


| Basic Information | |
|---|---|
| Family ID | F071412 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MADLNAKKREKLPAKDFGLPEKARTKEAKKESGNYPMPDK |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.70 % |
| % of genes near scaffold ends (potentially truncated) | 97.54 % |
| % of genes from short scaffolds (< 2000 bps) | 95.08 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.393 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.852 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.869 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF13396 | PLDc_N | 4.92 |
| PF08327 | AHSA1 | 4.92 |
| PF05532 | CsbD | 2.46 |
| PF13561 | adh_short_C2 | 1.64 |
| PF08028 | Acyl-CoA_dh_2 | 1.64 |
| PF00903 | Glyoxalase | 1.64 |
| PF01243 | Putative_PNPOx | 1.64 |
| PF02771 | Acyl-CoA_dh_N | 1.64 |
| PF00378 | ECH_1 | 1.64 |
| PF00067 | p450 | 1.64 |
| PF00248 | Aldo_ket_red | 1.64 |
| PF13673 | Acetyltransf_10 | 1.64 |
| PF12681 | Glyoxalase_2 | 1.64 |
| PF01872 | RibD_C | 1.64 |
| PF03631 | Virul_fac_BrkB | 0.82 |
| PF01904 | DUF72 | 0.82 |
| PF13452 | MaoC_dehydrat_N | 0.82 |
| PF02517 | Rce1-like | 0.82 |
| PF00999 | Na_H_Exchanger | 0.82 |
| PF00753 | Lactamase_B | 0.82 |
| PF00376 | MerR | 0.82 |
| PF13378 | MR_MLE_C | 0.82 |
| PF10604 | Polyketide_cyc2 | 0.82 |
| PF01906 | YbjQ_1 | 0.82 |
| PF12833 | HTH_18 | 0.82 |
| PF00717 | Peptidase_S24 | 0.82 |
| PF02627 | CMD | 0.82 |
| PF00201 | UDPGT | 0.82 |
| PF00873 | ACR_tran | 0.82 |
| PF03950 | tRNA-synt_1c_C | 0.82 |
| PF01292 | Ni_hydr_CYTB | 0.82 |
| PF04122 | CW_binding_2 | 0.82 |
| PF00583 | Acetyltransf_1 | 0.82 |
| PF05222 | AlaDh_PNT_N | 0.82 |
| PF08281 | Sigma70_r4_2 | 0.82 |
| PF01738 | DLH | 0.82 |
| PF00909 | Ammonium_transp | 0.82 |
| PF07650 | KH_2 | 0.82 |
| PF02720 | DUF222 | 0.82 |
| PF13466 | STAS_2 | 0.82 |
| PF13280 | WYL | 0.82 |
| PF04072 | LCM | 0.82 |
| PF08450 | SGL | 0.82 |
| PF03992 | ABM | 0.82 |
| PF13581 | HATPase_c_2 | 0.82 |
| PF00005 | ABC_tran | 0.82 |
| PF07987 | DUF1775 | 0.82 |
| PF01895 | PhoU | 0.82 |
| PF01212 | Beta_elim_lyase | 0.82 |
| PF03764 | EFG_IV | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 3.28 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 2.46 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.64 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.64 |
| COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 1.64 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.64 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.64 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.82 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.82 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.82 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.82 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.82 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.82 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.82 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.82 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.82 |
| COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.82 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.82 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.82 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.82 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.82 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.82 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.82 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.82 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.82 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.82 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.82 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.82 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.82 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.82 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.82 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.82 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.82 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.82 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.82 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.82 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.82 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.82 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.82 |
| COG4549 | Uncharacterized conserved protein YcnI, contains cohesin/reeler-like domain | Function unknown [S] | 0.82 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.82 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.03 % |
| Unclassified | root | N/A | 31.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02GED6A | Not Available | 508 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101634477 | Not Available | 542 | Open in IMG/M |
| 3300000956|JGI10216J12902_100041524 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300000956|JGI10216J12902_102868477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300000956|JGI10216J12902_106235938 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300000956|JGI10216J12902_107184239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300000956|JGI10216J12902_111160744 | Not Available | 1149 | Open in IMG/M |
| 3300001870|JGI24129J20441_1070503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 696 | Open in IMG/M |
| 3300004156|Ga0062589_100054340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2267 | Open in IMG/M |
| 3300004157|Ga0062590_100892890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 831 | Open in IMG/M |
| 3300004463|Ga0063356_103693953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 659 | Open in IMG/M |
| 3300004479|Ga0062595_100002369 | All Organisms → cellular organisms → Bacteria | 4660 | Open in IMG/M |
| 3300004480|Ga0062592_100874083 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300004480|Ga0062592_101987013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 574 | Open in IMG/M |
| 3300004480|Ga0062592_102527710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 517 | Open in IMG/M |
| 3300005180|Ga0066685_10154763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1561 | Open in IMG/M |
| 3300005329|Ga0070683_100481219 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1185 | Open in IMG/M |
| 3300005367|Ga0070667_100559100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1052 | Open in IMG/M |
| 3300005367|Ga0070667_101630455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
| 3300005616|Ga0068852_101945947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300005618|Ga0068864_102184734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300006049|Ga0075417_10246951 | Not Available | 855 | Open in IMG/M |
| 3300006178|Ga0075367_10953577 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006353|Ga0075370_10923077 | Not Available | 534 | Open in IMG/M |
| 3300006358|Ga0068871_100979658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella | 787 | Open in IMG/M |
| 3300006806|Ga0079220_10536601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
| 3300006852|Ga0075433_11740464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300006853|Ga0075420_101075338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
| 3300006918|Ga0079216_11134101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 621 | Open in IMG/M |
| 3300006969|Ga0075419_10727769 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300007004|Ga0079218_11411968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 745 | Open in IMG/M |
| 3300007004|Ga0079218_13679943 | Not Available | 521 | Open in IMG/M |
| 3300009029|Ga0066793_10695028 | Not Available | 578 | Open in IMG/M |
| 3300009094|Ga0111539_10414008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1570 | Open in IMG/M |
| 3300009098|Ga0105245_12813033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300009100|Ga0075418_12744400 | Not Available | 538 | Open in IMG/M |
| 3300009101|Ga0105247_10678822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 773 | Open in IMG/M |
| 3300009148|Ga0105243_10837276 | Not Available | 910 | Open in IMG/M |
| 3300009148|Ga0105243_11953188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 620 | Open in IMG/M |
| 3300009156|Ga0111538_12330701 | Not Available | 672 | Open in IMG/M |
| 3300009176|Ga0105242_10144229 | Not Available | 2070 | Open in IMG/M |
| 3300009789|Ga0126307_10109198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2197 | Open in IMG/M |
| 3300009789|Ga0126307_11392164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae | 568 | Open in IMG/M |
| 3300010036|Ga0126305_10402750 | Not Available | 902 | Open in IMG/M |
| 3300010397|Ga0134124_12413720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces alboflavus | 567 | Open in IMG/M |
| 3300011119|Ga0105246_10502309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300011119|Ga0105246_11157741 | Not Available | 709 | Open in IMG/M |
| 3300012045|Ga0136623_10394795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
| 3300012046|Ga0136634_10362354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300012092|Ga0136621_1060487 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300012093|Ga0136632_10249353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 804 | Open in IMG/M |
| 3300012094|Ga0136638_10526507 | Not Available | 564 | Open in IMG/M |
| 3300012530|Ga0136635_10059279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
| 3300012680|Ga0136612_10224890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 954 | Open in IMG/M |
| 3300012681|Ga0136613_10801920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300012900|Ga0157292_10156268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
| 3300012951|Ga0164300_10645064 | Not Available | 632 | Open in IMG/M |
| 3300012958|Ga0164299_10726281 | Not Available | 698 | Open in IMG/M |
| 3300012984|Ga0164309_10322246 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300012984|Ga0164309_10387689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1038 | Open in IMG/M |
| 3300013297|Ga0157378_12328285 | Not Available | 587 | Open in IMG/M |
| 3300013297|Ga0157378_12572707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300013297|Ga0157378_12943839 | Not Available | 528 | Open in IMG/M |
| 3300014052|Ga0120109_1157894 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300014054|Ga0120135_1019558 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300014325|Ga0163163_10445788 | Not Available | 1354 | Open in IMG/M |
| 3300014325|Ga0163163_11418560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 756 | Open in IMG/M |
| 3300014325|Ga0163163_11929051 | Not Available | 651 | Open in IMG/M |
| 3300014326|Ga0157380_12370255 | Not Available | 596 | Open in IMG/M |
| 3300015200|Ga0173480_10240644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 981 | Open in IMG/M |
| 3300015372|Ga0132256_100131363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2486 | Open in IMG/M |
| 3300015372|Ga0132256_100383754 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300015372|Ga0132256_100656748 | Not Available | 1164 | Open in IMG/M |
| 3300015372|Ga0132256_101047388 | Not Available | 931 | Open in IMG/M |
| 3300015372|Ga0132256_102771138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 589 | Open in IMG/M |
| 3300015373|Ga0132257_103803950 | Not Available | 549 | Open in IMG/M |
| 3300015373|Ga0132257_104464864 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Kuenenia → Candidatus Kuenenia stuttgartiensis | 509 | Open in IMG/M |
| 3300015374|Ga0132255_100940590 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300015374|Ga0132255_102066147 | Not Available | 868 | Open in IMG/M |
| 3300015374|Ga0132255_104485885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300017787|Ga0183260_10275243 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300017789|Ga0136617_10309114 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300018000|Ga0184604_10361049 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300018061|Ga0184619_10355355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria | 668 | Open in IMG/M |
| 3300018067|Ga0184611_1301210 | Not Available | 557 | Open in IMG/M |
| 3300018422|Ga0190265_13427775 | Not Available | 529 | Open in IMG/M |
| 3300018429|Ga0190272_12206544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 591 | Open in IMG/M |
| 3300018429|Ga0190272_12631171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
| 3300018432|Ga0190275_10458509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1299 | Open in IMG/M |
| 3300018432|Ga0190275_11537991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
| 3300018465|Ga0190269_10610414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces → unclassified Actinomyces → Actinomyces sp. oral taxon 849 → Actinomyces sp. oral taxon 849 str. F0330 | 740 | Open in IMG/M |
| 3300018469|Ga0190270_10082278 | Not Available | 2394 | Open in IMG/M |
| 3300018476|Ga0190274_10995458 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300018476|Ga0190274_11146670 | Not Available | 859 | Open in IMG/M |
| 3300018476|Ga0190274_13969885 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300018481|Ga0190271_11490619 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300018920|Ga0190273_10778465 | Not Available | 756 | Open in IMG/M |
| 3300019361|Ga0173482_10172675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella | 862 | Open in IMG/M |
| 3300019377|Ga0190264_12371802 | Not Available | 500 | Open in IMG/M |
| 3300019767|Ga0190267_10900622 | Not Available | 605 | Open in IMG/M |
| 3300019767|Ga0190267_10936832 | Not Available | 598 | Open in IMG/M |
| 3300022756|Ga0222622_10344052 | Not Available | 1038 | Open in IMG/M |
| 3300025918|Ga0207662_11377530 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025936|Ga0207670_11145669 | Not Available | 657 | Open in IMG/M |
| 3300025941|Ga0207711_12051549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
| 3300025972|Ga0207668_11433218 | Not Available | 623 | Open in IMG/M |
| 3300026023|Ga0207677_10638004 | Not Available | 939 | Open in IMG/M |
| 3300026023|Ga0207677_11496455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Wizardvirus → unclassified Wizardvirus → Gordonia phage YungMoney | 623 | Open in IMG/M |
| 3300026035|Ga0207703_11808407 | Not Available | 587 | Open in IMG/M |
| 3300026088|Ga0207641_11934644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300026121|Ga0207683_12134035 | Not Available | 508 | Open in IMG/M |
| 3300026142|Ga0207698_11027150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
| 3300028069|Ga0255358_1044052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300028381|Ga0268264_10676627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1023 | Open in IMG/M |
| 3300028596|Ga0247821_10745708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300030114|Ga0311333_11908376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300030905|Ga0308200_1137456 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031228|Ga0299914_10234199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1626 | Open in IMG/M |
| 3300031232|Ga0302323_102425152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 598 | Open in IMG/M |
| 3300031902|Ga0302322_103156316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 566 | Open in IMG/M |
| 3300031918|Ga0311367_11300043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 719 | Open in IMG/M |
| 3300033550|Ga0247829_10592858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 921 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.85% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 8.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.10% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 4.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.28% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.28% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.46% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 2.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.46% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.64% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.82% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.82% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_10146640 | 2170459005 | Grass Soil | MSKLSVKQRERLPAKAFGLPEKARTKKARRETGNY |
| INPhiseqgaiiFebDRAFT_1016344772 | 3300000364 | Soil | MADLSAKKREKIPTKDFGLPEKARTKDDKKESGNYPMPDK |
| JGI10216J12902_1000415241 | 3300000956 | Soil | MSKLSPRQRANLEPKDFGLPEKARTEEARKEAGNYPMPDKNHAIS |
| JGI10216J12902_1028684772 | 3300000956 | Soil | VAKLSAKERAKLKPSQFGLPEKARTKDARKEPGNYPMPD |
| JGI10216J12902_1062359382 | 3300000956 | Soil | MAKLTAKQREALKPSQFGLPDKARTKKARKQPGNYPMPDRGHAISAVRL |
| JGI10216J12902_1071842393 | 3300000956 | Soil | MADLTAKQREKLPAKEFGLPEKARTKDAKKESGNYPMPDKAHAR |
| JGI10216J12902_1111607443 | 3300000956 | Soil | MAKLTAKKRAALKPSQFGLPEKARTEKARKKPGNYPMPDEGHAI |
| JGI24129J20441_10705031 | 3300001870 | Arctic Peat Soil | VAKLKANERAKLPAKDFGLPEKARSAEAKKETGNYPMPD |
| Ga0062589_1000543401 | 3300004156 | Soil | MTSKLSASQRAKLPSKDFGLPEKARTPDAKKESGNYPMPDEGHAISAKRLAGKQRADG |
| Ga0062590_1008928902 | 3300004157 | Soil | VADLDADDREKIPTKEFGLPEKARTKEAKKQSGNYPMPDKAHARNAK |
| Ga0063356_1036939532 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGELSAKKREDLPAKDFGLPEKARTDQDKRESGNYPMPDK |
| Ga0062595_1000023692 | 3300004479 | Soil | MAKLTAKQRAKLPAKDFGLPEKARSEEARKESGNYPIPDKGECRFG* |
| Ga0062592_1008740831 | 3300004480 | Soil | MAKLSAKQRAKLPAKEFGLPEKAGSDKAKKETGNYPMPDA |
| Ga0062592_1019870133 | 3300004480 | Soil | MAELSAKKREKLPAKDFGLPEKARTEDDKRGSGNYPMPDKAHARN |
| Ga0062592_1025277102 | 3300004480 | Soil | MSDLTSKKRENIPTKEFGLPEKARTKEAKKESGNYPMPDKAHARNAK |
| Ga0066685_101547635 | 3300005180 | Soil | MSKLSARQRAKLPPKAFGLPERARTKEARQESGNYPMPDRGHA |
| Ga0070683_1004812191 | 3300005329 | Corn Rhizosphere | MSKLSAKARANLPPKAFGLPEKARTKKARGETGNYPMPDRGHAISAIRLSRLER |
| Ga0070667_1005591001 | 3300005367 | Switchgrass Rhizosphere | MADMDAARREKLPAKDFGLPERARTKDAKKESGNYPMPDKAHARNA |
| Ga0070667_1016304552 | 3300005367 | Switchgrass Rhizosphere | MADLDAEKRENLPAKDFGLPEKARTKQAKKQSGNYPMPDKAHARN |
| Ga0068852_1019459472 | 3300005616 | Corn Rhizosphere | MAKLTAKQREKLPAKAFGLPERARSKKARKESGNYPMPD |
| Ga0068864_1021847342 | 3300005618 | Switchgrass Rhizosphere | MADLDAEKREKIPTKDFGLPEKARTKDAKKESGNYPMPDK |
| Ga0075417_102469511 | 3300006049 | Populus Rhizosphere | MADLDADKREKLDSKDFGLPEKARTKEAKRESGNYPMPDDAHAR |
| Ga0075367_109535772 | 3300006178 | Populus Endosphere | MAELSDKKRENLPSREFGLPEKARTKAQKRETGNYP |
| Ga0075370_109230771 | 3300006353 | Populus Endosphere | MAKLSATQRAKLPARKFGLPEKARTSEAKKETGNYPMPDK |
| Ga0068871_1009796582 | 3300006358 | Miscanthus Rhizosphere | MSELTEKDRAKLPSKEFGLPEKARTAEAKKETGNYPMP |
| Ga0079220_105366013 | 3300006806 | Agricultural Soil | MSTLTAKQRAALPPKAFGLPERARTKKARKGSGNY |
| Ga0075433_117404642 | 3300006852 | Populus Rhizosphere | MAKLTAKQRANLPPKAFGLPERARSKQARKEPGNYP |
| Ga0075420_1010753382 | 3300006853 | Populus Rhizosphere | VADLDADDREKIPTKEFGLPEKARTKEAKKQSGNYPMPDEAHA |
| Ga0079216_111341013 | 3300006918 | Agricultural Soil | MAKLTPKKRASLPSRVFGLPEKARTKKAKQETGNYPMPD |
| Ga0075419_107277691 | 3300006969 | Populus Rhizosphere | MADLDADKREKLDSKDFGLPEKARTKEAKRESGNYPMPDDAHARNAKARA |
| Ga0079218_114119683 | 3300007004 | Agricultural Soil | MADLTAKKREKLPAKDFGLPEKARTKDAKKESGNYPMPDKSHARNA |
| Ga0079218_136799431 | 3300007004 | Agricultural Soil | VAELSAKRREKLPSKDFGLPEKARTADDKRDAGNYPMPDASHAAN |
| Ga0066793_106950281 | 3300009029 | Prmafrost Soil | MAKLTSKQRAKLPTRDFGLPEKARSDEDKKEAGNYPIPDKG |
| Ga0111539_104140083 | 3300009094 | Populus Rhizosphere | VADLDADDREKIPTKEFGLPEKARTKEAKKQSGNYPMPDEAHAR |
| Ga0105245_128130332 | 3300009098 | Miscanthus Rhizosphere | MAKLTPKQRENLPSKDFGLPEKARTKSQKRESGNYPMPDRGHAISALRR |
| Ga0075418_127444001 | 3300009100 | Populus Rhizosphere | VGITTEVIEMAELSAKKREKLPAKDFGLPEKARTKDDKKESGNYP |
| Ga0105247_106788222 | 3300009101 | Switchgrass Rhizosphere | VGYFFIMAEPTEKQRENLPSKDFGLPERARTKAQKRKTGNYPMPDRGHAISALR |
| Ga0105243_108372761 | 3300009148 | Miscanthus Rhizosphere | VADLDADDREKIPTKEFGLPEKARTKDAKKQSGNY |
| Ga0105243_119531882 | 3300009148 | Miscanthus Rhizosphere | MAKLTAKQREKLPAKAFGLPERARSKKARKESGNYPMPDRDHAISAIRRSERERRRG |
| Ga0111538_123307012 | 3300009156 | Populus Rhizosphere | MADLSAKKREKIPTKDFGLPEKARTKDDKKESGNYPMPD |
| Ga0105242_101442294 | 3300009176 | Miscanthus Rhizosphere | MTKLTPTQRAKLPAREFGLPEKARTADAKKETGNYPMPDRG |
| Ga0126307_101091981 | 3300009789 | Serpentine Soil | MGDLSPKKREKLPAKDFGLPERAKTPEAKKESGNYPMPDAKHAK |
| Ga0126307_113921641 | 3300009789 | Serpentine Soil | LEDVMGELDAKKREELPTKDFGLPEKARTKSAKKESGNYPMPDKPHARNAK |
| Ga0126305_104027502 | 3300010036 | Serpentine Soil | MADLNAKKREKLPAKDFGLPEKARTKEAKKESGNYPMPDK |
| Ga0134124_124137201 | 3300010397 | Terrestrial Soil | MAKLSTKQRENLPAKAFGLPEKARSKKARKESGNYPMPDK |
| Ga0105246_105023093 | 3300011119 | Miscanthus Rhizosphere | MSTLTAKQRANLRPKDFGLPERARTPAARKETGNYPIPDRGHAI |
| Ga0105246_111577411 | 3300011119 | Miscanthus Rhizosphere | VADLDADDREKIPTNEFGLPEKARTKEAKKQSGNYPM |
| Ga0136623_103947951 | 3300012045 | Polar Desert Sand | MGELTAKQRAKLPAKEFGLPEKARSSDARKQTGNYPVPDKGHAISAKRLSRKQL |
| Ga0136634_103623542 | 3300012046 | Polar Desert Sand | MAKLTPKKRAALPSKEFGLPEKARTAEAKKETGNYPVPDRGHAISAKRLSK |
| Ga0136621_10604871 | 3300012092 | Polar Desert Sand | MGELTAKQRAKLPAKEFGLPEKARSSDAKKQTGNYPMPDKDHAISA |
| Ga0136632_102493531 | 3300012093 | Polar Desert Sand | MAKLDAKQRAKLPAKDFGLPEKARSADAKKETGNYPIPDEGHAISAKRLSRKQRK |
| Ga0136638_105265072 | 3300012094 | Polar Desert Sand | MGELTAKQRATLPAKEFGLPEKAGSSDAKKQTGNYPMPD |
| Ga0136635_100592793 | 3300012530 | Polar Desert Sand | MTKLTRRKRANLPSRDFGLPEKARTEEAKQETGNYPIPDRGHAIS |
| Ga0136612_102248902 | 3300012680 | Polar Desert Sand | MKGRVVAKLSAKERAKLPARDFGLPEKARTAEAKKETGNYPMPDQGHAISAKRLSM |
| Ga0136613_108019201 | 3300012681 | Polar Desert Sand | MAKLTPKKRAALPAKDFGLPEKARTSEAKKEAGNYPMPDRGHAISAK |
| Ga0157292_101562681 | 3300012900 | Soil | MSELTEKDRAKLPSKEFGLPEKARTAEAKKETGNYPMPDRNHAISAKS |
| Ga0164300_106450641 | 3300012951 | Soil | MSKLTAKQRAKLPPKAFGLPEKARSKKARKEPGNYPMPDRDHAIS |
| Ga0164299_107262812 | 3300012958 | Soil | MADLSAKKRAKVPTKDFGLPEKARTEDAKKESGNYPM |
| Ga0164309_103222463 | 3300012984 | Soil | MSELTEKDRAKLPSKEFGLPEKARTAEAKKETGNYPMPDRN |
| Ga0164309_103876891 | 3300012984 | Soil | MAKLSAKQRAALKPSQFGLPERARTEKARKETGNYPMPDKGHA |
| Ga0157378_123282852 | 3300013297 | Miscanthus Rhizosphere | MADLSAKKREKIPTKDFGLPEKARTKDDKKESGNYPM |
| Ga0157378_125727072 | 3300013297 | Miscanthus Rhizosphere | MGKLTPKQRENLASKDFGLPERARTKAQKRDTGNYPMPDRGHAISALRL |
| Ga0157378_129438392 | 3300013297 | Miscanthus Rhizosphere | MADLSAKKRAKVPTKDFGLPEKARTEDAKKESGNYPMPDKAHARN |
| Ga0120109_11578941 | 3300014052 | Permafrost | MAKLTPKQRSELTARDFGLPEKARSSDARKEIGNYPIPDTGHAASAKRLSR |
| Ga0120135_10195582 | 3300014054 | Permafrost | MAKLDAKQRAKLPAKDFGLPEKARSAGAKKESGNYPIPDEGHAI |
| Ga0163163_104457883 | 3300014325 | Switchgrass Rhizosphere | MADLDAEKRENLPAKDFGLPEKARTKQAKKQSGNYP |
| Ga0163163_114185602 | 3300014325 | Switchgrass Rhizosphere | MSKLTAKLRAKLPARAFCLPERARTAKAKKESGNYPMPDEGHAI |
| Ga0163163_119290511 | 3300014325 | Switchgrass Rhizosphere | MGKLSARQRANLPAKEFGLPEKARTEEARRGTGNYPM |
| Ga0157380_123702552 | 3300014326 | Switchgrass Rhizosphere | MSELTEKDRAKLPSKEFGLPEKARTAEAKKQTGNYPMPDREHAISAKSRARK |
| Ga0173480_102406441 | 3300015200 | Soil | MAELSAKQRAKLPSREFGLPERARSADAKKETGNYPMPDKGHAISAKRL |
| Ga0132256_1001313631 | 3300015372 | Arabidopsis Rhizosphere | MADLDAEDREKIPTKEFGLPEKARTKEAKKQSGNY |
| Ga0132256_1003837543 | 3300015372 | Arabidopsis Rhizosphere | MTAKKRASTKTKDFGLPEKARTTDQKKESGNYPMPDKAHARNAKARAQQQYD |
| Ga0132256_1006567483 | 3300015372 | Arabidopsis Rhizosphere | VADLDAKKREQLPAKDFGLPEKARTKAAKKESGNYPMPDKAH |
| Ga0132256_1010473882 | 3300015372 | Arabidopsis Rhizosphere | MGKLTEKQRENLPAKDFGLPERARTKAQKRETGNYPMPDRRH |
| Ga0132256_1027711381 | 3300015372 | Arabidopsis Rhizosphere | VADLDADDREKIPTKEFGLPEKARTKDAKKQSGNYPMPDKAHA |
| Ga0132257_1038039501 | 3300015373 | Arabidopsis Rhizosphere | MPKLTPKQRAKLPAREFGLPEKARSSEAKKETGNYPMPDK |
| Ga0132257_1044648641 | 3300015373 | Arabidopsis Rhizosphere | MAKLTEKQRENLPSKDFGLPERARTKAQKRKTGNYPMPDR |
| Ga0132255_1009405901 | 3300015374 | Arabidopsis Rhizosphere | MSELTEKDRAKLPSKEFGLPEKARTAEAKKQTGNYPMPDRNHAISAK |
| Ga0132255_1020661471 | 3300015374 | Arabidopsis Rhizosphere | MADMTAKKRASTKTKDFGLPEKARTTDQKKESGNYPMPDKAHARNAK |
| Ga0132255_1044858852 | 3300015374 | Arabidopsis Rhizosphere | MSKLTPTQRAKLPARKFGLPEKARTPEARKETGNY |
| Ga0183260_102752433 | 3300017787 | Polar Desert Sand | MADLDASKREKLPAKEFGLPEKARTKAAKKESGNYPMPDKHARNAKSRARRLTAPG |
| Ga0136617_103091142 | 3300017789 | Polar Desert Sand | MARLNAKQRAKLPAKEFGLPEKARSEDAKKESGKLPDAG |
| Ga0184604_103610492 | 3300018000 | Groundwater Sediment | MAKLKAKQRAELPAKDFGLPEKARSADAKKETGNYPMPDEGHAISAKRLSRMQ |
| Ga0184619_103553553 | 3300018061 | Groundwater Sediment | MAKLTAQQRAKLPAREFGLPEKARSDEARKETGNYPIP |
| Ga0184611_13012102 | 3300018067 | Groundwater Sediment | MADLNAKKRASLPSKDFGLPEKARTTDQKKESGNYPM |
| Ga0190265_134277752 | 3300018422 | Soil | MSTLTAKQRANLPPKVFGLPEKARTKKARKDTGNY |
| Ga0190272_122065441 | 3300018429 | Soil | MAELTPKKRAALPSKVFGLPEKARTSKAKKEPGNYPIPDRGHAISAKRLSRKNRKDGNLT |
| Ga0190272_126311711 | 3300018429 | Soil | MAKLNAKQRAKLPAKEFGLPEKARSADAKKETGNYPI |
| Ga0190275_104585092 | 3300018432 | Soil | VAKLSAKQRAKLPAKEFGLPEKARTPDAKKETGNYPMPDEGHAISAKRLSRK |
| Ga0190275_115379911 | 3300018432 | Soil | MADLSAEKREDLPAKDFGLPEKARTKDAKKESGNYPMPDK |
| Ga0190269_106104141 | 3300018465 | Soil | MAKLTPRKRANLPPKAFGLPEKARTEEARKETGNYPIPDK |
| Ga0190270_100822781 | 3300018469 | Soil | MAKLSAKKRAALEPSQFGLPEKARTEKARKETGNYPMPDKGHAISAV |
| Ga0190274_109954583 | 3300018476 | Soil | MAELSAKKREQLPAKEFGLPEKARTKDAKKESGNYPMPD |
| Ga0190274_111466703 | 3300018476 | Soil | VGDLDAQDREKIPTKEFGLPEKARTKEAKKQSGNYPMPDKA |
| Ga0190274_139698852 | 3300018476 | Soil | MAKLTPKKRAALKPSQFGLPERARTKKARKETGNYPMPDKGHA |
| Ga0190271_114906193 | 3300018481 | Soil | MAKLTPTQRAKLPARKFGLPEKARTPEARKETGNYPMPD |
| Ga0190273_107784652 | 3300018920 | Soil | MSKLTAKLRAKLPARAFGLPEKARTDRAKKESGNYPIPD |
| Ga0173482_101726751 | 3300019361 | Soil | MSELTEKDRAKLPSKEFGLPEKARTAEAKKETGNYP |
| Ga0190264_123718021 | 3300019377 | Soil | MAELTPNQRAKLPSKEFGLPEKAKTAQAKEETGNYPIPDRG |
| Ga0190267_109006221 | 3300019767 | Soil | MSKLTPTQRAKLPSQKFGLPEKARTAEAKKETGNYPMPDRGHAISAKR |
| Ga0190267_109368321 | 3300019767 | Soil | MADLDADKREKLDSKDFGLPEKARTKEAKRESGNYPMPDDAHARNAK |
| Ga0222622_103440522 | 3300022756 | Groundwater Sediment | MADLTAKKRASMKSKDFGLPEKARTTDQKKDSGNYPMPDKA |
| Ga0207662_113775301 | 3300025918 | Switchgrass Rhizosphere | MADMTAKKRGATKTKDFGLPEKARTTDQKKESGNYPM |
| Ga0207670_111456691 | 3300025936 | Switchgrass Rhizosphere | VADLDADDREKIPTNEFGLPEKARTKEAKKQSGNYPMPDKAHARNA |
| Ga0207711_120515491 | 3300025941 | Switchgrass Rhizosphere | MAKLTEKQRENLPSKDFGLPERARTKAQKRKTGNYPMPDRGHAISALRLGERQAQIE |
| Ga0207668_114332182 | 3300025972 | Switchgrass Rhizosphere | MSTLTAKQRANLRPKDFGLPEKARTKKARKETGNYPIPDRG |
| Ga0207677_106380042 | 3300026023 | Miscanthus Rhizosphere | MADLSAKKREKIPTKDFGLPEKARTKDDKKESGNYPMPDKAHAR |
| Ga0207677_114964552 | 3300026023 | Miscanthus Rhizosphere | VADLDADDREKIPTNEFGLPEKARTKEAKKQSGNYP |
| Ga0207703_118084071 | 3300026035 | Switchgrass Rhizosphere | VADLDADDREKIPTKEFGLPEKARTKKAKKQSGNYPMPDKAHARNAKS |
| Ga0207641_119346441 | 3300026088 | Switchgrass Rhizosphere | MAKLTAKQREKLPAREFGLPEKARTSEARKESGNYPMPDREH |
| Ga0207683_121340351 | 3300026121 | Miscanthus Rhizosphere | MAKLTAKKRAALKPSQFGLPEKARTEKARKQPGNYPMPDE |
| Ga0207698_110271501 | 3300026142 | Corn Rhizosphere | MAKLTAKQREKLPAKAFGLPERARSKKARKESGNYPMPDRDHAISAIRRSER |
| Ga0255358_10440521 | 3300028069 | Soil | VAKLKANERAKLPAKDFGLPEKARSAEAKRETGNYPMPDEGHAISAKRLSRMQRE |
| Ga0268264_106766271 | 3300028381 | Switchgrass Rhizosphere | MAKLTAKQREKLPAREFGLPEKARTSEARKESGNYPMPDREHAGSA |
| Ga0247821_107457081 | 3300028596 | Soil | MADLPAKKREQLPAKDFGLPEKARTKSAKKESGNYPMPDSFFAD |
| Ga0311333_119083762 | 3300030114 | Fen | VAKLKPNERARLPAKDFGLPEKARSAGAKKETGNYPMPDEGHAISAKRLSRIQLE |
| Ga0308200_11374563 | 3300030905 | Soil | MTKLTAKKRAKLPAREFGLPEKARSDDAKKETGNY |
| Ga0299914_102341993 | 3300031228 | Soil | MSKLTPTQRAKLPARKFGLPEKARTPEARKQTGNYPIPDRGHAISAKRLAHKNRKDG |
| Ga0302323_1024251522 | 3300031232 | Fen | VAKLKPNERARLPAKDFGLPEKARSAGAKKETGNYPM |
| Ga0302322_1031563161 | 3300031902 | Fen | VAKLKANERAKLPAKDFGLPEKARSAEAKKETGNYPMPDEGHAISAK |
| Ga0311367_113000431 | 3300031918 | Fen | VAKLTANERAELPAKDFGLPEKARSAEAKKESGNYPMPDEGHAISAKRLSRMQ |
| Ga0247829_105928581 | 3300033550 | Soil | VADLDAKKREQLPAKDFGLPEKARTKAAKKESGNYPMP |
| ⦗Top⦘ |