


| Basic Information | |
|---|---|
| Family ID | F071488 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 41 residues |
| Representative Sequence | EAKETAQHALEAANIQGNTTLAQALQGELALYDLGLPYHK |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.44 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.426 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.295 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.869 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.082 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF13414 | TPR_11 | 38.52 |
| PF13432 | TPR_16 | 23.77 |
| PF13424 | TPR_12 | 9.84 |
| PF07719 | TPR_2 | 3.28 |
| PF14559 | TPR_19 | 2.46 |
| PF13431 | TPR_17 | 2.46 |
| PF01658 | Inos-1-P_synth | 0.82 |
| PF13374 | TPR_10 | 0.82 |
| PF07715 | Plug | 0.82 |
| PF00593 | TonB_dep_Rec | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG1260 | Myo-inositol-1-phosphate synthase | Lipid transport and metabolism [I] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.43 % |
| Unclassified | root | N/A | 15.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17345547 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 2805 | Open in IMG/M |
| 2162886012|MBSR1b_contig_5138372 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 926 | Open in IMG/M |
| 2170459002|FZY7DQ102G3QMW | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 528 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100683868 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100850977 | Not Available | 670 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101953121 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101953612 | Not Available | 1971 | Open in IMG/M |
| 3300000955|JGI1027J12803_101734554 | Not Available | 668 | Open in IMG/M |
| 3300003911|JGI25405J52794_10001550 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
| 3300004157|Ga0062590_100385067 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300004479|Ga0062595_100459858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 939 | Open in IMG/M |
| 3300004479|Ga0062595_102543653 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
| 3300005290|Ga0065712_10480053 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005332|Ga0066388_100737466 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1587 | Open in IMG/M |
| 3300005332|Ga0066388_104531643 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005340|Ga0070689_101460318 | Not Available | 619 | Open in IMG/M |
| 3300005354|Ga0070675_100732857 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300005518|Ga0070699_100649199 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 963 | Open in IMG/M |
| 3300005535|Ga0070684_101386503 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005548|Ga0070665_101191935 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005555|Ga0066692_10106854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 1668 | Open in IMG/M |
| 3300005568|Ga0066703_10086641 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1821 | Open in IMG/M |
| 3300006032|Ga0066696_10417764 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300006032|Ga0066696_10674106 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300006175|Ga0070712_100642860 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300006791|Ga0066653_10597885 | Not Available | 560 | Open in IMG/M |
| 3300006794|Ga0066658_10596339 | Not Available | 602 | Open in IMG/M |
| 3300006796|Ga0066665_10382682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1157 | Open in IMG/M |
| 3300006854|Ga0075425_102312427 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 597 | Open in IMG/M |
| 3300006903|Ga0075426_10494762 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300007255|Ga0099791_10107502 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1287 | Open in IMG/M |
| 3300007788|Ga0099795_10146300 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300009100|Ga0075418_10513366 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300009147|Ga0114129_12413825 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 630 | Open in IMG/M |
| 3300009156|Ga0111538_13363661 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 556 | Open in IMG/M |
| 3300009177|Ga0105248_12624730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 574 | Open in IMG/M |
| 3300009545|Ga0105237_11285474 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300010047|Ga0126382_10299183 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1207 | Open in IMG/M |
| 3300010047|Ga0126382_10570948 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300010048|Ga0126373_11648414 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300010325|Ga0134064_10133202 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010358|Ga0126370_10636644 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300010359|Ga0126376_10225250 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300010360|Ga0126372_10812148 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300010360|Ga0126372_11948258 | Not Available | 633 | Open in IMG/M |
| 3300010361|Ga0126378_10900775 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300010361|Ga0126378_12138118 | Not Available | 638 | Open in IMG/M |
| 3300010362|Ga0126377_10747695 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300010362|Ga0126377_10867356 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300010371|Ga0134125_12672817 | Not Available | 543 | Open in IMG/M |
| 3300010396|Ga0134126_12078788 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 620 | Open in IMG/M |
| 3300010398|Ga0126383_10290427 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1627 | Open in IMG/M |
| 3300010868|Ga0124844_1012525 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
| 3300010868|Ga0124844_1012607 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
| 3300011444|Ga0137463_1302418 | Not Available | 585 | Open in IMG/M |
| 3300012198|Ga0137364_10609220 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300012205|Ga0137362_10839387 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 786 | Open in IMG/M |
| 3300012205|Ga0137362_11384809 | Not Available | 589 | Open in IMG/M |
| 3300012285|Ga0137370_10126654 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300012363|Ga0137390_10214568 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1911 | Open in IMG/M |
| 3300012363|Ga0137390_11370798 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012532|Ga0137373_10665508 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300012683|Ga0137398_10292493 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1093 | Open in IMG/M |
| 3300012892|Ga0157294_10108522 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012917|Ga0137395_11073295 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012944|Ga0137410_10484708 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012948|Ga0126375_11837938 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012951|Ga0164300_11054839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 527 | Open in IMG/M |
| 3300012971|Ga0126369_11449502 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 776 | Open in IMG/M |
| 3300012984|Ga0164309_10575325 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 875 | Open in IMG/M |
| 3300012989|Ga0164305_10135698 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1646 | Open in IMG/M |
| 3300013296|Ga0157374_10704163 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300014166|Ga0134079_10020213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2142 | Open in IMG/M |
| 3300014497|Ga0182008_10323232 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300014497|Ga0182008_10599943 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300015245|Ga0137409_10019095 | All Organisms → cellular organisms → Bacteria | 6775 | Open in IMG/M |
| 3300015372|Ga0132256_101478122 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300015372|Ga0132256_102981533 | Not Available | 569 | Open in IMG/M |
| 3300015374|Ga0132255_102833513 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300015374|Ga0132255_103585292 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300015374|Ga0132255_104139620 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300016445|Ga0182038_11661048 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017657|Ga0134074_1355777 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300017659|Ga0134083_10113754 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300018028|Ga0184608_10374391 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300018056|Ga0184623_10194793 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300018072|Ga0184635_10071392 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300018081|Ga0184625_10105628 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300018482|Ga0066669_11431141 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300019867|Ga0193704_1016106 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300019885|Ga0193747_1005275 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
| 3300019885|Ga0193747_1095904 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 721 | Open in IMG/M |
| 3300020005|Ga0193697_1093451 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300020059|Ga0193745_1109855 | Not Available | 581 | Open in IMG/M |
| 3300021344|Ga0193719_10347224 | Not Available | 617 | Open in IMG/M |
| 3300022534|Ga0224452_1106289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 859 | Open in IMG/M |
| 3300025315|Ga0207697_10448861 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025909|Ga0207705_10964815 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300025915|Ga0207693_11224097 | Not Available | 565 | Open in IMG/M |
| 3300025916|Ga0207663_10896033 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300025925|Ga0207650_10646601 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300025930|Ga0207701_10282227 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300026023|Ga0207677_10375300 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300026023|Ga0207677_11416048 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300026324|Ga0209470_1207534 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300026330|Ga0209473_1272973 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027655|Ga0209388_1218265 | Not Available | 524 | Open in IMG/M |
| 3300027903|Ga0209488_10156899 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1719 | Open in IMG/M |
| 3300028810|Ga0307294_10061964 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300028824|Ga0307310_10628576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 548 | Open in IMG/M |
| 3300028875|Ga0307289_10103863 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300030916|Ga0075386_12158328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 562 | Open in IMG/M |
| 3300030916|Ga0075386_12232730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 958 | Open in IMG/M |
| 3300031446|Ga0170820_13999860 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031446|Ga0170820_15348994 | Not Available | 508 | Open in IMG/M |
| 3300031474|Ga0170818_107135891 | Not Available | 1517 | Open in IMG/M |
| 3300031562|Ga0310886_10320605 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300031744|Ga0306918_10780475 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300031847|Ga0310907_10562538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 617 | Open in IMG/M |
| 3300031912|Ga0306921_11471144 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300031946|Ga0310910_11200576 | Not Available | 588 | Open in IMG/M |
| 3300031954|Ga0306926_10229167 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.10% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.46% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.64% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.82% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02536700 | 2088090014 | Soil | AGRFVEAKKTAEQALQAAEIQGNSTLSSALRDEISLYDLGLPYHKELK |
| MBSR1b_0237.00007990 | 2162886012 | Miscanthus Rhizosphere | AQHALEAANIEGNTTLSNALRDEIALYELGLPYHKEAR |
| E1_04543940 | 2170459002 | Grass Soil | GIRRDRPVVEAKKTAEQALQAAQIQGNSALSSALRDEISLYDLGLPYHKEAR |
| INPhiseqgaiiFebDRAFT_1006838682 | 3300000364 | Soil | AQRALQSANIEGNSELAGSLRDEMSLYELGLPNRRQER* |
| INPhiseqgaiiFebDRAFT_1008509772 | 3300000364 | Soil | QFAEAKDTAQHALEAANVQGNTNLVDALQGELALYDLGLPYHK* |
| INPhiseqgaiiFebDRAFT_1019531211 | 3300000364 | Soil | KKTAEQALQAAQIQGNSTLSGALRDEISLYDLGLPYHKELK* |
| INPhiseqgaiiFebDRAFT_1019536122 | 3300000364 | Soil | QALQKAEIQGNSTLSGALRDEISLYDLGLPYHKELR* |
| JGI1027J12803_1017345542 | 3300000955 | Soil | KTAEQALQTAEIQGNSVLSGVLRDEISLYDLGLPYHKELK* |
| JGI25405J52794_100015503 | 3300003911 | Tabebuia Heterophylla Rhizosphere | RFPEAQGAARRALQIAEIRGDSTLANALRDEVALYELGLPNHK* |
| Ga0062590_1003850671 | 3300004157 | Soil | EAKETAQHALEAANIQGNTTLANALRDEIALYDLGLPYHK* |
| Ga0062595_1004598581 | 3300004479 | Soil | EAKETAQHALEAANIQGNTTLADALRDEIALYELDLPYHKEAR* |
| Ga0062595_1025436531 | 3300004479 | Soil | VGQFGEAKETAQHALEAANIQGNTTLSNALRDEIALYELGLPYRKDER* |
| Ga0065712_104800532 | 3300005290 | Miscanthus Rhizosphere | AGQFAEAKETAQHALEAANIQGNTPLAEALQGELALYDLGLPYHK* |
| Ga0066388_1007374662 | 3300005332 | Tropical Forest Soil | FAEAKETAQKALETANAQGNTVLAGDLQGELALYELGLPCHK* |
| Ga0066388_1045316432 | 3300005332 | Tropical Forest Soil | AEAKDTAQQALKAANIQGNTNLADALQGELALYDLGLPYHK* |
| Ga0070689_1014603182 | 3300005340 | Switchgrass Rhizosphere | GQYSEAKETAQHALEAAKIQGNTTLADALQGELALYDLGLPYHK* |
| Ga0070675_1007328572 | 3300005354 | Miscanthus Rhizosphere | AGQFAEAKETAQQALKAANIQGNTTLADALQGELALYDLGLPYHK* |
| Ga0070699_1006491992 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GRFADAKETAEQALRAAKVEGNASLADALQGELALYDLGLPYHK* |
| Ga0070684_1013865032 | 3300005535 | Corn Rhizosphere | KKTAEQALEAAETQGNSSLSSALRNEISLYELGLPYHKQAR* |
| Ga0070665_1011919352 | 3300005548 | Switchgrass Rhizosphere | AQHALEAANIQGNTNLAEALQGELALYDLGLPYHK* |
| Ga0066692_101068542 | 3300005555 | Soil | EAKGTAEQALQAAEVQGNSALSNALRDELALYELGLPYHK* |
| Ga0066703_100866411 | 3300005568 | Soil | RFADAKETAQQALQAAMVEGNASLADALQGELALYDLGLPYHK* |
| Ga0066696_104177642 | 3300006032 | Soil | EAKETARHAMEAANVQGNTYLADALRGELALYDLGLPYHK* |
| Ga0066696_106741062 | 3300006032 | Soil | GQFAEAKETAQHALEAANIQGNTTLADALQGELALYDLGFPYHK* |
| Ga0070712_1006428601 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KTAEQALQAAQIQGNSTLSSALRDEISLYDLGLPYHKEAR* |
| Ga0066653_105978851 | 3300006791 | Soil | ETAHHALEAANIQGNTSLAEALQGELALYDLGLPYHK* |
| Ga0066658_105963392 | 3300006794 | Soil | QRALQSANVQGNSELADSLRDEIALYELGLPYRRQER* |
| Ga0066665_103826822 | 3300006796 | Soil | KETAQHALEAANIQGNTTLADALQGELALYDLGFPYHK* |
| Ga0075425_1023124272 | 3300006854 | Populus Rhizosphere | AKETAEQALQAAEIQGNPSLSDALRDEIALYELGLPYHKQTR* |
| Ga0075426_104947621 | 3300006903 | Populus Rhizosphere | ALQSANVQGNSELADSLRDEIGLYELGLPYRRQER* |
| Ga0099791_101075021 | 3300007255 | Vadose Zone Soil | ALQTSEIQGNSTLSGALRDEIALYELGLPYHKEAR* |
| Ga0099795_101463002 | 3300007788 | Vadose Zone Soil | AEAKETAQHALEAANIQGNTSLAEALQGELALYDLGLPYHQ* |
| Ga0075418_105133662 | 3300009100 | Populus Rhizosphere | GQFAEAKETAQQALKAANIQGNTTLADALQGELALYDLGLPYHK* |
| Ga0114129_124138251 | 3300009147 | Populus Rhizosphere | AEARETAQRALQAVEIQGNATLANTLQDEIALYELGLPYHR* |
| Ga0111538_133636612 | 3300009156 | Populus Rhizosphere | QRALQAVEIQGNATLANTLQDEIALYELGLPYHR* |
| Ga0105248_126247302 | 3300009177 | Switchgrass Rhizosphere | AEQALRAAQIEGNSTLSSALRDEISLYDLGLPYHKETR* |
| Ga0105237_112854741 | 3300009545 | Corn Rhizosphere | AESARRAWQAAQTQGNSTLANALRDEIALYELGLPYHK* |
| Ga0126382_102991831 | 3300010047 | Tropical Forest Soil | GQFVEAKETAQQALQAAKVQGNTTLADALQGELALYDLGLPYHK* |
| Ga0126382_105709481 | 3300010047 | Tropical Forest Soil | KETAQQAMQEAEKQGDSSLSSTLRDEIALYELALPYHKEQ* |
| Ga0126373_116484142 | 3300010048 | Tropical Forest Soil | QFAEAKDTAQQALKAANVQGNTNLADALQGELALYDLGLPYHK* |
| Ga0134064_101332021 | 3300010325 | Grasslands Soil | SEQAVRIAGTEGKSDLANALRDEIALYELGLPYHK* |
| Ga0126370_106366442 | 3300010358 | Tropical Forest Soil | AQKALETANAQGNTVLAGDLQGELALYELGLPCHK* |
| Ga0126376_102252501 | 3300010359 | Tropical Forest Soil | TAQQALKAANVQGNTNLADALQGELALYDLGLPYHK* |
| Ga0126372_108121481 | 3300010360 | Tropical Forest Soil | AEAKETAQQALQAANVQGNTTLADALQGELALYDLGLPYHK* |
| Ga0126372_119482582 | 3300010360 | Tropical Forest Soil | QFAEAKETAQHALEAANIQGNTTLADALQGELALYDLGLPYHK* |
| Ga0126378_109007751 | 3300010361 | Tropical Forest Soil | KTAQNALQAANMQGNTVLADSLQSDLALYDLGLPFHK* |
| Ga0126378_121381181 | 3300010361 | Tropical Forest Soil | AEAGRFAEAKETAQHALEAANIQGNTTLADALQGELALYDLGLPYHK* |
| Ga0126377_107476952 | 3300010362 | Tropical Forest Soil | GQFAQAKETAQQALAASNVQGNSTLSGALRDEIALYELGLPYRNTPR* |
| Ga0126377_108673562 | 3300010362 | Tropical Forest Soil | KETARQALKAANVQGNTNLADALQGELALYDLGLPYHK* |
| Ga0134125_126728171 | 3300010371 | Terrestrial Soil | ETAQHALDAANIQGNTTLAEALQGELALYDLGLPYHK* |
| Ga0134126_120787882 | 3300010396 | Terrestrial Soil | LEAANIQGNTTLSNALRDEIALYELGLPYRNNAK* |
| Ga0126383_102904271 | 3300010398 | Tropical Forest Soil | EDSRFADAKETAQRALQAAKVEGNASLAEALQAELALYDLGLPYHK* |
| Ga0124844_10125252 | 3300010868 | Tropical Forest Soil | EAKETAQQALKEAEIQGNSTLSDPVRDEIALYELGLPYHK* |
| Ga0124844_10126072 | 3300010868 | Tropical Forest Soil | AKETAQQALKEAEIQGNSTLSDPVRDEIALYELGLPYHK* |
| Ga0137463_13024182 | 3300011444 | Soil | EAKETAQHALEVANIQGNTTLVEALQGELTLYDLGLPYHQ* |
| Ga0137364_106092201 | 3300012198 | Vadose Zone Soil | KETARQALQEAETRGNSTLANALRDEIALYELALPYHKEQ* |
| Ga0137362_108393871 | 3300012205 | Vadose Zone Soil | TARRALQAAEIRNNSTLANALRDEIALYELDLPFHK* |
| Ga0137362_113848092 | 3300012205 | Vadose Zone Soil | EAKETAQHALEAANIQGNTSLAEALQGELALYDLGLPYHK* |
| Ga0137370_101266541 | 3300012285 | Vadose Zone Soil | AEAGQFPEAKETAHQALEAANLQGNTALAEALQGELALYDLGLPYHK* |
| Ga0137390_102145682 | 3300012363 | Vadose Zone Soil | AEAKETAQHALEAANIQGNTTLADALQGELALYDLGFPYHK* |
| Ga0137390_113707981 | 3300012363 | Vadose Zone Soil | RFIEAKKTAEQALQKAEIQGNSTLSGALRDEISLYELGLPYHKEAR* |
| Ga0137373_106655081 | 3300012532 | Vadose Zone Soil | TAEQALQAAEIQGKSTLSNALRDEISLYELGLPYHKEAK* |
| Ga0137398_102924932 | 3300012683 | Vadose Zone Soil | ETGRFVDAKKTAEEALQAAEMQGNSTLFSALRSEISLYELGLPYHK* |
| Ga0157294_101085221 | 3300012892 | Soil | EAKETAQHALEAANIQGNTPLAEALQGELALYDLGLPYHK* |
| Ga0137395_110732951 | 3300012917 | Vadose Zone Soil | QHALEAANIQGNSTLADALQGELALYDLGLPFHK* |
| Ga0137410_104847081 | 3300012944 | Vadose Zone Soil | QFAEAKETAQHALEAANIQGNTSLADALQGELALYDLGLPYHK* |
| Ga0126375_118379382 | 3300012948 | Tropical Forest Soil | AKKTAQQALQAANVQGNTTLADALQGELALYDLGLPYHK* |
| Ga0164300_110548391 | 3300012951 | Soil | EQALQKAEIQGNSTLSGALRDEISLYDLGLPYHKETR* |
| Ga0126369_114495021 | 3300012971 | Tropical Forest Soil | QHALEAANIQGNTTLADALQGELALYDLGLPYHK* |
| Ga0164309_105753252 | 3300012984 | Soil | TAQHALEAANIQGNTTLSNALRDEIALYELGLPYHKEAR* |
| Ga0164305_101356982 | 3300012989 | Soil | AKETAQHALEAANIQGNTTLSNALRDEIALYELGLPYHKEAR* |
| Ga0157374_107041631 | 3300013296 | Miscanthus Rhizosphere | GQYSEAKETAQHALEAANIQGNTTLADALQGELALYDLGLPYHK* |
| Ga0134079_100202132 | 3300014166 | Grasslands Soil | ARNGLQAANMQGNTGLADALQSDLALYDLGLPFHK* |
| Ga0182008_103232321 | 3300014497 | Rhizosphere | ETAQHALDAANVQGNTTLAEALQDELALYDLGLPYHK* |
| Ga0182008_105999431 | 3300014497 | Rhizosphere | AKETAQNGLQAANMQGNTALADALQSDLALYDLGLPFHK* |
| Ga0137409_100190954 | 3300015245 | Vadose Zone Soil | AQHALEAANIQGNTTLAKALQGELTLYDLGLPYHQ* |
| Ga0132256_1014781222 | 3300015372 | Arabidopsis Rhizosphere | FVEAKKTAEQALQAAEIQENSTLSSALRDEISLYELGLPYHKQGR* |
| Ga0132256_1029815331 | 3300015372 | Arabidopsis Rhizosphere | ETAKHALEAANIQGNTTLAEGLQGGLVLYELGLPYHK* |
| Ga0132255_1028335131 | 3300015374 | Arabidopsis Rhizosphere | FAKAKETAQHALEAANIQGNTTLVDALQGELALYDLGLPYHK* |
| Ga0132255_1035852922 | 3300015374 | Arabidopsis Rhizosphere | QQALEAANIQGNTTLADALQGELALYDLGLPCHK* |
| Ga0132255_1041396202 | 3300015374 | Arabidopsis Rhizosphere | KETAQKALETANIQGNTVLADELQGELALYELGLPYRK* |
| Ga0182038_116610482 | 3300016445 | Soil | YAEAGQFPEAKKTAQKALQAANMQGNTVLADALQNDLALYDLGLPFHK |
| Ga0134074_13557772 | 3300017657 | Grasslands Soil | EAGQFAEAKETAQNALQAAKIQGNTALADALESDLALYDLGLPFHK |
| Ga0134083_101137541 | 3300017659 | Grasslands Soil | RQTAQQALQAAEIQGNSTLSNTLRDEITLYELGLPYHKEQ |
| Ga0184608_103743912 | 3300018028 | Groundwater Sediment | AEQALQAAEIQGNSTLSSALRDEISLYELGLPYHKQGR |
| Ga0184623_101947931 | 3300018056 | Groundwater Sediment | AEAGQLSEAKETAQHALEAANIQGNTSLAEALQGELALYDLGLPYHK |
| Ga0184635_100713921 | 3300018072 | Groundwater Sediment | AGQFAEAKETAQHALEAANIQGNTTLANTLRDEIALYELGLPYHK |
| Ga0184625_101056282 | 3300018081 | Groundwater Sediment | AQHALEAANIQGNTTLVNTLRDEIALYELGLPYHK |
| Ga0066669_114311411 | 3300018482 | Grasslands Soil | FAAAKETARNGLQAANMQGNTALADALQSDLALYDLGLPFHK |
| Ga0193704_10161062 | 3300019867 | Soil | EAKETAQHALEAANIEGNTTLANALQGELALYDLGLPYHK |
| Ga0193747_10052751 | 3300019885 | Soil | KETAQRALQVAQVQGNSTLANAIRDEIALYELALPYHK |
| Ga0193747_10959042 | 3300019885 | Soil | EAKETAQHALEAANIQGNTTLSNALRDEIALYELGLPYHKEAR |
| Ga0193697_10934512 | 3300020005 | Soil | FAEAKETAQQALQAAEIQGDSNLSNALRDEIALYELGLPYHKETR |
| Ga0193745_11098552 | 3300020059 | Soil | AKETAQHALEAANIEGNTTLANALQGELALYDLGLPYHK |
| Ga0193719_103472242 | 3300021344 | Soil | QFTEAKETAQHALEAANIQGNTTLAEALQGELALYDLGLPYHK |
| Ga0224452_11062892 | 3300022534 | Groundwater Sediment | TAQQALQAAEIEGNSTLANALQDEIALYELGLPYHK |
| Ga0207697_104488612 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | TAQQAMQEAEKQGDSSLSSTLRDEMALYELALPYHKEQ |
| Ga0207705_109648151 | 3300025909 | Corn Rhizosphere | AKETAQHALEAANIQGNTPLAEALQGELALYDLGLPYHK |
| Ga0207693_112240971 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EAKETAQHALEAANIQGNTTLAEALQSELALYDLGLPYRK |
| Ga0207663_108960332 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AEAKETAQNALQAANMQGNTALADALQSDLALYDLGLPFHK |
| Ga0207650_106466011 | 3300025925 | Switchgrass Rhizosphere | TAQHALEAANIQGNTTLADALQGELALYDLGLPYHK |
| Ga0207701_102822271 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | HALEAANIQGNTTLSNALRDEIALYELGLPYRKDGR |
| Ga0207677_103753001 | 3300026023 | Miscanthus Rhizosphere | GQYSEAKETAQHALEAANIQGNTTLADALQGELALYDLGLPYHK |
| Ga0207677_114160482 | 3300026023 | Miscanthus Rhizosphere | ETAQHALEASNLQDNTTLSNALRDEIALYELGLPYRNTAR |
| Ga0209470_12075342 | 3300026324 | Soil | EAKETAHHALEAANIQGNTTLADALQGELALYDLGFPYHK |
| Ga0209473_12729731 | 3300026330 | Soil | KETAHHALEAANIQGNTSLAEALQGELALYDLGFSYHK |
| Ga0209388_12182651 | 3300027655 | Vadose Zone Soil | AEEGQFTEAKETAQHALEAANIQGNTTLAEALQGELALYDLGLPYHQ |
| Ga0209488_101568992 | 3300027903 | Vadose Zone Soil | EHALEAANIQGNTTLSNALRDEIALYELGLPYHKEAR |
| Ga0307294_100619641 | 3300028810 | Soil | EAGQFAEAKETAQHALEAANIEGNTTLANALQGELALYDLGLPYHK |
| Ga0307310_106285762 | 3300028824 | Soil | EAGQYAEAKETAQHALEAANIQGNTTLAEALQGELALYDLGLPYHK |
| Ga0307289_101038631 | 3300028875 | Soil | YAEVGQFSEAKETAQHALEAANIQGNTSLAEALQGELALYDLGLPYHK |
| Ga0075386_121583282 | 3300030916 | Soil | QALQAAEIQGNSTLSNALRDEISLYELGLPYHKEAK |
| Ga0075386_122327302 | 3300030916 | Soil | ARQALQVAEIRGNSTLANALRDEIALYELGLPYHNDTK |
| Ga0170820_139998602 | 3300031446 | Forest Soil | AKETAQHALEAANIQGNTTLSNALRDEIALYELGLPYHTEAR |
| Ga0170820_153489941 | 3300031446 | Forest Soil | QFAEAKETAQRALEAANIQGNTALAEALQSELALYDLGLPYRK |
| Ga0170818_1071358911 | 3300031474 | Forest Soil | KKTAEQALQAAEIQGNSTLSSALRDEISLYDLGLPYHKELK |
| Ga0310886_103206051 | 3300031562 | Soil | EAKETAQHALEAANIQGNTTLAQALQGELALYDLGLPYHK |
| Ga0306918_107804751 | 3300031744 | Soil | EAGRFAEAKETAQHALEAANIQGNTTLADALQGELALYDLGLPYHK |
| Ga0310907_105625382 | 3300031847 | Soil | TAQHALEAANIQGNTTLSNALRDEIALYELGLPYRNNAK |
| Ga0306921_114711441 | 3300031912 | Soil | GQFAEAKETAQHALEAANIQGNTTLADALQGELALYDLGLPYHK |
| Ga0310910_112005762 | 3300031946 | Soil | AGRFAEAKETAQHALEAANIQGNTTLADALQGELALYDLGLPYHK |
| Ga0306926_102291671 | 3300031954 | Soil | KETAQQALQEAEKQGDSSLSSTLRDEIALYELALPYHKEQ |
| ⦗Top⦘ |