


| Basic Information | |
|---|---|
| Family ID | F071523 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MVALVLIESVRQWIGVLSGREEARVKEAPFVMTRLAEERG |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.26 % |
| % of genes from short scaffolds (< 2000 bps) | 88.52 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.033 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.934 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.590 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.279 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF02075 | RuvC | 25.41 |
| PF01019 | G_glu_transpept | 16.39 |
| PF09720 | Unstab_antitox | 7.38 |
| PF01850 | PIN | 1.64 |
| PF05016 | ParE_toxin | 1.64 |
| PF08323 | Glyco_transf_5 | 0.82 |
| PF07617 | DUF1579 | 0.82 |
| PF02641 | DUF190 | 0.82 |
| PF01875 | Memo | 0.82 |
| PF13360 | PQQ_2 | 0.82 |
| PF13229 | Beta_helix | 0.82 |
| PF11949 | DUF3466 | 0.82 |
| PF13602 | ADH_zinc_N_2 | 0.82 |
| PF13722 | CstA_5TM | 0.82 |
| PF03734 | YkuD | 0.82 |
| PF12840 | HTH_20 | 0.82 |
| PF12704 | MacB_PCD | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 25.41 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 16.39 |
| COG0297 | Glycogen synthase | Carbohydrate transport and metabolism [G] | 0.82 |
| COG0438 | Glycosyltransferase involved in cell wall bisynthesis | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
| COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 0.82 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
| COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 0.82 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.03 % |
| Unclassified | root | N/A | 31.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_76098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1560 | Open in IMG/M |
| 3300001356|JGI12269J14319_10027847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3832 | Open in IMG/M |
| 3300001416|JGI20176J14865_103186 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300003693|Ga0032354_1102661 | Not Available | 531 | Open in IMG/M |
| 3300004082|Ga0062384_100176801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1237 | Open in IMG/M |
| 3300004092|Ga0062389_104182770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 543 | Open in IMG/M |
| 3300004635|Ga0062388_100208269 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300004635|Ga0062388_101219767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 745 | Open in IMG/M |
| 3300005179|Ga0066684_10429026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 888 | Open in IMG/M |
| 3300005187|Ga0066675_10732469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 744 | Open in IMG/M |
| 3300005436|Ga0070713_100011465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6457 | Open in IMG/M |
| 3300005468|Ga0070707_101239206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 712 | Open in IMG/M |
| 3300005526|Ga0073909_10465789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 606 | Open in IMG/M |
| 3300005587|Ga0066654_10799776 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005602|Ga0070762_10798755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 638 | Open in IMG/M |
| 3300005610|Ga0070763_10112368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1386 | Open in IMG/M |
| 3300005610|Ga0070763_10346982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 825 | Open in IMG/M |
| 3300006032|Ga0066696_10453455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 840 | Open in IMG/M |
| 3300006052|Ga0075029_100015952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4171 | Open in IMG/M |
| 3300006174|Ga0075014_100442151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300009500|Ga0116229_11136797 | Not Available | 624 | Open in IMG/M |
| 3300009518|Ga0116128_1113904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300009518|Ga0116128_1134967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300009524|Ga0116225_1029036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2762 | Open in IMG/M |
| 3300009524|Ga0116225_1475206 | Not Available | 555 | Open in IMG/M |
| 3300010048|Ga0126373_11382804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300010048|Ga0126373_11474697 | Not Available | 746 | Open in IMG/M |
| 3300010361|Ga0126378_10682604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300010366|Ga0126379_13872674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300010379|Ga0136449_103777958 | Not Available | 570 | Open in IMG/M |
| 3300012200|Ga0137382_11298625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300012201|Ga0137365_11280211 | Not Available | 521 | Open in IMG/M |
| 3300012203|Ga0137399_10918693 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012209|Ga0137379_11301424 | Not Available | 632 | Open in IMG/M |
| 3300012351|Ga0137386_10445400 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300012363|Ga0137390_11146955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300012683|Ga0137398_10102154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1805 | Open in IMG/M |
| 3300012927|Ga0137416_11722939 | Not Available | 572 | Open in IMG/M |
| 3300014489|Ga0182018_10299824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300015374|Ga0132255_103908868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300016294|Ga0182041_11597920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300017948|Ga0187847_10583911 | Not Available | 624 | Open in IMG/M |
| 3300017948|Ga0187847_10847892 | Not Available | 519 | Open in IMG/M |
| 3300017955|Ga0187817_10000212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22789 | Open in IMG/M |
| 3300017970|Ga0187783_10013957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5923 | Open in IMG/M |
| 3300017975|Ga0187782_11478757 | Not Available | 535 | Open in IMG/M |
| 3300017999|Ga0187767_10202265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300018007|Ga0187805_10168316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300018030|Ga0187869_10578518 | Not Available | 532 | Open in IMG/M |
| 3300018043|Ga0187887_10182198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300018062|Ga0187784_10015769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6109 | Open in IMG/M |
| 3300018062|Ga0187784_10373787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1154 | Open in IMG/M |
| 3300019786|Ga0182025_1007262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300019786|Ga0182025_1033830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300020579|Ga0210407_10632480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 833 | Open in IMG/M |
| 3300020581|Ga0210399_11050565 | Not Available | 654 | Open in IMG/M |
| 3300020583|Ga0210401_10183373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1949 | Open in IMG/M |
| 3300021168|Ga0210406_11043851 | Not Available | 605 | Open in IMG/M |
| 3300021170|Ga0210400_10077873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2603 | Open in IMG/M |
| 3300021171|Ga0210405_10328414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
| 3300021402|Ga0210385_11444055 | Not Available | 526 | Open in IMG/M |
| 3300021407|Ga0210383_10731019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300021420|Ga0210394_10207213 | Not Available | 1711 | Open in IMG/M |
| 3300021432|Ga0210384_10775720 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300021433|Ga0210391_11540277 | Not Available | 509 | Open in IMG/M |
| 3300021474|Ga0210390_11123857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300021475|Ga0210392_10547321 | Not Available | 856 | Open in IMG/M |
| 3300021479|Ga0210410_11758829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300021858|Ga0213852_1007683 | Not Available | 559 | Open in IMG/M |
| 3300021858|Ga0213852_1293694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1183 | Open in IMG/M |
| 3300021861|Ga0213853_10493846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 855 | Open in IMG/M |
| 3300021861|Ga0213853_11524649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300024295|Ga0224556_1051158 | Not Available | 1020 | Open in IMG/M |
| 3300025442|Ga0208034_1085154 | Not Available | 560 | Open in IMG/M |
| 3300025922|Ga0207646_10970282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300025939|Ga0207665_10991576 | Not Available | 668 | Open in IMG/M |
| 3300027080|Ga0208237_1067500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300027168|Ga0208239_1022168 | Not Available | 611 | Open in IMG/M |
| 3300027559|Ga0209222_1006365 | Not Available | 2509 | Open in IMG/M |
| 3300027625|Ga0208044_1061442 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300027783|Ga0209448_10243970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300027854|Ga0209517_10120888 | Not Available | 1723 | Open in IMG/M |
| 3300027857|Ga0209166_10066907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 2052 | Open in IMG/M |
| 3300027879|Ga0209169_10605283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300027884|Ga0209275_10243762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Luteimonas → Luteimonas gilva | 984 | Open in IMG/M |
| 3300027986|Ga0209168_10299787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 790 | Open in IMG/M |
| 3300028792|Ga0307504_10369455 | Not Available | 557 | Open in IMG/M |
| 3300028798|Ga0302222_10334536 | Not Available | 590 | Open in IMG/M |
| 3300029636|Ga0222749_10395533 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300029907|Ga0311329_10393267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300029911|Ga0311361_10487945 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300029922|Ga0311363_10953940 | Not Available | 760 | Open in IMG/M |
| 3300029945|Ga0311330_10247134 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300029951|Ga0311371_12438332 | Not Available | 535 | Open in IMG/M |
| 3300029999|Ga0311339_10780975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300030007|Ga0311338_11807912 | Not Available | 550 | Open in IMG/M |
| 3300030044|Ga0302281_10354981 | Not Available | 573 | Open in IMG/M |
| 3300030509|Ga0302183_10220003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300030991|Ga0073994_12381300 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031090|Ga0265760_10272029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 593 | Open in IMG/M |
| 3300031170|Ga0307498_10155684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300031241|Ga0265325_10078331 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300031708|Ga0310686_104130312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Luteimonas → Luteimonas gilva | 949 | Open in IMG/M |
| 3300031715|Ga0307476_10149982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1674 | Open in IMG/M |
| 3300031718|Ga0307474_10482082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300031718|Ga0307474_11235796 | Not Available | 590 | Open in IMG/M |
| 3300031718|Ga0307474_11475969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300031753|Ga0307477_10042183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3135 | Open in IMG/M |
| 3300031754|Ga0307475_10869360 | Not Available | 713 | Open in IMG/M |
| 3300031823|Ga0307478_11630451 | Not Available | 532 | Open in IMG/M |
| 3300031823|Ga0307478_11707800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300031912|Ga0306921_12264418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300031945|Ga0310913_10442946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300032205|Ga0307472_101487132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300032515|Ga0348332_13617870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Luteimonas → Luteimonas gilva | 821 | Open in IMG/M |
| 3300032770|Ga0335085_11030375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 887 | Open in IMG/M |
| 3300032828|Ga0335080_10245335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
| 3300032828|Ga0335080_10414526 | Not Available | 1443 | Open in IMG/M |
| 3300032892|Ga0335081_12071608 | Not Available | 604 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.10% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.10% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.10% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 3.28% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.28% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.46% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.46% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.64% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.64% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.64% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.82% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.82% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.82% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001416 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01246180 | 2199352024 | Soil | MVSLVLIESIRKWFGVLSGKTEARVKESPYVMTRLAEERG |
| JGI12269J14319_100278474 | 3300001356 | Peatlands Soil | MVALVLIESIRQWMGVLSGTRDARVKETPFVMTRLAEGEV* |
| JGI20176J14865_1031861 | 3300001416 | Arctic Peat Soil | MVALVLIESVRQWIGVLSGREEARVKEAPFVMTRLAEERG* |
| Ga0032354_11026611 | 3300003693 | Avena Fatua Rhizosphere | AILVVMVSLVLIESARHWISILSGRSEARVTESPFVPTRLAEDRA* |
| Ga0062384_1001768013 | 3300004082 | Bog Forest Soil | LVFMVTLVLIESTRQWIRVLTGGEAARVKETPFVMTRLAEEQG* |
| Ga0062389_1041827703 | 3300004092 | Bog Forest Soil | MVTLVLIESTRQWIRVLTGGEAARVKETPFVMTRLAEEQG* |
| Ga0062388_1002082691 | 3300004635 | Bog Forest Soil | VLVAMVALVLIESVRQWVGVLSGKKEARAKEAPFVTTRLAKEQA* |
| Ga0062388_1012197671 | 3300004635 | Bog Forest Soil | TGALVVMVALVLVESGRQWWGILSGTREARVKESPFVRTRLVEEQG* |
| Ga0066684_104290261 | 3300005179 | Soil | LDAALTAILVIMVALVLIESVRQWVGVLSGREEARVKEAPFVMTRLAEERG* |
| Ga0066675_107324691 | 3300005187 | Soil | VMVTVIIFESGRQWLGILNGSRAAQLKESPFVVTRLAEERA* |
| Ga0070713_1000114657 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AVVTALLVGMVTLLLIESMRQWLGVLSGRRQALLKEAPFVMTHLAEERV* |
| Ga0070707_1012392061 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TAVLVVMVALVLIESVRQWVAVLSGREEARVKEAPFVMTRLAEEQG* |
| Ga0073909_104657891 | 3300005526 | Surface Soil | LVVMVALVLIESVRQWTGVLTGREDARVKETPFVMTRLAEERG* |
| Ga0066654_107997761 | 3300005587 | Soil | LDAAVTGVLIVMVGLILVESLRQWFGILSGRKEAQTKESPFVVTRMAEERV* |
| Ga0070762_107987553 | 3300005602 | Soil | ALVLIESVRQWIGVLSGREYVRVKESPFVQTRLAEERG* |
| Ga0070763_101123681 | 3300005610 | Soil | VVMVTLVLVESARQWTGILRGTRAAPVKESPFVKTRLLEERG* |
| Ga0070763_103469821 | 3300005610 | Soil | NRLDAALTAVLVVMVALVLIESVRQWIAVLSGRDEARVRETPFVMTRLAEERG* |
| Ga0066696_104534551 | 3300006032 | Soil | ALVLIESVRQWVGVLSGREEARVKEAPFVMTRLAEERG* |
| Ga0075029_1000159526 | 3300006052 | Watersheds | LLLVMVALVLFESARQWVGVISGSKEARVKEAPFVMTRLAEERA* |
| Ga0075014_1004421511 | 3300006174 | Watersheds | LVLFESARQWLGVLSGRKEARVKETPFVMTRLSEERA* |
| Ga0116229_111367971 | 3300009500 | Host-Associated | GILVVMVTLVLIESMRQWIGILSGAREGRVKESPFVRTRFAEERG* |
| Ga0116128_11139041 | 3300009518 | Peatland | TLVLVESARQWIGILTGAREERVKESAFVRTRLAEEEG* |
| Ga0116128_11349673 | 3300009518 | Peatland | LDAAVTAVLVVMVALVLIESVRQWISILSGREEARVKEVPFVMTRLAEDRG* |
| Ga0116225_10290365 | 3300009524 | Peatlands Soil | VVMVALVLIESVRQWIAVLSGREEARVKEAPFVMTRLADERG* |
| Ga0116225_14752061 | 3300009524 | Peatlands Soil | ILVVMVTLVLVESGRQWLGILSGAKEVRVKESPFVRTRFVEEQG* |
| Ga0126373_113828043 | 3300010048 | Tropical Forest Soil | GLVVMVSLVLIESARQWVGILSGRKPARVKEVPFVMTRLAEERL* |
| Ga0126373_114746973 | 3300010048 | Tropical Forest Soil | VLVESARQWIGILSGRKEARVKEVPFVMTRLAEERL* |
| Ga0126378_106826041 | 3300010361 | Tropical Forest Soil | NNRLDAAGTATLLLMVAVVLGESLRHWIHILTGREEARLKEAPFVMTRLAEERI* |
| Ga0126379_138726743 | 3300010366 | Tropical Forest Soil | IDAAVTAALLGMVALVLIESARQWVSVLTGRKEARVKETPFVMTRLTEERA* |
| Ga0136449_1037779583 | 3300010379 | Peatlands Soil | AVTAVLVVMVAMVLIESIRQWMGVLSGTRDGRVKEAPFVMTRLAEGEV* |
| Ga0137382_112986253 | 3300012200 | Vadose Zone Soil | NRLDAAVTGILIAMVTLLLIESVRRWLVVLGGEHDLRSTESPFVATRLAEEQG* |
| Ga0137365_112802112 | 3300012201 | Vadose Zone Soil | LILIESARQWLGILSGKREAQVKESPFVVTRLVEERG* |
| Ga0137399_109186933 | 3300012203 | Vadose Zone Soil | LVMMVTLVLVESVRQWWGILSGAREARVKESPFVRTRLAEEQG* |
| Ga0137379_113014241 | 3300012209 | Vadose Zone Soil | AVVTAVLVVMVALVLIESVRQWAGVLSGREDARVKESPFVMTRLAEERG* |
| Ga0150985_1090150861 | 3300012212 | Avena Fatua Rhizosphere | RLDAVVTGILIVMVALILVESVRQWFGILSGKKEAQTKESPFVVTRLAEERL* |
| Ga0137386_104454001 | 3300012351 | Vadose Zone Soil | MVTLILIESARQWLGILSGKREAQVKESPFVVTRLVEERG* |
| Ga0137390_111469551 | 3300012363 | Vadose Zone Soil | RLDAVVTAVLVVMVALVLIESVRQWVAVLSGREEARVKEAPFVMTRLAEEQG* |
| Ga0137398_101021541 | 3300012683 | Vadose Zone Soil | NRLDAMVTGLLVLMVTLVLVESLRQWMGILSGTREARVKESPFVRTRLAEEQG* |
| Ga0137416_117229392 | 3300012927 | Vadose Zone Soil | VVTGVLVVMVALVLLESSRQWLEILSGKKELRVSESPFVMTQLAEEGQG* |
| Ga0182018_102998241 | 3300014489 | Palsa | TLVLVESGRQWMGVLSGAKEARVKESPFVRTRLVEEQG* |
| Ga0132255_1039088683 | 3300015374 | Arabidopsis Rhizosphere | VALVLIESVRQWAGVLTGREDARVKETPFVMTRLAEERG* |
| Ga0182041_115979203 | 3300016294 | Soil | LLLVMVALVLIESARQWIGVLTGRKEARVKETPFKMTRLAEERA |
| Ga0187847_105839111 | 3300017948 | Peatland | LTAVLVVMVALVLIESVRQWIAVLSGREEARVKESPFVMTRLAEERG |
| Ga0187847_108478921 | 3300017948 | Peatland | LVESARQWMGILSGAREARVKESPFVRTRFAEEQG |
| Ga0187817_1000021219 | 3300017955 | Freshwater Sediment | MVALVLMESVRGWIGVLSGRKEARLKETPFVMTHLLEEQA |
| Ga0187783_100139571 | 3300017970 | Tropical Peatland | GALLLMVAVVLVESLRHWIHILTGREEARLKEAPFVMTRLAEERI |
| Ga0187782_114787571 | 3300017975 | Tropical Peatland | MVAVVLVESLRHWIHILTGREATRLKEAPFVMTRLAEERI |
| Ga0187767_102022653 | 3300017999 | Tropical Peatland | VTLVLIESIRGWVGVISGRREARLQETPFVMTRLAEERA |
| Ga0187805_101683163 | 3300018007 | Freshwater Sediment | LIESLRQWISILRGWEVAPVKEAPFVLTRLTEERA |
| Ga0187869_105785183 | 3300018030 | Peatland | MVTLVLVESVRQWIGILSGAREARVKEAPFVRTRLVEEQG |
| Ga0187887_101821984 | 3300018043 | Peatland | LVLMVALILIESVRQWIGVLSGREEARVKEVPFVMTRLAEERG |
| Ga0187784_100157691 | 3300018062 | Tropical Peatland | ATLLLMVAVVLVESLRHWIHILTGREEARLKEAPFVMTRLAEERI |
| Ga0187784_103737871 | 3300018062 | Tropical Peatland | TATLLLMVAVVLVESLRHWIHILTGREQARLKEAPFVMTRLAEERM |
| Ga0182025_10072621 | 3300019786 | Permafrost | VLVESLRQWMGGILNGAKEARVKESPFVRTRLVEEQG |
| Ga0182025_10338301 | 3300019786 | Permafrost | LQQSIGCVDAAVTGVLVVMVTLVLVESARQWMGILSGTREARVKESPFVRTRLVEEQG |
| Ga0210407_106324801 | 3300020579 | Soil | VALVLIESVRQWIAVLSGTQEVRVKEVPFVMTRLVEERP |
| Ga0210399_110505651 | 3300020581 | Soil | VTLVLVESGRQWWGILSGVKEARVKESPFVRTRLVEEQG |
| Ga0210401_101833735 | 3300020583 | Soil | DAAVTGVLVAMVTLVLFESVRQWLGILLGTKEVRLKESPFVRTRLAMEEQG |
| Ga0210406_110438513 | 3300021168 | Soil | TLVVVESGRQWWGILSGVKEARVKESPFVRTRLVEEQG |
| Ga0210400_100778736 | 3300021170 | Soil | VESGRQWWGILSGTREAPVKEAPFVRTRLVEERLVEERG |
| Ga0210405_103284141 | 3300021171 | Soil | MVTLVLVESGRQWWGILSGTREAPVKEAPFVRTRLVEERLVEERG |
| Ga0210385_114440551 | 3300021402 | Soil | VMVALVLVESARQWIAVLAGRKEARVKESPFVITRLAEERA |
| Ga0210383_107310191 | 3300021407 | Soil | AVLVVMVTLVLIESVRQLNLVLSGREPASVKESPFVKTRLAEDRL |
| Ga0210394_102072133 | 3300021420 | Soil | IVMVTLVLIESARQWWGILSGASEVRVKESPFVRTRLAEERG |
| Ga0210384_107757203 | 3300021432 | Soil | LVLLESVRQWIGVLSGREEARLKEAPFVMTRLAEERG |
| Ga0210391_115402771 | 3300021433 | Soil | VMVTLVLVESVRQWMGILSGAREAQMKEAPFVRTRLAEERG |
| Ga0210390_111238573 | 3300021474 | Soil | AALTAVLVVMVALVLIESVRQWIGVLSGREEARVKETPFVMTRLAEERG |
| Ga0210392_105473211 | 3300021475 | Soil | ILIVMVTLVLIESARQWWGILSGASEVRVKESPFVRTRLAEERG |
| Ga0210410_117588291 | 3300021479 | Soil | VAMVTLVLIESVRQWIGVLSGREDARVKESPFVPTRLAGEQA |
| Ga0213852_10076832 | 3300021858 | Watersheds | VTTVLVVMVALVLIESGRQWLGVLRGSKDARVKEAPFVMTQLAEERG |
| Ga0213852_12936943 | 3300021858 | Watersheds | VIMVAMVLIESARKWIGVLSGREEARVKESPFVMTRLAEEEA |
| Ga0213853_104938461 | 3300021861 | Watersheds | VMVTLVLIESARQWIGVLTGRRESRVRETPFVTTRLSEERA |
| Ga0213853_115246493 | 3300021861 | Watersheds | VLIESARQWIGVLTGRRESRVRETPFVMTRLSEERA |
| Ga0224556_10511584 | 3300024295 | Soil | LVESLRQWWGILSGANEARVKESPFVRTRLVGERG |
| Ga0208034_10851543 | 3300025442 | Peatland | TGVLVVMVTLVLVESARQWVGILTGAREERVKESPFVRTRFAQEQG |
| Ga0207646_109702821 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TAVLVVMVALVLIESVRQWVAVLSGREEARVKEAPFVMTRLAEEQG |
| Ga0207665_109915762 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTALLLVMVALVLIESARQWIGVISGRKEARVKETPFVMTRLGEDHA |
| Ga0208575_10180951 | 3300026920 | Soil | VVIESVRVWVGVLTGKREARIKETPFVATRLVMEEQG |
| Ga0208237_10675003 | 3300027080 | Forest Soil | VLVESGRQWWGILSGTREAPVKEAPFVRTRLVEERLVEERG |
| Ga0208239_10221681 | 3300027168 | Forest Soil | DASLTAVLVVMVALVLIESVRQWIGVLSGREEARVKEAPFVMTRMAEERG |
| Ga0209222_10063653 | 3300027559 | Forest Soil | AVTGILVLMVTLVLLESGRQWLGILRGTREARTKESPFVRTRLVEERG |
| Ga0208044_10614421 | 3300027625 | Peatlands Soil | VVMVALVLIESVRQWIAVLSGREEARVKEAPFVMTRLADERG |
| Ga0209448_102439703 | 3300027783 | Bog Forest Soil | LVVMVALVLIESVRQWIAVLSGTDEVRVKEAPFVMTRLAEERG |
| Ga0209517_101208883 | 3300027854 | Peatlands Soil | MVTLVLVESARQWMGILSGAREARVMESPFVRTRLAEERG |
| Ga0209166_100669071 | 3300027857 | Surface Soil | MGTLVLVESVRQWVGVLTGSREARIIETPFVMTRLVEEKG |
| Ga0209701_103075931 | 3300027862 | Vadose Zone Soil | MVSLVVVESARVWIGVLTGRREARVKETPFVATRLVMEEQ |
| Ga0209169_106052832 | 3300027879 | Soil | DAAMTGILVVMVTLVLLESARQWWGILRGTREARMKESPFVRTRMVEDRG |
| Ga0209275_102437623 | 3300027884 | Soil | VLLESSRQWWGILRGTREAPVKEAPFVRTRLVEERLVEERG |
| Ga0209168_102997873 | 3300027986 | Surface Soil | LVVMVALVLIESVRQWIAVLNGTEEVRVKEVPFVMTRLAEERP |
| Ga0307504_103694553 | 3300028792 | Soil | MVALVLIESARQWLGVLSGRKEARIKETPFVMTRLTEERA |
| Ga0302222_103345363 | 3300028798 | Palsa | GTLVVMVTLVLVESGRQWMGVLSGAKEARVKESPFVRTRLVEEQG |
| Ga0222749_103955333 | 3300029636 | Soil | VAMVTLVLFESVRQWLGILLGTTEVRLKESPFVRTRLAMEEQG |
| Ga0311329_103932673 | 3300029907 | Bog | MVKLVLAESLRQWWGVVSGAREARVKESPFVKTRLAEERG |
| Ga0311361_104879451 | 3300029911 | Bog | VTLVLVESLRQWWGILSGANEARVKESPFVRTRLVGERG |
| Ga0311363_109539404 | 3300029922 | Fen | ILVVMVTLVLVESLRQWWGILSGANEARVKESPFVRTRLVGERG |
| Ga0311330_102471341 | 3300029945 | Bog | DAAVTGILVLMVTLVLAESLRQWWGVVSGAREARVKESPFVKTRLAEERG |
| Ga0311371_124383322 | 3300029951 | Palsa | VTTILVLMVALVLIESVRQWMAVLSGKSESRVKESPFVMTRLAEERV |
| Ga0311339_107809753 | 3300029999 | Palsa | VMVTLILIESGRQWLGILRGTREARVKESPFVRTRLVEERG |
| Ga0311338_118079121 | 3300030007 | Palsa | VTAILVVMVALVLVESVRQWIGVLSGREEARVKESPFVMTRLAEERA |
| Ga0302281_103549811 | 3300030044 | Fen | VLILMVTLVLVESLRQWYGILRGTGETRVKESPFVRTQLAEERG |
| Ga0302183_102200033 | 3300030509 | Palsa | LVLVESLRQWATILSGAREARVKEAPFVKTRLAEGRG |
| Ga0073994_123813001 | 3300030991 | Soil | LDAVVTGVLIVMVTLILVESARQWLGILNGKKEARVKESPFVVTRLVEERG |
| Ga0265760_102720291 | 3300031090 | Soil | IMVTLVLVESVRQWVGILSGAREARVKESPFVRTRFAEERA |
| Ga0307498_101556841 | 3300031170 | Soil | AAVTAILVLMVALVLIESVRQWAGVLTGREDARVKETPFVMTRLAEERG |
| Ga0265325_100783312 | 3300031241 | Rhizosphere | VVTGVLVAMVTLVLIESVRQWIGVLRGREDARVKESPFVATRLAEEQG |
| Ga0310686_1041303122 | 3300031708 | Soil | AVTGVLVVMVALVLVESVRQWFGILRGTREVRVKESPFVRTRLVEEQG |
| Ga0307476_101499822 | 3300031715 | Hardwood Forest Soil | ATAILVVMVALVLIESVRQWIGVLSGREEARVKESPFVMTRLAEERG |
| Ga0307474_104820821 | 3300031718 | Hardwood Forest Soil | ALLVVMVALVLIESVRQWMAVLSGREESRVKEAPFVMTRLAEERG |
| Ga0307474_112357963 | 3300031718 | Hardwood Forest Soil | VTGILVGMVTLVLVESGRQWLGILSGAKEARVKESPFVRTRFVEEQG |
| Ga0307474_114759693 | 3300031718 | Hardwood Forest Soil | VMVALVLTESVRQWIGVLSGREEARVKESPFVMTRLAEERG |
| Ga0307477_100421831 | 3300031753 | Hardwood Forest Soil | VTLVLFESVRQWLGILRGTKEVRLKESPFVRTRLAMEEQG |
| Ga0307475_108693601 | 3300031754 | Hardwood Forest Soil | VVMVTLVLVESLRQWIGILSGAKETRVKESPFVRTRFVGEQG |
| Ga0307478_116304513 | 3300031823 | Hardwood Forest Soil | ILVVMVTLVLFESARQWLGILLGTKEARLKESPFVRTRLAMEEQR |
| Ga0307478_117078001 | 3300031823 | Hardwood Forest Soil | VTAILVVMVALVLIESVRQWIGVLSGREEARVKESPFVMTRLVEERG |
| Ga0306921_122644183 | 3300031912 | Soil | ALVLIESARQWIGVLTGRKEARVKETPFRMTRLAEERA |
| Ga0310913_104429461 | 3300031945 | Soil | MVALVLFESARQWIGVLSGRREAKTKESPLVMTRLAEDRA |
| Ga0307472_1014871321 | 3300032205 | Hardwood Forest Soil | MVALVLIESVRQWAGVLSGREDACVKETPFVMTRLAEERG |
| Ga0348332_136178702 | 3300032515 | Plant Litter | LVLVESVRQWFGILRGTREVRVKESPFVRTRLVEEQG |
| Ga0335085_110303753 | 3300032770 | Soil | LIESARQWIGILTGRRQAIVREAPFTMTRLAEERA |
| Ga0335080_102453354 | 3300032828 | Soil | LVVMVALVLLESGRQWLAILSGRKEARVKETPFVMTRLAEERG |
| Ga0335080_104145261 | 3300032828 | Soil | GLLVMMVGLVLFESIRQWVGVLTGREEARVKEAPFVMTRLAGERA |
| Ga0335081_120716081 | 3300032892 | Soil | LLVMVTLVLIESARHWIGIISGCKAASVKETPFVMTRLTEERA |
| ⦗Top⦘ |