


| Basic Information | |
|---|---|
| Family ID | F071381 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 50 residues |
| Representative Sequence | FLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 97.54 % |
| % of genes from short scaffolds (< 2000 bps) | 95.90 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.443 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.672 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.803 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.377 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 85.71% β-sheet: 0.00% Coil/Unstructured: 14.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF13787 | HXXEE | 54.92 |
| PF00144 | Beta-lactamase | 5.74 |
| PF08334 | T2SSG | 0.82 |
| PF08309 | LVIVD | 0.82 |
| PF12833 | HTH_18 | 0.82 |
| PF00440 | TetR_N | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 5.74 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 5.74 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 5.74 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.44 % |
| Unclassified | root | N/A | 6.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005288|Ga0065714_10531310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 507 | Open in IMG/M |
| 3300005294|Ga0065705_10399722 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005328|Ga0070676_10321315 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300005335|Ga0070666_11241100 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005340|Ga0070689_100838027 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005340|Ga0070689_101639552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 584 | Open in IMG/M |
| 3300005344|Ga0070661_100522579 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005345|Ga0070692_11167854 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005354|Ga0070675_100595139 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300005355|Ga0070671_101599680 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005356|Ga0070674_100139021 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300005356|Ga0070674_101549166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 597 | Open in IMG/M |
| 3300005439|Ga0070711_101617584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 567 | Open in IMG/M |
| 3300005455|Ga0070663_100722115 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005456|Ga0070678_101600697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 612 | Open in IMG/M |
| 3300005459|Ga0068867_100973553 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005459|Ga0068867_102353084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 507 | Open in IMG/M |
| 3300005466|Ga0070685_10991796 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005548|Ga0070665_101370182 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005616|Ga0068852_101833913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300005617|Ga0068859_102396420 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005618|Ga0068864_102697440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 503 | Open in IMG/M |
| 3300005840|Ga0068870_10410493 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005841|Ga0068863_100460341 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300005841|Ga0068863_101986785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 591 | Open in IMG/M |
| 3300005842|Ga0068858_100868016 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005843|Ga0068860_101459286 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005844|Ga0068862_100435769 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300006049|Ga0075417_10503800 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006196|Ga0075422_10561411 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300006847|Ga0075431_101252089 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300006853|Ga0075420_100385470 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300006881|Ga0068865_101456699 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006881|Ga0068865_102018787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 523 | Open in IMG/M |
| 3300007076|Ga0075435_101174259 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300009036|Ga0105244_10256992 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300009094|Ga0111539_12116794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 653 | Open in IMG/M |
| 3300009101|Ga0105247_11680440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 524 | Open in IMG/M |
| 3300009148|Ga0105243_11730512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 655 | Open in IMG/M |
| 3300009156|Ga0111538_12703539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 622 | Open in IMG/M |
| 3300009177|Ga0105248_11785040 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300009610|Ga0105340_1211072 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300010400|Ga0134122_12039691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 613 | Open in IMG/M |
| 3300011435|Ga0137426_1190902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 610 | Open in IMG/M |
| 3300012476|Ga0157344_1005738 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012484|Ga0157333_1032794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 526 | Open in IMG/M |
| 3300012487|Ga0157321_1038907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 516 | Open in IMG/M |
| 3300012488|Ga0157343_1008759 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012501|Ga0157351_1023242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 673 | Open in IMG/M |
| 3300012502|Ga0157347_1044337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 596 | Open in IMG/M |
| 3300012514|Ga0157330_1019622 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012672|Ga0137317_1011088 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012882|Ga0157304_1025875 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012884|Ga0157300_1036914 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012891|Ga0157305_10070265 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300012891|Ga0157305_10102810 | All Organisms → cellular organisms → Bacteria → FCB group | 707 | Open in IMG/M |
| 3300012896|Ga0157303_10154525 | Not Available | 619 | Open in IMG/M |
| 3300012899|Ga0157299_10130252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 688 | Open in IMG/M |
| 3300012903|Ga0157289_10109072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 803 | Open in IMG/M |
| 3300012907|Ga0157283_10405615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 508 | Open in IMG/M |
| 3300012910|Ga0157308_10133550 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012958|Ga0164299_11230087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 568 | Open in IMG/M |
| 3300012958|Ga0164299_11510700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 524 | Open in IMG/M |
| 3300012961|Ga0164302_11534793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 551 | Open in IMG/M |
| 3300012961|Ga0164302_11613770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 540 | Open in IMG/M |
| 3300012984|Ga0164309_11522398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 572 | Open in IMG/M |
| 3300012986|Ga0164304_10791003 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300012987|Ga0164307_11403824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 588 | Open in IMG/M |
| 3300012987|Ga0164307_11916222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 502 | Open in IMG/M |
| 3300013096|Ga0157307_1145570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 546 | Open in IMG/M |
| 3300013296|Ga0157374_11484162 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300013306|Ga0163162_12145794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 641 | Open in IMG/M |
| 3300014867|Ga0180076_1071294 | Not Available | 638 | Open in IMG/M |
| 3300014880|Ga0180082_1115297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 614 | Open in IMG/M |
| 3300014969|Ga0157376_12015499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 615 | Open in IMG/M |
| 3300015373|Ga0132257_100046203 | All Organisms → cellular organisms → Bacteria | 4832 | Open in IMG/M |
| 3300017965|Ga0190266_10559276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 682 | Open in IMG/M |
| 3300018051|Ga0184620_10113819 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300018067|Ga0184611_1347705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 509 | Open in IMG/M |
| 3300018074|Ga0184640_10390422 | Not Available | 628 | Open in IMG/M |
| 3300018083|Ga0184628_10052392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2061 | Open in IMG/M |
| 3300018083|Ga0184628_10183798 | Not Available | 1092 | Open in IMG/M |
| 3300018469|Ga0190270_12233504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 608 | Open in IMG/M |
| 3300018481|Ga0190271_13087087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 559 | Open in IMG/M |
| 3300019356|Ga0173481_10178445 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300022756|Ga0222622_10547064 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300022756|Ga0222622_10670287 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300023260|Ga0247798_1059908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 536 | Open in IMG/M |
| 3300023270|Ga0247784_1053530 | Not Available | 990 | Open in IMG/M |
| 3300025315|Ga0207697_10240053 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300025893|Ga0207682_10156573 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300025906|Ga0207699_11172005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 569 | Open in IMG/M |
| 3300025926|Ga0207659_11083795 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300025926|Ga0207659_11311108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 621 | Open in IMG/M |
| 3300025926|Ga0207659_11924645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 501 | Open in IMG/M |
| 3300025931|Ga0207644_11471628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 572 | Open in IMG/M |
| 3300025937|Ga0207669_10321497 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300026023|Ga0207677_10653217 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300026075|Ga0207708_10617194 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300026121|Ga0207683_11238305 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300027533|Ga0208185_1012976 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300027543|Ga0209999_1106790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 546 | Open in IMG/M |
| 3300027573|Ga0208454_1083824 | Not Available | 743 | Open in IMG/M |
| 3300028380|Ga0268265_10442922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1211 | Open in IMG/M |
| 3300028380|Ga0268265_12219371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 556 | Open in IMG/M |
| 3300028587|Ga0247828_10674559 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300028592|Ga0247822_10842395 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300031562|Ga0310886_10090662 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300031562|Ga0310886_10181845 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300031573|Ga0310915_10087518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2083 | Open in IMG/M |
| 3300031858|Ga0310892_10465872 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300031908|Ga0310900_10542795 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300031913|Ga0310891_10062917 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300032000|Ga0310903_10576089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 596 | Open in IMG/M |
| 3300032003|Ga0310897_10435214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 626 | Open in IMG/M |
| 3300032075|Ga0310890_11130584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 635 | Open in IMG/M |
| 3300033551|Ga0247830_11475044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. S4-A87 | 544 | Open in IMG/M |
| 3300034147|Ga0364925_0189440 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300034147|Ga0364925_0191783 | Not Available | 750 | Open in IMG/M |
| 3300034149|Ga0364929_0031374 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300034894|Ga0373916_0019512 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 7.38% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.28% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.46% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.64% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012672 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2 | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034894 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0065714_105313102 | 3300005288 | Miscanthus Rhizosphere | CLFPFVAQPMIAEALGLTPMGLRDFMKRRRTELPALLKRTL* |
| Ga0065705_103997222 | 3300005294 | Switchgrass Rhizosphere | QFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0070676_103213152 | 3300005328 | Miscanthus Rhizosphere | PVPADQFLVTLVGSCLFPFVGQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL* |
| Ga0070666_112411001 | 3300005335 | Switchgrass Rhizosphere | KRKKITPVPADQFLVTLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL* |
| Ga0070689_1008380271 | 3300005340 | Switchgrass Rhizosphere | FLVTLVGSCLYPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL* |
| Ga0070689_1016395522 | 3300005340 | Switchgrass Rhizosphere | TLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL* |
| Ga0070661_1005225792 | 3300005344 | Corn Rhizosphere | VAADQFLVTLVGSCLFPFVVQPMIAEALGLSTTGVRQFMKRRRTELPALLKRMLHS* |
| Ga0070692_111678541 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | KIEPVSADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0070675_1005951391 | 3300005354 | Miscanthus Rhizosphere | VTLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0070671_1015996802 | 3300005355 | Switchgrass Rhizosphere | TLVGSCLYPFVAQPMIAEALGLTPKGLRDFMNRRRTELPALLKRTL* |
| Ga0070674_1001390213 | 3300005356 | Miscanthus Rhizosphere | QINERAKQKKIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRAFMKRRRVELPALLKRTL* |
| Ga0070674_1015491661 | 3300005356 | Miscanthus Rhizosphere | VTLVGSCLYPFVAQPMIAEALGLRPKELRDFMKRRRAELPALLKRTL* |
| Ga0070711_1016175841 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | YPFVAQPMIAEALGLGPKELRAFMKRRRTELPALLKRTL* |
| Ga0070663_1007221152 | 3300005455 | Corn Rhizosphere | VGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL* |
| Ga0070678_1016006971 | 3300005456 | Miscanthus Rhizosphere | TLVGSCLFPFVAQPMIAEALGLTPMGLRDFMKRRRTELPALLKRTL* |
| Ga0068867_1009735532 | 3300005459 | Miscanthus Rhizosphere | TLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRT* |
| Ga0068867_1023530841 | 3300005459 | Miscanthus Rhizosphere | FPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL* |
| Ga0070685_109917961 | 3300005466 | Switchgrass Rhizosphere | AKRKKIAPVAADQFLVTLVGSCLYPFVAQPMIAEALGLGPRELRAFMKRRRAELPALLKRTL* |
| Ga0070665_1013701822 | 3300005548 | Switchgrass Rhizosphere | LVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0068852_1018339131 | 3300005616 | Corn Rhizosphere | PFVAQPMIAEALGLGPKELRDFMTRRRVELPALLKRTL* |
| Ga0068859_1023964202 | 3300005617 | Switchgrass Rhizosphere | TLVGSCLFPFVAQPMIAEALGLGPKDFRDFMKRRRAELPALLKRTL* |
| Ga0068864_1026974402 | 3300005618 | Switchgrass Rhizosphere | LVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0068870_104104932 | 3300005840 | Miscanthus Rhizosphere | ADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRAFMKRRRVELPALLKRTL* |
| Ga0068863_1004603411 | 3300005841 | Switchgrass Rhizosphere | AADQFLVTLVGSCLFPFVAQPMIAEALGLSTTGVRQFMKRRRTELPALLKRMLHS* |
| Ga0068863_1019867852 | 3300005841 | Switchgrass Rhizosphere | YPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL* |
| Ga0068858_1008680162 | 3300005842 | Switchgrass Rhizosphere | VTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL* |
| Ga0068860_1014592862 | 3300005843 | Switchgrass Rhizosphere | KIAPVAADQFLVTLVGGCLYPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL* |
| Ga0068862_1004357691 | 3300005844 | Switchgrass Rhizosphere | LYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0075417_105038001 | 3300006049 | Populus Rhizosphere | DQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0075422_105614112 | 3300006196 | Populus Rhizosphere | LYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL* |
| Ga0075431_1012520891 | 3300006847 | Populus Rhizosphere | EWKKIAPVPADQFLVTLVGGCLYTFVVQPMIAEALGLGPKELRALMKRRRAELPALLKRTL* |
| Ga0075420_1003854704 | 3300006853 | Populus Rhizosphere | ADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0068865_1014566991 | 3300006881 | Miscanthus Rhizosphere | VAPVPADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0068865_1020187871 | 3300006881 | Miscanthus Rhizosphere | YPFVAQPMIAEALGLRPKGLRDFMKRRRAELPALLKRTL* |
| Ga0075435_1011742592 | 3300007076 | Populus Rhizosphere | TLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL* |
| Ga0105244_102569921 | 3300009036 | Miscanthus Rhizosphere | TPVPADQFLVTLVGSCLFPFVAQPMIAEALGLGPKDFRDFMKRRRAELPALLKRTL* |
| Ga0111539_121167941 | 3300009094 | Populus Rhizosphere | NERAKQKGIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL* |
| Ga0105247_116804402 | 3300009101 | Switchgrass Rhizosphere | PVAADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRNFMKRRRAELPALLKRTL* |
| Ga0105243_117305122 | 3300009148 | Miscanthus Rhizosphere | LVGSCLWPFVAQPMIAEALGLTPKGLRDFRKRRRTELPALLKRTL* |
| Ga0111538_127035392 | 3300009156 | Populus Rhizosphere | SCLYPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL* |
| Ga0105248_117850401 | 3300009177 | Switchgrass Rhizosphere | LVGSCLWPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL* |
| Ga0105340_12110721 | 3300009610 | Soil | QPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0134122_120396912 | 3300010400 | Terrestrial Soil | KKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL* |
| Ga0137426_11909021 | 3300011435 | Soil | TLVGSCLYTFVVQPMIAEALGLGPKELRAFMKRRRAELPALLKRTL* |
| Ga0157344_10057382 | 3300012476 | Arabidopsis Rhizosphere | VPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0157333_10327941 | 3300012484 | Soil | VAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL* |
| Ga0157321_10389071 | 3300012487 | Arabidopsis Rhizosphere | IVPVPADQFLVTLVGSCLYPFWAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL* |
| Ga0157343_10087592 | 3300012488 | Arabidopsis Rhizosphere | QQMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0157351_10232421 | 3300012501 | Unplanted Soil | QINERAKQEKIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRDFMKRRRVELPALLKRTL* |
| Ga0157347_10443371 | 3300012502 | Arabidopsis Rhizosphere | PADQFLVTLVGSCLYPFVAQPMIAEALGLTAKGLRDFMKRRRAELPALLKRTL* |
| Ga0157330_10196222 | 3300012514 | Soil | DQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFLKRRRVELPALLKRTL* |
| Ga0137317_10110881 | 3300012672 | Soil | RKKIAPVSADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0157304_10258752 | 3300012882 | Soil | PADQFLVTLVGSCLYPFVAQPMIAEALGLRPKELRDFMKRRRAELPALLKRTL* |
| Ga0157300_10369142 | 3300012884 | Soil | LVTLVGSCLFPFVAQPMIAEALGLGPKELRAFMKRRRAELPALLKRTL* |
| Ga0157305_100702651 | 3300012891 | Soil | SCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0157305_101028101 | 3300012891 | Soil | AKQQKIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0157303_101545251 | 3300012896 | Soil | TLVGSCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL* |
| Ga0157299_101302521 | 3300012899 | Soil | QKKSVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTSRGLRDFMKRRRVELPALLKRTL |
| Ga0157289_101090722 | 3300012903 | Soil | MGWRKKIEPVSADQFLVTLVGSCLWPFVAQPMIAEALGLAPKGLRDFMKRRRTELPALLKRTL* |
| Ga0157283_104056151 | 3300012907 | Soil | PVAADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL* |
| Ga0157308_101335502 | 3300012910 | Soil | LVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0164299_112300871 | 3300012958 | Soil | APVAADQFLVTLVGSCLYPFVAQPMIAEALGLGPNELRTFMKRRRAALPALLKRTL* |
| Ga0164299_115107002 | 3300012958 | Soil | WPFVAQPMLAEALGLTPKGLRDFRKRRRTELPALLKRTL* |
| Ga0164302_115347931 | 3300012961 | Soil | QPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL* |
| Ga0164302_116137702 | 3300012961 | Soil | VAADQFLVTLVGSCLFPFVAQPMFAEALGLTATGVRQFMKRRRAELPALLKRTL* |
| Ga0164309_115223982 | 3300012984 | Soil | GSCLFPFVAQPMIAEALGLGPKELRAFMKRRRAELPALLKRTL* |
| Ga0164304_107910031 | 3300012986 | Soil | KKIGPVAADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL* |
| Ga0164307_114038242 | 3300012987 | Soil | AKRKNIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRAFMKRRRAELPALLKRTL* |
| Ga0164307_119162221 | 3300012987 | Soil | PADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL* |
| Ga0157307_11455702 | 3300013096 | Soil | ASCLFPFVAQPIIAEALGLTSKGLRDFMKRRRTELPALLKRTL* |
| Ga0157374_114841622 | 3300013296 | Miscanthus Rhizosphere | FLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0163162_121457941 | 3300013306 | Switchgrass Rhizosphere | INERARRKKIAPVSADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRIELPALLKRTL* |
| Ga0180076_10712941 | 3300014867 | Soil | SCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL* |
| Ga0180082_11152971 | 3300014880 | Soil | KRIKPVSADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL* |
| Ga0157376_120154991 | 3300014969 | Miscanthus Rhizosphere | INELAKRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLRPKELRDFMKRRRAELPALLKRTL* |
| Ga0132257_1000462031 | 3300015373 | Arabidopsis Rhizosphere | FLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRIELPALLKRTL* |
| Ga0190266_105592762 | 3300017965 | Soil | ADQFLVTLVGSCLFPFVAQPMIAEALGLSATGVRQFMKRRRTELPALLKRTLSQ |
| Ga0184620_101138191 | 3300018051 | Groundwater Sediment | LVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0184611_13477052 | 3300018067 | Groundwater Sediment | FLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0184640_103904222 | 3300018074 | Groundwater Sediment | QFLVTLVGSCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL |
| Ga0184628_100523923 | 3300018083 | Groundwater Sediment | ARRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0184628_101837982 | 3300018083 | Groundwater Sediment | FPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL |
| Ga0190270_122335041 | 3300018469 | Soil | DQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0190271_130870872 | 3300018481 | Soil | VTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0173481_101784452 | 3300019356 | Soil | SCLWPFVAQPMIAEALGLTPTGLRDFMKRRRTELPALLKRTL |
| Ga0222622_105470642 | 3300022756 | Groundwater Sediment | QFLVTLVGSCLFPFVAQPMIAEALGLGPRELRGFMKRRRTELPALLKRTL |
| Ga0222622_106702872 | 3300022756 | Groundwater Sediment | AQPMIAEALGLRPKELRGFMKRRRAELPALLKRTL |
| Ga0247798_10599082 | 3300023260 | Soil | PVPADQFLVTLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0247784_10535301 | 3300023270 | Plant Litter | FPFVAQPMLAEALGLSATGVRQFMKRRRTELPALLKRTL |
| Ga0207697_102400532 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | LYPFVAQPMIAEALGLTAKGLRDFMKRRRTELPALLKRTL |
| Ga0207682_101565733 | 3300025893 | Miscanthus Rhizosphere | LVGSCLWPFVAQPMIAEALGLTPKGLRDFIKRRRTELPALLKRTL |
| Ga0207699_111720052 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VGSCLYPFVAQPMIAEALGLGPKELRAFMKRRRTELPALLKRTL |
| Ga0207659_110837951 | 3300025926 | Miscanthus Rhizosphere | LVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0207659_113111081 | 3300025926 | Miscanthus Rhizosphere | PADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0207659_119246452 | 3300025926 | Miscanthus Rhizosphere | LVTLVGSCLFPFVAQPMIAEALGLGPKDFRDFMKRRRAELPALLKRTL |
| Ga0207644_114716282 | 3300025931 | Switchgrass Rhizosphere | ADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMNRRRTELPALLKRTL |
| Ga0207669_103214971 | 3300025937 | Miscanthus Rhizosphere | CLWPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL |
| Ga0207677_106532172 | 3300026023 | Miscanthus Rhizosphere | RKKIAPVSADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0207708_106171942 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | TLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL |
| Ga0207683_112383052 | 3300026121 | Miscanthus Rhizosphere | YPFVAQPMIAEALGLTPKGLRDFMKRRRIELPALLKRTL |
| Ga0207698_116847002 | 3300026142 | Corn Rhizosphere | VEQQINERAKRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL |
| Ga0208185_10129761 | 3300027533 | Soil | ADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL |
| Ga0209999_11067901 | 3300027543 | Arabidopsis Thaliana Rhizosphere | PVPADQFLVTLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRTELPALLKRTL |
| Ga0208454_10838242 | 3300027573 | Soil | GSCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL |
| Ga0268265_104429223 | 3300028380 | Switchgrass Rhizosphere | FPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL |
| Ga0268265_122193711 | 3300028380 | Switchgrass Rhizosphere | LYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0247828_106745592 | 3300028587 | Soil | VAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0247822_108423952 | 3300028592 | Soil | RARRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRTELPALLKRTL |
| Ga0310886_100906621 | 3300031562 | Soil | NERARQKQIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL |
| Ga0310886_101818451 | 3300031562 | Soil | RKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLGPKELRNFMKRRRTELPALLKRTL |
| Ga0310915_100875184 | 3300031573 | Soil | EVKRKKLAPVPADQFLLTLVGSCLYPFAARSTLADVLGLGPKQVRRFMERRRKELPAFLKRALQR |
| Ga0310892_104658722 | 3300031858 | Soil | TLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKKTL |
| Ga0310900_105427952 | 3300031908 | Soil | PFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0310891_100629171 | 3300031913 | Soil | ERAKQKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL |
| Ga0310903_105760891 | 3300032000 | Soil | QFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0310897_104352141 | 3300032003 | Soil | VTLVGSCLFPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKKTL |
| Ga0310890_111305841 | 3300032075 | Soil | INERAKQEKIVPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL |
| Ga0247830_114750441 | 3300033551 | Soil | VPADQFLVTLVGSCLFPFVAQPMIAEALGLGPKELRDFMKRRRAELPALLKRTL |
| Ga0364925_0189440_2_211 | 3300034147 | Sediment | EQQINERARRKKIAPVPADQFLVTLVGSCLYPFVAQPMIAEALGLTPKGLRDFMKRRRVELPALLKRTL |
| Ga0364925_0191783_616_750 | 3300034147 | Sediment | VGSCLFPFVAQPMFAEALGLSATGVRQFMKRRRTELPALLKRTL |
| Ga0364929_0031374_2_160 | 3300034149 | Sediment | ADQFLVTLVGSCLWPFVAQPMIAEALGLTPKGLRDFMKRRRTELPALLKRTL |
| Ga0373916_0019512_674_835 | 3300034894 | Sediment Slurry | PADQFLVTLVGSCLYPFVAQPMIAEALGLTPRGLRDFMKRRRVELPALLKRTL |
| ⦗Top⦘ |