


| Basic Information | |
|---|---|
| Family ID | F071531 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MANVIEFYVPVRFRKPVKWVPQQQRGRVLEFPVAQKRTA |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.80 % |
| % of genes near scaffold ends (potentially truncated) | 10.66 % |
| % of genes from short scaffolds (< 2000 bps) | 66.39 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.262 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (15.574 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.967 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.96% β-sheet: 0.00% Coil/Unstructured: 91.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00158 | Sigma54_activat | 32.79 |
| PF02954 | HTH_8 | 13.93 |
| PF00196 | GerE | 9.84 |
| PF02518 | HATPase_c | 2.46 |
| PF07730 | HisKA_3 | 2.46 |
| PF00106 | adh_short | 0.82 |
| PF05193 | Peptidase_M16_C | 0.82 |
| PF01292 | Ni_hydr_CYTB | 0.82 |
| PF02775 | TPP_enzyme_C | 0.82 |
| PF04542 | Sigma70_r2 | 0.82 |
| PF03050 | DDE_Tnp_IS66 | 0.82 |
| PF01209 | Ubie_methyltran | 0.82 |
| PF13186 | SPASM | 0.82 |
| PF06296 | RelE | 0.82 |
| PF13620 | CarboxypepD_reg | 0.82 |
| PF01740 | STAS | 0.82 |
| PF00115 | COX1 | 0.82 |
| PF00589 | Phage_integrase | 0.82 |
| PF00342 | PGI | 0.82 |
| PF05951 | Peptidase_M15_2 | 0.82 |
| PF07883 | Cupin_2 | 0.82 |
| PF14537 | Cytochrom_c3_2 | 0.82 |
| PF13669 | Glyoxalase_4 | 0.82 |
| PF00326 | Peptidase_S9 | 0.82 |
| PF13492 | GAF_3 | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 2.46 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 2.46 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 2.46 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 2.46 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.82 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.82 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.82 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.82 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.82 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.82 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.82 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.82 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.82 |
| COG3108 | Uncharacterized conserved protein YcbK, DUF882 family | Function unknown [S] | 0.82 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.82 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.82 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.82 |
| COG4737 | Uncharacterized conserved protein | Function unknown [S] | 0.82 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.26 % |
| Unclassified | root | N/A | 5.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17402371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1495 | Open in IMG/M |
| 2170459003|FZ032L002FZHNQ | Not Available | 510 | Open in IMG/M |
| 2170459024|GZTSFBX01DZ1N2 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_12311294 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101745818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101910733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2993 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1065901 | Not Available | 534 | Open in IMG/M |
| 3300000650|AP72_2010_repI_A1DRAFT_1002151 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300000955|JGI1027J12803_100997750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300000955|JGI1027J12803_104947382 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300001867|JGI12627J18819_10437682 | Not Available | 534 | Open in IMG/M |
| 3300003218|JGI26339J46600_10017924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2055 | Open in IMG/M |
| 3300003218|JGI26339J46600_10042805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1238 | Open in IMG/M |
| 3300003218|JGI26339J46600_10057623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1023 | Open in IMG/M |
| 3300003219|JGI26341J46601_10011753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2868 | Open in IMG/M |
| 3300003219|JGI26341J46601_10043677 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300003219|JGI26341J46601_10051271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1289 | Open in IMG/M |
| 3300003223|JGI26343J46809_1017941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300003368|JGI26340J50214_10023519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1883 | Open in IMG/M |
| 3300004114|Ga0062593_100308021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1355 | Open in IMG/M |
| 3300004152|Ga0062386_100264896 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300004479|Ga0062595_100313034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1067 | Open in IMG/M |
| 3300004480|Ga0062592_102323537 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300004633|Ga0066395_10080961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1521 | Open in IMG/M |
| 3300005093|Ga0062594_101930846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300005290|Ga0065712_10385888 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005332|Ga0066388_100027670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 5215 | Open in IMG/M |
| 3300005332|Ga0066388_100359140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2103 | Open in IMG/M |
| 3300005332|Ga0066388_100709583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1611 | Open in IMG/M |
| 3300005332|Ga0066388_106258258 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005434|Ga0070709_10157306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1577 | Open in IMG/M |
| 3300005434|Ga0070709_10967908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 676 | Open in IMG/M |
| 3300005436|Ga0070713_100226562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1697 | Open in IMG/M |
| 3300005436|Ga0070713_100993043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 809 | Open in IMG/M |
| 3300005437|Ga0070710_10639326 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005437|Ga0070710_10731926 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005614|Ga0068856_100356241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1482 | Open in IMG/M |
| 3300005616|Ga0068852_101687584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 656 | Open in IMG/M |
| 3300005764|Ga0066903_100296574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2553 | Open in IMG/M |
| 3300005841|Ga0068863_100048940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4008 | Open in IMG/M |
| 3300005844|Ga0068862_101312793 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300006028|Ga0070717_10307353 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300006047|Ga0075024_100098503 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300006059|Ga0075017_101515220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 528 | Open in IMG/M |
| 3300006162|Ga0075030_100298364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1288 | Open in IMG/M |
| 3300006173|Ga0070716_101810630 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006174|Ga0075014_100007123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3693 | Open in IMG/M |
| 3300006174|Ga0075014_100096478 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300006176|Ga0070765_100047457 | All Organisms → cellular organisms → Bacteria | 3482 | Open in IMG/M |
| 3300006176|Ga0070765_100320763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1436 | Open in IMG/M |
| 3300006237|Ga0097621_101715664 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300006358|Ga0068871_102134303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 534 | Open in IMG/M |
| 3300006904|Ga0075424_100825260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 989 | Open in IMG/M |
| 3300010043|Ga0126380_10106057 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300010047|Ga0126382_10342195 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300010048|Ga0126373_11694833 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300010048|Ga0126373_12140555 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300010362|Ga0126377_10141675 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300010376|Ga0126381_100173758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 2854 | Open in IMG/M |
| 3300012948|Ga0126375_10069057 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300012960|Ga0164301_10509549 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300012971|Ga0126369_13534400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012984|Ga0164309_10234994 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300013296|Ga0157374_12373802 | Not Available | 558 | Open in IMG/M |
| 3300013296|Ga0157374_12562222 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300014200|Ga0181526_10839103 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300014325|Ga0163163_10301026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1656 | Open in IMG/M |
| 3300014838|Ga0182030_10050557 | All Organisms → cellular organisms → Bacteria | 6634 | Open in IMG/M |
| 3300015371|Ga0132258_10088045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7270 | Open in IMG/M |
| 3300015372|Ga0132256_102592143 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300015373|Ga0132257_101198268 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300017823|Ga0187818_10418353 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300017932|Ga0187814_10036303 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300017947|Ga0187785_10291756 | Not Available | 746 | Open in IMG/M |
| 3300017995|Ga0187816_10052078 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300018044|Ga0187890_10890274 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300021420|Ga0210394_10112703 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
| 3300021439|Ga0213879_10051009 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300021441|Ga0213871_10055459 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300021478|Ga0210402_10071728 | All Organisms → cellular organisms → Bacteria | 3066 | Open in IMG/M |
| 3300021560|Ga0126371_10037077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4603 | Open in IMG/M |
| 3300021560|Ga0126371_10047425 | All Organisms → cellular organisms → Bacteria | 4100 | Open in IMG/M |
| 3300024179|Ga0247695_1076790 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025904|Ga0207647_10032894 | All Organisms → cellular organisms → Bacteria | 3326 | Open in IMG/M |
| 3300025915|Ga0207693_10838678 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300026023|Ga0207677_10058996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2645 | Open in IMG/M |
| 3300027502|Ga0209622_1000737 | All Organisms → cellular organisms → Bacteria | 4326 | Open in IMG/M |
| 3300027548|Ga0209523_1002938 | All Organisms → cellular organisms → Bacteria | 2645 | Open in IMG/M |
| 3300027812|Ga0209656_10004848 | All Organisms → cellular organisms → Bacteria | 8652 | Open in IMG/M |
| 3300027812|Ga0209656_10030549 | All Organisms → cellular organisms → Bacteria | 3197 | Open in IMG/M |
| 3300027812|Ga0209656_10036682 | All Organisms → cellular organisms → Bacteria | 2857 | Open in IMG/M |
| 3300027825|Ga0209039_10385546 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300027911|Ga0209698_10008231 | All Organisms → cellular organisms → Bacteria | 10801 | Open in IMG/M |
| 3300027911|Ga0209698_10099122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2441 | Open in IMG/M |
| 3300027915|Ga0209069_10081410 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300031231|Ga0170824_105915570 | Not Available | 600 | Open in IMG/M |
| 3300031446|Ga0170820_16393490 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031708|Ga0310686_104603492 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300031720|Ga0307469_10663744 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300031823|Ga0307478_10000963 | All Organisms → cellular organisms → Bacteria | 26843 | Open in IMG/M |
| 3300032770|Ga0335085_10011268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13287 | Open in IMG/M |
| 3300032770|Ga0335085_10012771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 12349 | Open in IMG/M |
| 3300032770|Ga0335085_11619372 | Not Available | 670 | Open in IMG/M |
| 3300032782|Ga0335082_10080250 | All Organisms → cellular organisms → Bacteria | 3281 | Open in IMG/M |
| 3300032805|Ga0335078_10191369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 2852 | Open in IMG/M |
| 3300032805|Ga0335078_10392327 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300032829|Ga0335070_10000129 | All Organisms → cellular organisms → Bacteria | 85971 | Open in IMG/M |
| 3300032829|Ga0335070_10000594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 40650 | Open in IMG/M |
| 3300032829|Ga0335070_10001850 | All Organisms → cellular organisms → Bacteria | 24526 | Open in IMG/M |
| 3300032829|Ga0335070_10003625 | All Organisms → cellular organisms → Bacteria | 18040 | Open in IMG/M |
| 3300032829|Ga0335070_10246760 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300032829|Ga0335070_10408670 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300032892|Ga0335081_10472035 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300032893|Ga0335069_10000369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 75761 | Open in IMG/M |
| 3300032893|Ga0335069_10759119 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300032897|Ga0335071_10195643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1975 | Open in IMG/M |
| 3300032897|Ga0335071_10842099 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300032955|Ga0335076_10003786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15234 | Open in IMG/M |
| 3300033158|Ga0335077_11344771 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300033402|Ga0326728_10000142 | All Organisms → cellular organisms → Bacteria | 291011 | Open in IMG/M |
| 3300033402|Ga0326728_10011484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 20188 | Open in IMG/M |
| 3300033983|Ga0371488_0004399 | All Organisms → cellular organisms → Bacteria | 14028 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 15.57% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 10.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.38% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.28% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.46% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.82% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.82% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.82% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00193020 | 2088090014 | Soil | MANVIEFYVPVRFRKAVKWVHPQQRGRVLEFPLAQKRTA |
| E4A_03801590 | 2170459003 | Grass Soil | MAKVIEFYVPARFRKVVKWLPQQQRGQLLEFAAAQKRTA |
| FD1_09565900 | 2170459024 | Grass Soil | MTNVIEFYVPVRFRKAVKWVPQQQRGRVLEFPVAQKRTA |
| ICChiseqgaiiFebDRAFT_123112942 | 3300000363 | Soil | MTNVIEFYVPVRFRKAVKWVPQQQQHGRVLEFPVAHKRTA* |
| INPhiseqgaiiFebDRAFT_1017458183 | 3300000364 | Soil | MAKVIEFYVPARFRKSVKWVPQPERGRILEFHVIQKKSA* |
| INPhiseqgaiiFebDRAFT_1019107332 | 3300000364 | Soil | MAKVIEFYVPARFRKPVKWVPQDERGRILEFHMVQKKTA* |
| AP72_2010_repI_A01DRAFT_10659012 | 3300000579 | Forest Soil | MANVIEFYIPVRFRKPVKWVPQQQRGRVLEFTVAQKRTA* |
| AP72_2010_repI_A1DRAFT_10021512 | 3300000650 | Forest Soil | MANVIEFYVPVRFRRTVKWVHPQQRGRVLEFLSPQKRTA* |
| JGI1027J12803_1009977502 | 3300000955 | Soil | MANVIEFYVPVRFRKAVKWVPQQQRGRVLEFPVAQQRTA* |
| JGI1027J12803_1049473822 | 3300000955 | Soil | MANAIEFYTPVRFRRAVKWVPQQQRGRVLEFPVEQKRTA* |
| JGI12627J18819_104376822 | 3300001867 | Forest Soil | MANVIEFYVPVRFRKAVKWVHPQQRGRVLEFVLPQKRTA* |
| JGI26339J46600_100179241 | 3300003218 | Bog Forest Soil | MANVIEFYIPVRFRKAVKWAPQQQRGRVLEFPVAQKRTA* |
| JGI26339J46600_100428053 | 3300003218 | Bog Forest Soil | MANVIEFYVPARFRKVVKWVPQQQRGRVLEFPVAQKRTA* |
| JGI26339J46600_100576232 | 3300003218 | Bog Forest Soil | MTNVIEFYVPVRFRKAVKWVPQQQRGRVLEFAVAQKRTA* |
| JGI26341J46601_100117532 | 3300003219 | Bog Forest Soil | MTNVIEFYVPVRFRKAVKWVPQQRRGQVLEFPVAQKRTA* |
| JGI26341J46601_100436772 | 3300003219 | Bog Forest Soil | MANVIEFYIPIRFRKAVKWVPQPQRGGVLEFPMAQKRTA* |
| JGI26341J46601_100512712 | 3300003219 | Bog Forest Soil | MANVIEFYVPVRFRKPVKWVPQQHRGRVLEFPLAQKRTA* |
| JGI26343J46809_10179412 | 3300003223 | Bog Forest Soil | MTNVIEFYVPVRFRKAVKWVPQQQRGRVLEFPVAQKRTA* |
| JGI26340J50214_100235191 | 3300003368 | Bog Forest Soil | MTNVIEFYVPVRFRKAAKWVPQQQRGRVLEFPVAQKRTA* |
| Ga0062593_1003080211 | 3300004114 | Soil | MPNVIEFYVPVRFRKAVKWVPQQQRGRVLEFRVAPKANRVTSPDQ |
| Ga0062386_1002648962 | 3300004152 | Bog Forest Soil | MANVIEFYVPVRFRKAVKWVHPQQRGRVLEFLLPQKRTA* |
| Ga0062595_1003130342 | 3300004479 | Soil | MAKVIEFYVPARFRKVVKWVPQEERGRVLEFAVAQKRTA* |
| Ga0062592_1023235371 | 3300004480 | Soil | MPNVIEFYVPVRFRKAVKWVPQQQRGRVLEFRVAPKANRVTSPDQKAS* |
| Ga0066395_100809612 | 3300004633 | Tropical Forest Soil | MTNVIEFYVPVRFRKAVKWVPQQQRGRVIEFPVAQKRTA* |
| Ga0062594_1019308462 | 3300005093 | Soil | MAKVIEFYVPVRLRKVVKWMPQQQRARVLEFAVAQKRTA* |
| Ga0065712_103858881 | 3300005290 | Miscanthus Rhizosphere | MAKVIEFYVPAGFRKVVKVVPPQERGQVLEFAVAQKRSA* |
| Ga0066388_1000276703 | 3300005332 | Tropical Forest Soil | MANVIEFYIPVRFRKSAKWVPQQQRGRVIEFAAAQKRTA* |
| Ga0066388_1003591403 | 3300005332 | Tropical Forest Soil | MANVIEFYVPVRFRKAVKWVPQQQRGRVLEFPVTQKRTA* |
| Ga0066388_1007095833 | 3300005332 | Tropical Forest Soil | MANVIEFYVPVRFRKAVKWVHPQQRGRVLEFLIRQKRTA* |
| Ga0066388_1062582582 | 3300005332 | Tropical Forest Soil | MANIIEFYVPVRFRKAVKWVHPQQRGRVLEFLLPQKRTA* |
| Ga0070709_101573062 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVIEFYVPVRFRKTVKWVHPQQRGRVLEFPLAQKRTA* |
| Ga0070709_109679082 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVIEFYIPVRFRKAVKWVPQQQRGRVLEFPVAQKRTA* |
| Ga0070713_1002265621 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNVIEFYVPVRFRKAVKWVPQQQRGRILEFPVAQKRTA* |
| Ga0070713_1009930432 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVIEFYIPVRFRKAVKWVPQLQRGRVLEFPVAQKRTA* |
| Ga0070710_106393261 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYVPVRFRKVLKWVPQQQRGRVLEFPVAQKRTA* |
| Ga0070710_107319262 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVIEFYVPVRFRKTVKWVHPQQRGRVLEFLLPQKRTA* |
| Ga0068856_1003562413 | 3300005614 | Corn Rhizosphere | MAKVIEFYVPAGFRKVVKVVPPQERGKVLEFAVAQKRSA* |
| Ga0068852_1016875841 | 3300005616 | Corn Rhizosphere | MAKVIEFYVPIRFRKVVKWMPQQQRARVLEFAVAQKRTA* |
| Ga0066903_1002965744 | 3300005764 | Tropical Forest Soil | MANVIEFYVPVRFRKPVKWVPQQQRGRVLEFPVAQKRTA* |
| Ga0068863_1000489405 | 3300005841 | Switchgrass Rhizosphere | MAKVIEFYVPARFRKVVKWVPQQERGQVLEFAVAQKRSA* |
| Ga0068862_1013127931 | 3300005844 | Switchgrass Rhizosphere | MTNVIEFYVPVRFRKAVKWAPQQQRGRVLEFPVAQKRTA* |
| Ga0070717_103073532 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYVPARFRKVVKWAPQQERGRVLEFAVTQKRTA* |
| Ga0075024_1000985033 | 3300006047 | Watersheds | MTNVIEFYVPARFRKAVKWVPQQQRGRVLEFPVAQKRTA* |
| Ga0075017_1015152201 | 3300006059 | Watersheds | MTNVIEFYVPVRFRKAVKWVPQQQRGRVLEFPVAQK |
| Ga0075030_1002983641 | 3300006162 | Watersheds | MANVIEFYVPARFRKVVKWVPEQQRGRVLEFPVAQKRTA* |
| Ga0070716_1018106301 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MANVIEFYVPVRFRKAVKWVHQQQRSRVLEFPVAQKRTA* |
| Ga0075014_1000071235 | 3300006174 | Watersheds | NMTNVIEFYVPVRFRKAVKWVPQQQRGRVLEFPVAQKRTA* |
| Ga0075014_1000964781 | 3300006174 | Watersheds | MTNVIEFYVPVRFRKAVKWVPQQQRGRVLEFPVAQKR |
| Ga0070765_1000474572 | 3300006176 | Soil | MAKVIEFYVPARFRKGVKWVPQRERGRMLEFAVAQKRTA* |
| Ga0070765_1003207631 | 3300006176 | Soil | MAKVIEFYVPVRFRKVLNWVPQQQRGRVLEFPVRQKRTA* |
| Ga0097621_1017156641 | 3300006237 | Miscanthus Rhizosphere | MPNVIEFYVPVRFRKTVKWVHPQQRGRVLEFPLAQKRTA* |
| Ga0068871_1021343032 | 3300006358 | Miscanthus Rhizosphere | MTNVIEFYVPVRFRKAVKWVPQQQSGRVLEFPVAQKRTA* |
| Ga0075424_1008252601 | 3300006904 | Populus Rhizosphere | MAKVIEFYVPVRFRKVLKWVPQQQRGRVLEFRVAQKRTA* |
| Ga0126380_101060572 | 3300010043 | Tropical Forest Soil | MANVIEYYVPVRFRKAVKWVPPQQRGRVLEFLLPQKRTA* |
| Ga0126382_103421952 | 3300010047 | Tropical Forest Soil | MANVIEFYVPVRFRKAVKWVPQRQRGRVLEFPVAQKRTA* |
| Ga0126373_116948332 | 3300010048 | Tropical Forest Soil | MANVIEFYIPVRFRKAVKWVPQQQRGRVLEFPVVQKRTA* |
| Ga0126373_121405551 | 3300010048 | Tropical Forest Soil | NMANVIEFYVPVRFRKAVKWVPQQQRGRVLEFPLAQKRTA* |
| Ga0126377_101416754 | 3300010362 | Tropical Forest Soil | MANVIEYCVPVRFRKAVKWVPPQQRGRVLEFLLPQKRTA* |
| Ga0126381_1001737581 | 3300010376 | Tropical Forest Soil | MANVIEFYVPVRFRKAVKWVHPQQRGRVLEFSVPQKRTA* |
| Ga0126375_100690573 | 3300012948 | Tropical Forest Soil | MANVIEFYVPVRFRKHVKWVPQQQRGRILEFPLAQKRTA* |
| Ga0164301_105095491 | 3300012960 | Soil | TEVVMAKVIEFYIPARFRKAVKWVPQQQRGRVLEFPVAQKQTA* |
| Ga0126369_135344002 | 3300012971 | Tropical Forest Soil | MAKVIEFYVPARFRKPVKWVPQEDRGRILEFHVVHKKTA* |
| Ga0164309_102349943 | 3300012984 | Soil | MAKVIEFYIPARFRKAVKWVPQQQRGRVLEFPVAQKQTA* |
| Ga0157374_123738021 | 3300013296 | Miscanthus Rhizosphere | MTNVIEFYVPVRFRKAVKWVRQQQRGRVLEFPVAQKRTA* |
| Ga0157374_125622222 | 3300013296 | Miscanthus Rhizosphere | MANVIEFYVPVRFRKAVKWVHQQQRGRVLEFPVAQKRTA* |
| Ga0181526_108391032 | 3300014200 | Bog | MTNMIEFYVPVRFRKAVKWVPQQQRGRVLEFPVAQKRTA* |
| Ga0163163_103010262 | 3300014325 | Switchgrass Rhizosphere | MAKVIEFYVPARFRKPVKWVPENERGRILEFPVIQKKTA* |
| Ga0182030_100505572 | 3300014838 | Bog | MANVIEFYIPVRFRKAVKWVPQQQRGRVLEFRVAQKRTA* |
| Ga0132258_100880451 | 3300015371 | Arabidopsis Rhizosphere | MEKVIEFYVPARFRKPVKWVPQDERGRILEFHMVQKKTA* |
| Ga0132256_1025921432 | 3300015372 | Arabidopsis Rhizosphere | MANVIEFYIPVRFRKAVKWVHPQQRGRVLEFVLPQKRTA* |
| Ga0132257_1011982682 | 3300015373 | Arabidopsis Rhizosphere | MANVIEFYVPVRFRKAVKWVPQQQRGRVLEFRVAPKANRVTSPDQKAS* |
| Ga0187818_104183531 | 3300017823 | Freshwater Sediment | MANVIEFYIPVRFRKAVKWVPQQQRGRVLEFPVAQKRTA |
| Ga0187814_100363031 | 3300017932 | Freshwater Sediment | MANVIEFYIPVRFRKAAKWVPQQQRGRVLEFPVAQKRTA |
| Ga0187785_102917561 | 3300017947 | Tropical Peatland | AMAKVIEFYVPARFRKPVKWVPQEERGRILEFHAIQKKSA |
| Ga0187816_100520782 | 3300017995 | Freshwater Sediment | MANVIEFYIPVRFRRAVKWVPQQQRGRVLEFPVAQKRTA |
| Ga0187890_108902742 | 3300018044 | Peatland | MANVIEFYVPARFRKVVKWVPQQQRGRVLEFPVAQKRTA |
| Ga0210394_101127032 | 3300021420 | Soil | MAKVIKFYVPARFRKILKWVPQQQRGRVLEFPVAQSRTA |
| Ga0213879_100510092 | 3300021439 | Bulk Soil | IEARSSNMANVIEFYVPVRFRKAVKWVHPQQRGRVLEFLVPQKRTA |
| Ga0213871_100554592 | 3300021441 | Rhizosphere | MANVIEFYVPVRFRKAVKWVHPQQRGRVLEFLLPQKRTA |
| Ga0210402_100717284 | 3300021478 | Soil | MAKVIEFYVPARFRKVVKWVPQQQRGRVLEFQAAQKRTA |
| Ga0126371_100370773 | 3300021560 | Tropical Forest Soil | MAKLIEFYVPRNFRKPSKWVPREDRGRILEFHVVQKKTA |
| Ga0126371_100474254 | 3300021560 | Tropical Forest Soil | MTNVIEFYVPVRFRKAVKWVPQQQRGRVIEFPVAQKRTA |
| Ga0247695_10767901 | 3300024179 | Soil | ANVIEFYIPVRFRKAVKWVPQQQRGRVLGFPVSQKRTA |
| Ga0207647_100328943 | 3300025904 | Corn Rhizosphere | MAKVIEFYVPAGFRKVVKVVPPQERGQVLEFAVAQKRSA |
| Ga0207693_108386781 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEFYVPARFRKVVKWAPQQERGRVLEFAVTQKRTA |
| Ga0207677_100589965 | 3300026023 | Miscanthus Rhizosphere | MAKVIEFYVPVRLRKVVKWMPQQQRARVLEFAVAQKRTA |
| Ga0209622_10007373 | 3300027502 | Forest Soil | MANVIEFYVPARFRKAVKWVHPQQRGRVLEFSLPQKRTA |
| Ga0209523_10029385 | 3300027548 | Forest Soil | MANVIEFYVPVRFRKAVKWVHPQQRGRVLEFVLPQKRTA |
| Ga0209656_1000484811 | 3300027812 | Bog Forest Soil | MANVIEFYIPIRFRKAVKWVPQPQRGGVLEFPMAQKRTA |
| Ga0209656_100305492 | 3300027812 | Bog Forest Soil | MANVIEFYVPVRFRKPVKWVPQQHRGRVLEFPLAQKRTA |
| Ga0209656_100366823 | 3300027812 | Bog Forest Soil | MTNVIEFYVPVRFRKAAKWVPQQQRGRVLEFPVAQKRTA |
| Ga0209039_103855462 | 3300027825 | Bog Forest Soil | MTNVIEFYVPVRFRKAVKWVPQQRRGQVLEFPVAQKRTA |
| Ga0209698_1000823111 | 3300027911 | Watersheds | MANVIEFYVPVRFRKAVKWVPQQQRGRVLEFPAAQKRTA |
| Ga0209698_100991224 | 3300027911 | Watersheds | MANVIEFYVPARFRKVVKWVPEQQRGRVLEFPVAQKRTA |
| Ga0209069_100814102 | 3300027915 | Watersheds | MTNVIEFYVPARFRKAVKWVPQQQRGRVLEFPVAQKRTA |
| Ga0170824_1059155702 | 3300031231 | Forest Soil | MAKVIEFYVPARFRKVVKWLPQQERGQVLEFAAAQKRTA |
| Ga0170820_163934902 | 3300031446 | Forest Soil | MAKVIEFYVPARFRKVVKWLPQQERGQVLEFAAAHKRTA |
| Ga0310686_1046034922 | 3300031708 | Soil | MAKVIEFYVPTRFRKILKWVPQQQRGRVLEFSVVQKRTA |
| Ga0307469_106637441 | 3300031720 | Hardwood Forest Soil | VTRRLVMAKVIEFYVPVRFRKVLKWVPQQERGRVLEFPVAQKRTA |
| Ga0307478_1000096310 | 3300031823 | Hardwood Forest Soil | MAKVNEFYVPARFRKILKSVPQQQRGRVLEFSVVQKRTA |
| Ga0335085_100112686 | 3300032770 | Soil | MANVIEFYIPVRSRKAVKWVPQQQRGRVLEFAVAQKRTA |
| Ga0335085_100127719 | 3300032770 | Soil | MTNVIEFYVPVRFRKAVKWVPQQQRGRVLEFRVPQKRTA |
| Ga0335085_116193722 | 3300032770 | Soil | MAKVIEFYVPARFRKPVKWVPQEERGRILEFHVLQKKSA |
| Ga0335082_100802504 | 3300032782 | Soil | NVIEFYIPVRFRKAAKWVPQQQRGRVLEFPVAQKRTA |
| Ga0335078_101913694 | 3300032805 | Soil | MANVIEFYVPARFRKVVKWVPQQQRGRVLEFPLAQKRTA |
| Ga0335078_103923272 | 3300032805 | Soil | MANVIEFYIPVRFRKATKWVPQQQRGRVLEFAVVQKRTA |
| Ga0335070_1000012944 | 3300032829 | Soil | MANVIESYIPVRFRKATKWVPQQQRGRVLEFAVVQKRTA |
| Ga0335070_100005944 | 3300032829 | Soil | MAKVIEFYVPSRFRKAVKWVHPQQRGRVLEFPMAQKRTA |
| Ga0335070_100018508 | 3300032829 | Soil | MANVIEFYVPVRFRKTVKWVHPQQRGRVLEFLIPQKRTA |
| Ga0335070_100036258 | 3300032829 | Soil | MANVIEFYVPVRFRKTVKWVHPQQRGRVLEFLLQQKRTA |
| Ga0335070_102467602 | 3300032829 | Soil | MANVIEFYIPVRFRKAAKWVPQQQRGRVLEFPVPQKRTA |
| Ga0335070_104086702 | 3300032829 | Soil | MANVIEFYVPVRFRKSVKWVHPQQRGRVLEFSVPQKRTA |
| Ga0335081_104720353 | 3300032892 | Soil | MANVIEFYVPVRFRKAVKWVLPQQRGRVLEFVLPQKRTA |
| Ga0335069_100003695 | 3300032893 | Soil | MANLIEFYIPVRYRKPVKWVPQQQRGRILEFARAQKRTA |
| Ga0335069_107591192 | 3300032893 | Soil | MANVIEFYVPVRFRKSVKWVHPQQRGRVLEFLLPQKRTA |
| Ga0335071_101956434 | 3300032897 | Soil | MANVIEFYIPVRFRKAVKWVPQQQHGRVLEFPSSAK |
| Ga0335071_108420992 | 3300032897 | Soil | MANVIEFYVPVRFRKAVKWVHPQQRGRVLEFLLPQKQTA |
| Ga0335076_100037868 | 3300032955 | Soil | MAKVIAFYVPARFRKVVKWVPQQQRGRVLEFPVAQKRTA |
| Ga0335077_113447712 | 3300033158 | Soil | MANVIEFYIPVRFRKAMKWVPQQQRGRVLKFPVAQKRTA |
| Ga0326728_10000142261 | 3300033402 | Peat Soil | MANLIEFYVPARFRKVVKWVPQQQRGRVLEFPVAQKRTA |
| Ga0326728_1001148422 | 3300033402 | Peat Soil | MANVIEFYIPVRFRKAVKWVPQEQRGRVLEFPVAQKRTA |
| Ga0371488_0004399_1_111 | 3300033983 | Peat Soil | VIEFYIPVRFRKAVKWVPQEQRGRVLEFPVAQKRTA |
| ⦗Top⦘ |