLPVAAAKKKVAT |
| Ga0222749_101921432 | 3300029636 | Soil | VLDLNAHGISNTAALLGGWNGWNEAHLPIETAAKK |
| Ga0222749_108333542 | 3300029636 | Soil | VLDLNAHGIKNTACLLGGWNDWQKASLPIEMTPVKK |
| Ga0307506_104825091 | 3300031366 | Soil | VLDLNAHNVKNTAALLGGWNGWITAGLPTEKTPIK |
| Ga0170820_164991061 | 3300031446 | Forest Soil | VLDLNAKGIKNTAALLGGWNGWLEAKLPVESTQVKK |
| Ga0307469_120588792 | 3300031720 | Hardwood Forest Soil | VLDLNAHGVKKTAALLGGWTGWVAANLPTEKTPIK |
| Ga0214473_108869062 | 3300031949 | Soil | VLDLNAHGIKNTAALIGGWNEWKAAGLPVQKTEMK |
| Ga0334961_000011_102834_102944 | 3300034143 | Sub-Biocrust Soil | VLELKQKGIERGAALLGGWNAWLAQHLPTETSEQEE |
| Ga0364940_0161833_11_118 | 3300034164 | Sediment | VLDLNKRGIKNAAALIGGWNEWKAAGLPVEKSELK |
| ⦗Top⦘ |