


| Basic Information | |
|---|---|
| Family ID | F071586 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MKTFYLSVVIGVVLAEMEAAQGQTEEAQAQTEVDLRPRRARFGISILGN |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.21 % |
| % of genes near scaffold ends (potentially truncated) | 39.34 % |
| % of genes from short scaffolds (< 2000 bps) | 81.15 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.311 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (18.852 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.967 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.262 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.25% β-sheet: 0.00% Coil/Unstructured: 46.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF01618 | MotA_ExbB | 27.05 |
| PF02472 | ExbD | 10.66 |
| PF13432 | TPR_16 | 3.28 |
| PF13414 | TPR_11 | 1.64 |
| PF14559 | TPR_19 | 1.64 |
| PF12831 | FAD_oxidored | 0.82 |
| PF13525 | YfiO | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 10.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.31 % |
| Unclassified | root | N/A | 28.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_104695020 | Not Available | 576 | Open in IMG/M |
| 3300000955|JGI1027J12803_108817043 | Not Available | 936 | Open in IMG/M |
| 3300004114|Ga0062593_100476013 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300004268|Ga0066398_10058943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300004479|Ga0062595_101342924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300004798|Ga0058859_11490322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1124 | Open in IMG/M |
| 3300004801|Ga0058860_11975947 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300004803|Ga0058862_12549182 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005093|Ga0062594_101971523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300005166|Ga0066674_10360751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300005180|Ga0066685_10246715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
| 3300005329|Ga0070683_100075264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3154 | Open in IMG/M |
| 3300005332|Ga0066388_100207352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2584 | Open in IMG/M |
| 3300005332|Ga0066388_100584065 | Not Available | 1742 | Open in IMG/M |
| 3300005332|Ga0066388_101350572 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300005332|Ga0066388_105046902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300005340|Ga0070689_100854292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300005354|Ga0070675_101436816 | Not Available | 636 | Open in IMG/M |
| 3300005355|Ga0070671_100070741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2911 | Open in IMG/M |
| 3300005436|Ga0070713_100187803 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300005438|Ga0070701_11051987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300005466|Ga0070685_11590780 | Not Available | 505 | Open in IMG/M |
| 3300005564|Ga0070664_100903482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300005598|Ga0066706_10743190 | Not Available | 778 | Open in IMG/M |
| 3300005713|Ga0066905_102320285 | Not Available | 502 | Open in IMG/M |
| 3300005719|Ga0068861_100279863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1436 | Open in IMG/M |
| 3300005764|Ga0066903_100327684 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
| 3300005764|Ga0066903_102779289 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005764|Ga0066903_104016636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300006028|Ga0070717_10088880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2605 | Open in IMG/M |
| 3300006028|Ga0070717_10346491 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300006034|Ga0066656_11104088 | Not Available | 510 | Open in IMG/M |
| 3300006173|Ga0070716_100026834 | All Organisms → cellular organisms → Bacteria | 3087 | Open in IMG/M |
| 3300006237|Ga0097621_100724915 | Not Available | 917 | Open in IMG/M |
| 3300006796|Ga0066665_10951313 | Not Available | 662 | Open in IMG/M |
| 3300006871|Ga0075434_100121879 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
| 3300006903|Ga0075426_10392828 | Not Available | 1023 | Open in IMG/M |
| 3300009038|Ga0099829_10048425 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
| 3300009088|Ga0099830_10040948 | All Organisms → cellular organisms → Bacteria | 3210 | Open in IMG/M |
| 3300009090|Ga0099827_10684322 | Not Available | 886 | Open in IMG/M |
| 3300009098|Ga0105245_12596718 | Not Available | 560 | Open in IMG/M |
| 3300009148|Ga0105243_10592507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1066 | Open in IMG/M |
| 3300009792|Ga0126374_10471177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300009792|Ga0126374_10977094 | Not Available | 662 | Open in IMG/M |
| 3300009792|Ga0126374_11432296 | Not Available | 564 | Open in IMG/M |
| 3300010043|Ga0126380_10166375 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300010046|Ga0126384_10238043 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300010047|Ga0126382_12350276 | Not Available | 516 | Open in IMG/M |
| 3300010048|Ga0126373_10945983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300010048|Ga0126373_12890271 | Not Available | 536 | Open in IMG/M |
| 3300010359|Ga0126376_12305396 | Not Available | 584 | Open in IMG/M |
| 3300010360|Ga0126372_10349300 | Not Available | 1326 | Open in IMG/M |
| 3300010360|Ga0126372_12083698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300010360|Ga0126372_12451033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010361|Ga0126378_10143348 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300010361|Ga0126378_10312601 | Not Available | 1676 | Open in IMG/M |
| 3300010366|Ga0126379_10915775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300010366|Ga0126379_12202333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300010373|Ga0134128_10091150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter daejeonensis | 3469 | Open in IMG/M |
| 3300010373|Ga0134128_10108005 | All Organisms → cellular organisms → Bacteria | 3161 | Open in IMG/M |
| 3300010376|Ga0126381_100424826 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300010398|Ga0126383_11365983 | Not Available | 798 | Open in IMG/M |
| 3300012096|Ga0137389_10005559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter daejeonensis | 8086 | Open in IMG/M |
| 3300012207|Ga0137381_10457047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300012207|Ga0137381_11119904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300012285|Ga0137370_10047330 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
| 3300012350|Ga0137372_10408153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300012350|Ga0137372_10876060 | Not Available | 639 | Open in IMG/M |
| 3300012353|Ga0137367_10123651 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300012353|Ga0137367_10399231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300012354|Ga0137366_10788615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300012359|Ga0137385_10884321 | Not Available | 740 | Open in IMG/M |
| 3300012929|Ga0137404_10667758 | Not Available | 938 | Open in IMG/M |
| 3300012960|Ga0164301_10517580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300012971|Ga0126369_11009797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300012971|Ga0126369_11127629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300012971|Ga0126369_11543248 | Not Available | 754 | Open in IMG/M |
| 3300012972|Ga0134077_10344460 | Not Available | 634 | Open in IMG/M |
| 3300013307|Ga0157372_10566084 | Not Available | 1325 | Open in IMG/M |
| 3300014968|Ga0157379_11651988 | Not Available | 627 | Open in IMG/M |
| 3300015371|Ga0132258_10545996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter daejeonensis | 2904 | Open in IMG/M |
| 3300016341|Ga0182035_10884073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300018431|Ga0066655_10176368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1298 | Open in IMG/M |
| 3300020078|Ga0206352_11064970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300021560|Ga0126371_10036433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter daejeonensis | 4641 | Open in IMG/M |
| 3300021560|Ga0126371_10383894 | Not Available | 1544 | Open in IMG/M |
| 3300025315|Ga0207697_10507806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300025321|Ga0207656_10266423 | Not Available | 842 | Open in IMG/M |
| 3300025900|Ga0207710_10235162 | Not Available | 913 | Open in IMG/M |
| 3300025904|Ga0207647_10006916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8223 | Open in IMG/M |
| 3300025914|Ga0207671_10311611 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300025922|Ga0207646_10182338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter daejeonensis | 1896 | Open in IMG/M |
| 3300025932|Ga0207690_10698821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300025936|Ga0207670_10468084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300025944|Ga0207661_10370182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1295 | Open in IMG/M |
| 3300025960|Ga0207651_10582747 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300025961|Ga0207712_10270469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1382 | Open in IMG/M |
| 3300026023|Ga0207677_10119684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter daejeonensis | 1978 | Open in IMG/M |
| 3300026142|Ga0207698_11912470 | Not Available | 608 | Open in IMG/M |
| 3300026142|Ga0207698_12389668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300026329|Ga0209375_1206890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300026377|Ga0257171_1037377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300026497|Ga0257164_1027832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300026538|Ga0209056_10401814 | Not Available | 841 | Open in IMG/M |
| 3300027654|Ga0209799_1003784 | All Organisms → cellular organisms → Bacteria | 3076 | Open in IMG/M |
| 3300028379|Ga0268266_10120240 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
| 3300030967|Ga0075399_10010482 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300030969|Ga0075394_10026000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300030973|Ga0075395_10044831 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
| 3300031122|Ga0170822_12630042 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300031231|Ga0170824_119447221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300031231|Ga0170824_121408487 | Not Available | 521 | Open in IMG/M |
| 3300031231|Ga0170824_127828181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300031446|Ga0170820_10244883 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300031474|Ga0170818_115654778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
| 3300031573|Ga0310915_10986681 | Not Available | 588 | Open in IMG/M |
| 3300031716|Ga0310813_10016777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4907 | Open in IMG/M |
| 3300031845|Ga0318511_10253505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300031890|Ga0306925_11865152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300031947|Ga0310909_10496614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300033475|Ga0310811_10000796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 40372 | Open in IMG/M |
| 3300033475|Ga0310811_10242171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter daejeonensis | 2146 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 18.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.46% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.46% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1046950201 | 3300000955 | Soil | LIGVALAETEAAQGQTEDAQAQTEVDLRPRRARFGISILGT* |
| JGI1027J12803_1088170431 | 3300000955 | Soil | MKKTFYLSVVIGVASAETEAAQGQTEDAQAQTQVDLRPRRVRFG |
| Ga0062593_1004760132 | 3300004114 | Soil | MKTFHLSVVIGVVLAEMEAAQGQTEEAQAQTEVDLRPRRAQFGISILSA* |
| Ga0066398_100589431 | 3300004268 | Tropical Forest Soil | MKTCYLSVVIGVVLAEMEAAQGQTEEAQAGSEVDLRPRRARFGISILGN* |
| Ga0062595_1013429242 | 3300004479 | Soil | MKTFYLSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISILGN* |
| Ga0058859_114903221 | 3300004798 | Host-Associated | VLRLRGNTDMKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT* |
| Ga0058860_119759471 | 3300004801 | Host-Associated | LSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT* |
| Ga0058862_125491821 | 3300004803 | Host-Associated | LSVVIGEVLAEMEAAQGQTEEAQAQTEVDRRPRGARFGISILGN* |
| Ga0062594_1019715233 | 3300005093 | Soil | MKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT* |
| Ga0066674_103607511 | 3300005166 | Soil | TFHLSVVIGMALAEMEAAQGQTGDARVQEVDLHPRRARFGISTLGN* |
| Ga0066685_102467152 | 3300005180 | Soil | MKKTFQMSVVIGVVLATMEAAQGQTEDAQAKTEIKLRLRRARFGISALDI* |
| Ga0070683_1000752645 | 3300005329 | Corn Rhizosphere | MKTFYLSVVIGEVLAEMEAAQGQTEEAQAQTEVDRRPRGARFGISILGN* |
| Ga0066388_1002073522 | 3300005332 | Tropical Forest Soil | MKKTFHLSVVIGVALAEMKAAQGQTEDAHAQEVDLRPRRARFGISTLGN* |
| Ga0066388_1005840652 | 3300005332 | Tropical Forest Soil | MKKTFHLSVVIGVALAEMKAAQGQTDNAQAQEVDLRPRRARFGISTLGN* |
| Ga0066388_1013505722 | 3300005332 | Tropical Forest Soil | MKKTFHLSVVIGVALAEMEAAQGQTEEAQAQEVDLRPRRARFGISILGI* |
| Ga0066388_1050469022 | 3300005332 | Tropical Forest Soil | MKKTFHLSVVIGVVLAEMEAAQGQTEDAQAQEVDLRPRGSVSPS* |
| Ga0070689_1008542921 | 3300005340 | Switchgrass Rhizosphere | KTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT* |
| Ga0070675_1014368162 | 3300005354 | Miscanthus Rhizosphere | MKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGIPILGT* |
| Ga0070671_1000707411 | 3300005355 | Switchgrass Rhizosphere | MKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT* |
| Ga0070713_1001878033 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTFYLSVVIGVVLAEIEAAQGQTEEAQARTEVDLCPRRARFGISILGN* |
| Ga0070701_110519873 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | SVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT* |
| Ga0070685_115907802 | 3300005466 | Switchgrass Rhizosphere | MKTFHLSVVISVVLAEMEAAQGQTEEAHAQTEVDLRPRRAQFGISI |
| Ga0070664_1009034823 | 3300005564 | Corn Rhizosphere | LSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGIPILGT* |
| Ga0066706_107431901 | 3300005598 | Soil | MKETFQMSIVIGAVVATMEAAQGQTEDAQAKTEIKLRLRRARFGISALDI* |
| Ga0066905_1023202851 | 3300005713 | Tropical Forest Soil | MKTFYLSVVIGVVLAEMEAAQGQTEEAQAQSEVDLRPRRARFGISILGN* |
| Ga0068861_1002798631 | 3300005719 | Switchgrass Rhizosphere | TDMKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT* |
| Ga0066903_1003276842 | 3300005764 | Tropical Forest Soil | MKKTFHMSVVIGVVVAETEAAQGQTEQAQVSTEVDFGFRRARFGSSSLAN* |
| Ga0066903_1027792893 | 3300005764 | Tropical Forest Soil | IVIGVVLAETEAAQGQTEDAQAPREVDLRTRRARFAISILSN* |
| Ga0066903_1040166361 | 3300005764 | Tropical Forest Soil | MKKTFHLSVVIGMTLAETEAAQEQTKEAQAGMEVDSFRRRAWFGISIMGI* |
| Ga0070717_100888804 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTFYLSVVIGVVLAEIEAAQGQTEEAQAQMEVDLRPRRARFGISILGN* |
| Ga0070717_103464914 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GNTEMKTFYLSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISIVGN* |
| Ga0066656_111040883 | 3300006034 | Soil | MMKKTFHLSVVIGMALAEMEAAQGQTGDARVQEVDLHPRRARFGISTLGN* |
| Ga0070716_1000268341 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TEMKTFYLSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISILGN* |
| Ga0097621_1007249151 | 3300006237 | Miscanthus Rhizosphere | MKKTFHLSVVIGVALAGMKAAQGQTEDAHAQKADLRPRRARFGISMLGN* |
| Ga0066665_109513131 | 3300006796 | Soil | MSIVIGAVVATMEAAQGQTEDAQAKTGVDLRLRRAWFGIPALDA* |
| Ga0075434_1001218795 | 3300006871 | Populus Rhizosphere | MKKTFHLSVVMGAVLAEMEAAQGQTEDAHAHEVDLRPRRARFAISILSN* |
| Ga0075426_103928282 | 3300006903 | Populus Rhizosphere | MKKTFHLSVVMGAVLAEMEAAQGQTEDAHAQEVDLRPRRARFAISILSN* |
| Ga0099829_100484251 | 3300009038 | Vadose Zone Soil | MKKNFYWSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISILGN* |
| Ga0099830_100409482 | 3300009088 | Vadose Zone Soil | MKKNFYWSVVIGVVLAEIEAARGQTEEAQAQTEVDLRPRRARFGISILGN* |
| Ga0099827_106843221 | 3300009090 | Vadose Zone Soil | MKTFYLSVVIGVVLAEIEAAQGQIEEAQAQTEVDLRPRRARFGISILGN* |
| Ga0105245_125967181 | 3300009098 | Miscanthus Rhizosphere | MKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARVGISILGT |
| Ga0105243_105925073 | 3300009148 | Miscanthus Rhizosphere | MKTFCLSVAIGKVLAETDAAQGQTEEAQAQTEVDLRPRRAQFGISILSA* |
| Ga0126374_104711772 | 3300009792 | Tropical Forest Soil | MKIFHLPIVIGVVLAETEAAQGQTEDAHAQEVDLRPRRARFAISILSN* |
| Ga0126374_109770942 | 3300009792 | Tropical Forest Soil | MRKTFHLSVVIGLVVAETEAAQGQTELAQASTEVDFRFRRARFGSSSLAY* |
| Ga0126374_114322961 | 3300009792 | Tropical Forest Soil | MKKTFPLSVVIGVVLAKTEAAQEQTKNAQAQTELNLRLRRARFGVSILDT* |
| Ga0126380_101663753 | 3300010043 | Tropical Forest Soil | MKTFYLSVVIGVVLAEMEAAQGQTEEAQAGSEVDLRPRRARFGISILGN* |
| Ga0126384_102380433 | 3300010046 | Tropical Forest Soil | FHLSVVIGLVVAETEAAQGQTEQAQTSTKVDFRFRRARFGSSSLAN* |
| Ga0126382_123502761 | 3300010047 | Tropical Forest Soil | MKKPFHLSVVIGLVVAETEAAQGQTELAQAPTEVDFRFRRARFGSSSLAY* |
| Ga0126373_109459832 | 3300010048 | Tropical Forest Soil | MKKTFHLSVVIGMALAETEAAQEQTKEAQAGMEVDSLRRRAWFSISIMGI* |
| Ga0126373_128902711 | 3300010048 | Tropical Forest Soil | MKKTLHLSVVIAVVLAETEAAQGQTEEAQAQTEVDPRSRRARFGISIVGN* |
| Ga0126376_123053961 | 3300010359 | Tropical Forest Soil | MAMKRTFRLSVVIGVVLAETEAAQGQAEDAQAQTEVDLRPRRPRFGVSILGN* |
| Ga0126372_103493001 | 3300010360 | Tropical Forest Soil | MKNRFHLSVVIGVVLAETVAAQGLAEEAQAQTEVDLRPRRARFGISIPGN* |
| Ga0126372_120836981 | 3300010360 | Tropical Forest Soil | MKKTFHLSVVIGMALAEMKAAQGQTEDAQAQEVDLRPRRARFGISTLGN* |
| Ga0126372_124510332 | 3300010360 | Tropical Forest Soil | IVIGVVLAETEAAQEQTEDPQAPREVDLRTRRARFAISILSN* |
| Ga0126378_101433483 | 3300010361 | Tropical Forest Soil | MKKTFHLSVVIGMTLAETEAAQEQTKEAQAGMEVDSLRRRAWFSISIMGI* |
| Ga0126378_103126012 | 3300010361 | Tropical Forest Soil | MKKHLHLSIVIGVTVAETEAAQGQDEQAQVSTEVEFRFRRARFGSSSLAI* |
| Ga0126379_109157752 | 3300010366 | Tropical Forest Soil | MKNRFHLSVVIGVVLAETVAAQGQTEEAQAQTEVDLRPRRVRFGISIPGN* |
| Ga0126379_122023332 | 3300010366 | Tropical Forest Soil | KKTLHLSVVIAVVLAETEAVQGQTEEALAGTEVDPRPRRARFGIFIVGN* |
| Ga0134128_100911504 | 3300010373 | Terrestrial Soil | MKTFHLSVVIGVVLAEMEAAQGQTEEAQAQTEVDLRPRRAQFGISILSD* |
| Ga0134128_101080054 | 3300010373 | Terrestrial Soil | MKTFYLSVVIGEVLAEMEAAQGQTEEAQAQTEVDRRPRRARFGISILGN* |
| Ga0126381_1004248262 | 3300010376 | Tropical Forest Soil | MKKHLHLSIVIGVTVAETEAAQGQDEQAQASTEVEFRFRRARFGSSSLAI* |
| Ga0126383_113659831 | 3300010398 | Tropical Forest Soil | MKTFYLSIVIGVLLVEMEAAQGQTEEAQAQTEVDLRPRRARFGISALGN* |
| Ga0137389_100055592 | 3300012096 | Vadose Zone Soil | MKTFYLSVVIGVVLAEMEAAQGQTEEAQAQTEVDLRPRRARFGISILGN* |
| Ga0137381_104570471 | 3300012207 | Vadose Zone Soil | MKKTFQMSVVIGVVLATMEAAQGQTEDAQAKTEIKPRLRRARFGISALDI* |
| Ga0137381_111199042 | 3300012207 | Vadose Zone Soil | MKTFYLSVAIGVVLAEIEAAQGLTEEAQAQAEVDLRPRGVRFGISILGN* |
| Ga0137370_100473301 | 3300012285 | Vadose Zone Soil | MKKNFYWSVVIGVVLAEIEAALGQTEEAQAQTEVDLRLRRARFGISILGN* |
| Ga0137372_104081532 | 3300012350 | Vadose Zone Soil | MKKIFQMSVVIGVVLATMEAAQGQTEDAQAKTEIKLRLRRARFGISALDI* |
| Ga0137372_108760602 | 3300012350 | Vadose Zone Soil | MKKTFHMSIVIGVVLANTEGEQGQTEDAQAKTKIKPCLGRARFGISALDI* |
| Ga0137367_101236513 | 3300012353 | Vadose Zone Soil | MKKTFHMSIVIGVVLANTEGEQGQTEDAQAKTKIKLCLGRARFGISALDI* |
| Ga0137367_103992311 | 3300012353 | Vadose Zone Soil | MKKTLQMSVVTGVVLATMEAAQGQTEDAQAKTEVDLRLRRARSGISGLDI* |
| Ga0137366_107886152 | 3300012354 | Vadose Zone Soil | MKKTFQMSVVIGLVLATMEAAQGQTEDAQAKTEIKLRLRRARFGISALDI* |
| Ga0137385_108843211 | 3300012359 | Vadose Zone Soil | MKTFYLSVAIGVVLAEIEAAQGLTEEAQGEEEVDLRPRRARFGISILGN* |
| Ga0137404_106677581 | 3300012929 | Vadose Zone Soil | MKKTFQMSVVIGVVLATMEAAQGQTEDAQAKTEIKLRLRRARFGIS |
| Ga0164301_105175802 | 3300012960 | Soil | MKTFYLSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRSARFGISILGN* |
| Ga0126369_110097972 | 3300012971 | Tropical Forest Soil | MKIFHLPIVIGVVLAETEAAQGQTEDAQAPREVDLRTRRARFAISILSN* |
| Ga0126369_111276292 | 3300012971 | Tropical Forest Soil | MKKTFHLSVVIGMTLAETEAAQEQTKEAQAGMEVDSFRRRAWFGISIMGL* |
| Ga0126369_115432481 | 3300012971 | Tropical Forest Soil | MKETFHLSVVIGVVVAETEAAQGQTEPAQHRRKLTFASELRFGSSSLAN* |
| Ga0134077_103444601 | 3300012972 | Grasslands Soil | MKKTFHLSVVIGVVVLETEAAQGQTEDAQAQTEIELRLRTARLGISVLGI* |
| Ga0157372_105660842 | 3300013307 | Corn Rhizosphere | MKKTFHLSVVIGVALAETEAVQGQTEDAQAQTEVDLRAPTARFGISILGT* |
| Ga0157379_116519881 | 3300014968 | Switchgrass Rhizosphere | MKTFCLSVAIGKVVAETDAAQGQTEEAQAQTEVDLRPRRAQFGISILSA* |
| Ga0132258_105459962 | 3300015371 | Arabidopsis Rhizosphere | MKTFYLSVVMSVVLAEMETAQGQTKEAQAHTEVDLCPRRVRFGISILGK* |
| Ga0182035_108840733 | 3300016341 | Soil | GNTEMKKTFHLSVVIGVVVAETEAAQGQTEPAQASTEVDFRFRRARFGSSSLAN |
| Ga0066655_101763681 | 3300018431 | Grasslands Soil | MKKTFQMSVVIGVVLATMEAAQGQTEDAQAKTEIKLRLRRARFGISALDI |
| Ga0206352_110649701 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | PQKAAWETEMKTFYLSVVIGEVLAEMEAAQGQTEEAQAQTEVDRRPRGARFGISILGN |
| Ga0126371_100364334 | 3300021560 | Tropical Forest Soil | MKKTFHMSVVIGVVVAETEAAQGQTEQAQVSTEVDFGFRRARFGSSSLAN |
| Ga0126371_103838943 | 3300021560 | Tropical Forest Soil | MKKTFHLSVVIGVVVAETEAAQGQTEPAQASTEVDFRFRRARFGSSSLAN |
| Ga0207697_105078063 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | TDMKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT |
| Ga0207656_102664232 | 3300025321 | Corn Rhizosphere | MKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFG |
| Ga0207710_102351622 | 3300025900 | Switchgrass Rhizosphere | MKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRPRRAQFGISILSD |
| Ga0207647_100069167 | 3300025904 | Corn Rhizosphere | MKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT |
| Ga0207671_103116113 | 3300025914 | Corn Rhizosphere | WKTEMKTFHLSVVIGVVLAEMEAAQGQTEEAQAQTEVDLRPRRAQFGISILSA |
| Ga0207646_101823381 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKNFYWSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGI |
| Ga0207690_106988211 | 3300025932 | Corn Rhizosphere | AVLRLRGNTDMKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT |
| Ga0207670_104680841 | 3300025936 | Switchgrass Rhizosphere | RLRGNTDMKKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT |
| Ga0207661_103701822 | 3300025944 | Corn Rhizosphere | MKTFYLSVVIGEVLAEMEAAQGQTEEAQAQTEVDLRPRRAQFGISILSA |
| Ga0207651_105827472 | 3300025960 | Switchgrass Rhizosphere | MKKTFHLSVVIGVSLAETEAAQGQTEEAQAQTEVDLRPRRAQFGISILSA |
| Ga0207712_102704694 | 3300025961 | Switchgrass Rhizosphere | MKTFHLSVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT |
| Ga0207677_101196841 | 3300026023 | Miscanthus Rhizosphere | MKTFHLSVVIGVVLAEMEAAQGQTEEAQAQTEVDLRPRRAQ |
| Ga0207698_119124701 | 3300026142 | Corn Rhizosphere | MKTFHLSVVIGVVLAEMEAAQGQTEEAQAQTEVDLRPRRAQFG |
| Ga0207698_123896681 | 3300026142 | Corn Rhizosphere | SVVIGVVLAEMEAAQGQTEEAQAQTEVDLRPRRAQFGISILSA |
| Ga0209375_12068901 | 3300026329 | Soil | NTEMKKTFQMSVVIGVVLATMEAAQGQTEDAQAKTEIKLRLRRARFGISALDI |
| Ga0257171_10373771 | 3300026377 | Soil | MKTFYLSVVIGVVLAEMEAAQGQTEEAQAQTEVDLRPRRARFGISILGN |
| Ga0257164_10278321 | 3300026497 | Soil | MKKTFHLSVVIGVVLAETEAAQGQTEEAQAQTEIDLRPRRARFGISFLGN |
| Ga0209056_104018141 | 3300026538 | Soil | MKETFQMSIVIGAVVATMEAAQGQTEDAQAKTGVDLRLRRAWFGIPALDA |
| Ga0209799_10037841 | 3300027654 | Tropical Forest Soil | MKTCYLSVVIGVVLAEMEAAQGQTEEAQAGSEVDLRPRRARFGISILGN |
| Ga0268266_101202403 | 3300028379 | Switchgrass Rhizosphere | MKKTFHLYVVIGVALAETEAAQGQTEDAQAQTEVDLRSRTARFGISILGT |
| Ga0075399_100104821 | 3300030967 | Soil | NTEMKTFYLSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISILGN |
| Ga0075394_100260001 | 3300030969 | Soil | KTFHLSVVIGVVLAEMEAAQGQTEDAHAQEVDLGPRRARFGISNLGI |
| Ga0075395_100448315 | 3300030973 | Soil | VVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISILGN |
| Ga0170822_126300421 | 3300031122 | Forest Soil | QRGNTEMKTFYLSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISIVGN |
| Ga0170824_1194472211 | 3300031231 | Forest Soil | RQRGNTEMKTFYLSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISILGN |
| Ga0170824_1214084871 | 3300031231 | Forest Soil | MKKNFHLSVVIGRVVGPTEAAQGQTEEAQAQTEVDLRPRRARFGI |
| Ga0170824_1278281811 | 3300031231 | Forest Soil | EMKTFYLSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISIVGN |
| Ga0170820_102448834 | 3300031446 | Forest Soil | LSVVIGVVLAEMEAAQGQTEDAHAQEVDLGPRRARFGISNLGI |
| Ga0170818_1156547781 | 3300031474 | Forest Soil | QHYVEFETAVTRQRGNTEMKTFYLSVVIGVVLAEIEAAQGQTEEAQAQTEVDLRPRRARFGISILGN |
| Ga0310915_109866811 | 3300031573 | Soil | MKKTFHLSFVIAVVLAEAEVAQGQTEDAQARTQVDPCPRTARFGISIVGN |
| Ga0310813_100167776 | 3300031716 | Soil | MKKTLHLSVVIGVALAEMKAAQGQTEDAHAQKADLRPRRARFGISMLGN |
| Ga0318511_102535052 | 3300031845 | Soil | TRLCGNTEMKKTFHLSFVIAVVLAEAEVAQGQTEDAQARTQVDPCPRTARFGISIVGN |
| Ga0306925_118651522 | 3300031890 | Soil | IAVVLAEAEVAQGQTEDAQARTQVDPCPRTARFGISIVGN |
| Ga0310909_104966141 | 3300031947 | Soil | GNTEMKKTFHLSFVIAVVLAEAEVAQGQTEDAQARTQVDPCPRTARFGISIVGN |
| Ga0310811_1000079633 | 3300033475 | Soil | SLKLPYKRGNTEMKKTLHLSVVIGVALAEMKAAQGQTEDAHAQKADLRPRRARFGISMLG |
| Ga0310811_102421713 | 3300033475 | Soil | MKTFYLSVVIGEVLAEMEAAQGQTEEAQAQTEVDRRPRGARFGISILG |
| ⦗Top⦘ |