


| Basic Information | |
|---|---|
| Family ID | F071261 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DGQRRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.69 % |
| % of genes near scaffold ends (potentially truncated) | 78.69 % |
| % of genes from short scaffolds (< 2000 bps) | 93.44 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.344 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.754 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.508 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.705 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00550 | PP-binding | 63.11 |
| PF00109 | ketoacyl-synt | 18.85 |
| PF13561 | adh_short_C2 | 13.11 |
| PF00106 | adh_short | 2.46 |
| PF02801 | Ketoacyl-synt_C | 1.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.34 % |
| Unclassified | root | N/A | 10.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig175594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 609 | Open in IMG/M |
| 2166559005|cont_contig23118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1181 | Open in IMG/M |
| 2170459009|GA8DASG01CE774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 2170459009|GA8DASG01EM0SQ | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300000545|CNXas_1019304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300001081|JGI12662J13196_1019203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 565 | Open in IMG/M |
| 3300001976|JGI24752J21851_1066322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300001991|JGI24743J22301_10130439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300002075|JGI24738J21930_10089275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 651 | Open in IMG/M |
| 3300002128|JGI24036J26619_10117195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300002155|JGI24033J26618_1078079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300003541|JGI20214J51650_10632784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300003570|Ga0007418J51697_1019450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300003572|Ga0007424J51698_1030036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 765 | Open in IMG/M |
| 3300005172|Ga0066683_10523763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 724 | Open in IMG/M |
| 3300005356|Ga0070674_100049033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 2901 | Open in IMG/M |
| 3300005366|Ga0070659_100668490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 896 | Open in IMG/M |
| 3300005367|Ga0070667_102104922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300005450|Ga0066682_10938065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300005456|Ga0070678_100074209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2556 | Open in IMG/M |
| 3300005548|Ga0070665_100278501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1674 | Open in IMG/M |
| 3300005548|Ga0070665_102460277 | Not Available | 522 | Open in IMG/M |
| 3300005598|Ga0066706_10693992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 808 | Open in IMG/M |
| 3300005718|Ga0068866_10463125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 831 | Open in IMG/M |
| 3300005718|Ga0068866_11293653 | Not Available | 530 | Open in IMG/M |
| 3300005840|Ga0068870_10506601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 805 | Open in IMG/M |
| 3300005841|Ga0068863_101775918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 626 | Open in IMG/M |
| 3300005952|Ga0080026_10198647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 593 | Open in IMG/M |
| 3300005994|Ga0066789_10105332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1210 | Open in IMG/M |
| 3300006046|Ga0066652_100604410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1035 | Open in IMG/M |
| 3300006052|Ga0075029_100407694 | Not Available | 884 | Open in IMG/M |
| 3300006426|Ga0075037_1105804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300006852|Ga0075433_11547059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300006881|Ga0068865_102108678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300006918|Ga0079216_11825461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300009101|Ga0105247_11718920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300009143|Ga0099792_10841740 | Not Available | 604 | Open in IMG/M |
| 3300009552|Ga0116138_1141863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 664 | Open in IMG/M |
| 3300010079|Ga0127436_153412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300010101|Ga0127481_1050845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300010117|Ga0127449_1103013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 901 | Open in IMG/M |
| 3300010134|Ga0127484_1138268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300010142|Ga0127483_1129980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 518 | Open in IMG/M |
| 3300010333|Ga0134080_10198584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 868 | Open in IMG/M |
| 3300010854|Ga0126360_1134630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter → Sulfitobacter indolifex → Sulfitobacter indolifex HEL-45 | 605 | Open in IMG/M |
| 3300010856|Ga0126358_1049076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300010858|Ga0126345_1054269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300010861|Ga0126349_1041912 | Not Available | 796 | Open in IMG/M |
| 3300010865|Ga0126346_1014345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300010869|Ga0126359_1444469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 716 | Open in IMG/M |
| 3300011422|Ga0137425_1133157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300012208|Ga0137376_10668090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 897 | Open in IMG/M |
| 3300012389|Ga0134040_1192353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300012392|Ga0134043_1233832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 851 | Open in IMG/M |
| 3300012398|Ga0134051_1206916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 621 | Open in IMG/M |
| 3300012683|Ga0137398_10663347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300012924|Ga0137413_10478294 | Not Available | 912 | Open in IMG/M |
| 3300012927|Ga0137416_11414722 | Not Available | 630 | Open in IMG/M |
| 3300014169|Ga0181531_10467483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 778 | Open in IMG/M |
| 3300015052|Ga0137411_1117350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 813 | Open in IMG/M |
| 3300015077|Ga0173483_10575796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300015200|Ga0173480_10872747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 581 | Open in IMG/M |
| 3300015201|Ga0173478_10186640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 858 | Open in IMG/M |
| 3300015242|Ga0137412_11017905 | Not Available | 592 | Open in IMG/M |
| 3300018025|Ga0187885_10165727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1038 | Open in IMG/M |
| 3300018030|Ga0187869_10407434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 648 | Open in IMG/M |
| 3300018038|Ga0187855_10461488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 740 | Open in IMG/M |
| 3300018042|Ga0187871_10595693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 613 | Open in IMG/M |
| 3300019260|Ga0181506_1212238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 540 | Open in IMG/M |
| 3300019263|Ga0184647_1034862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300019789|Ga0137408_1351414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 737 | Open in IMG/M |
| 3300019889|Ga0193743_1013727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4447 | Open in IMG/M |
| 3300020008|Ga0193757_1031427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 522 | Open in IMG/M |
| 3300020170|Ga0179594_10225304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 705 | Open in IMG/M |
| 3300021307|Ga0179585_1079095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300021315|Ga0179958_1004014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 815 | Open in IMG/M |
| 3300021478|Ga0210402_11200156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 686 | Open in IMG/M |
| 3300022506|Ga0242648_1059235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300022523|Ga0242663_1141655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300022712|Ga0242653_1097333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300022717|Ga0242661_1085358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 642 | Open in IMG/M |
| 3300022724|Ga0242665_10094204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 878 | Open in IMG/M |
| 3300023078|Ga0247756_1118813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300025315|Ga0207697_10528852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300025898|Ga0207692_10972174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → unclassified Brevundimonas → Brevundimonas sp. | 560 | Open in IMG/M |
| 3300025903|Ga0207680_11312939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300025907|Ga0207645_10076135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2148 | Open in IMG/M |
| 3300025909|Ga0207705_10608893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 849 | Open in IMG/M |
| 3300025930|Ga0207701_11583229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300025945|Ga0207679_10341419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1302 | Open in IMG/M |
| 3300026023|Ga0207677_11918044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → unclassified Brevundimonas → Brevundimonas sp. | 550 | Open in IMG/M |
| 3300027257|Ga0208996_1056251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 580 | Open in IMG/M |
| 3300027401|Ga0208637_1042309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300027524|Ga0208998_1047588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 697 | Open in IMG/M |
| 3300027660|Ga0209736_1111261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 741 | Open in IMG/M |
| 3300027678|Ga0209011_1099868 | Not Available | 845 | Open in IMG/M |
| 3300027880|Ga0209481_10664773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300027894|Ga0209068_10944776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 511 | Open in IMG/M |
| 3300027898|Ga0209067_10616244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300029923|Ga0311347_10370314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 873 | Open in IMG/M |
| 3300030056|Ga0302181_10421044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300030841|Ga0075384_11272334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 562 | Open in IMG/M |
| 3300030872|Ga0265723_1031810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 513 | Open in IMG/M |
| 3300030905|Ga0308200_1109536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300030963|Ga0265768_108398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 641 | Open in IMG/M |
| 3300030988|Ga0308183_1072471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 737 | Open in IMG/M |
| 3300030988|Ga0308183_1149690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300031094|Ga0308199_1157309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21 | 546 | Open in IMG/M |
| 3300031098|Ga0308191_1023392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 628 | Open in IMG/M |
| 3300031099|Ga0308181_1134695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300031100|Ga0308180_1012320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 762 | Open in IMG/M |
| 3300031421|Ga0308194_10295880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300031422|Ga0308186_1041105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter → Sulfitobacter indolifex → Sulfitobacter indolifex HEL-45 | 503 | Open in IMG/M |
| 3300031423|Ga0308177_1025938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300031715|Ga0307476_10379785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1042 | Open in IMG/M |
| 3300031903|Ga0307407_11709801 | Not Available | 501 | Open in IMG/M |
| 3300033434|Ga0316613_10659128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 716 | Open in IMG/M |
| 3300034384|Ga0372946_0032215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2331 | Open in IMG/M |
| 3300034644|Ga0370548_006222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1489 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.56% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 4.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.28% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.46% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.46% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 2.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.64% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.82% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.82% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.82% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.82% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.82% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003570 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_34 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003572 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Bulk_40 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005644 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300010079 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010101 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023078 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027257 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031098 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031100 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031423 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_01950380 | 2140918007 | Soil | MITEPSTERQRTPLQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV |
| cont_0118.00002040 | 2166559005 | Simulated | GSMITEPPTDGQRRPLQDIETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| F47_11418710 | 2170459009 | Grass Soil | MGKQGHCEDIETLYIGVATPAVRRAFVGYHRAESRLCAITKEV |
| F47_01309720 | 2170459009 | Grass Soil | RRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV |
| F47_02551980 | 2170459009 | Grass Soil | AEACSQDLGSMITEPPTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV |
| CNXas_10193042 | 3300000545 | Quercus Rhizosphere | ITERPTDGQRRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV* |
| JGI12662J13196_10192031 | 3300001081 | Forest Soil | YSQGLGSMITEPPTDGQRTPLQDFETLYIGEAEPAVVRRAFVGYDGAKSRLCAIAKEV* |
| JGI24752J21851_10663222 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTEPPTDGQRRPLQDIETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| JGI24743J22301_101304392 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | PTDGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| JGI24738J21930_100892751 | 3300002075 | Corn Rhizosphere | LQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| JGI24036J26619_101171952 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | GSMITEPPTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV* |
| JGI24033J26618_10780791 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | PLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| JGI20214J51650_106327841 | 3300003541 | Wetland | MITEPSADGQRTPLQDIETLYIGGAEPAVVRRVRVGHDGAKSRLCAIAKKINDH |
| Ga0007418J51697_10194501 | 3300003570 | Avena Fatua Rhizosphere | QTRPLQDFETLYIGVATPAVRRGFVGYQRAESRLCAIAKEV* |
| Ga0007424J51698_10300361 | 3300003572 | Avena Fatua Rhizosphere | QRRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0066683_105237632 | 3300005172 | Soil | MITEPPTDGAKNALRDFETLYIGGAELAVVRRALVGYDGAKSRLCAIARKI* |
| Ga0070674_1000490334 | 3300005356 | Miscanthus Rhizosphere | DGWANKAMQDFETLYIGVATPVVRRAFVGYHRAESRLCAIAKEV* |
| Ga0070659_1006684903 | 3300005366 | Corn Rhizosphere | TEPPTDGQTRPLQDFETLYIGVATPAVRRAFIGYHRAESRLCAIAKEV* |
| Ga0070667_1021049221 | 3300005367 | Switchgrass Rhizosphere | TEPPTDGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0066682_109380652 | 3300005450 | Soil | TDGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0070678_1000742094 | 3300005456 | Miscanthus Rhizosphere | MITEPPTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAK |
| Ga0070665_1002785013 | 3300005548 | Switchgrass Rhizosphere | RPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV* |
| Ga0070665_1024602771 | 3300005548 | Switchgrass Rhizosphere | MITGRPTDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0066695_107244591 | 3300005553 | Soil | AYSQGLGSMITEPPTDGQRTPLQDFETVYIGEVEPAVVRRAFVGCHGAKSRLCAIAKEV* |
| Ga0066706_106939922 | 3300005598 | Soil | MVTEPPTDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV* |
| Ga0075036_10301301 | 3300005644 | Permafrost Soil | FETLYIGGAEPAVVRRALSAVSWQNHDFAKSRLC* |
| Ga0068866_104631251 | 3300005718 | Miscanthus Rhizosphere | EPPTDGQTRPLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0068866_112936532 | 3300005718 | Miscanthus Rhizosphere | MITEPRTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKE |
| Ga0068870_105066013 | 3300005840 | Miscanthus Rhizosphere | FETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0068863_1017759183 | 3300005841 | Switchgrass Rhizosphere | RTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV* |
| Ga0080026_101986473 | 3300005952 | Permafrost Soil | ETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKKV* |
| Ga0066789_101053322 | 3300005994 | Soil | LQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV* |
| Ga0066652_1006044103 | 3300006046 | Soil | RPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV* |
| Ga0075029_1004076941 | 3300006052 | Watersheds | MITEPSADGQRTPLQDIETLYIGGAEPAVVRWVHVGHDGANSRRCAIAKEI* |
| Ga0075037_11058041 | 3300006426 | Permafrost Soil | QRTPLQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV* |
| Ga0075433_115470592 | 3300006852 | Populus Rhizosphere | RPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0068865_1021086781 | 3300006881 | Miscanthus Rhizosphere | TDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV* |
| Ga0079216_118254611 | 3300006918 | Agricultural Soil | MITEPPTDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV* |
| Ga0105247_117189202 | 3300009101 | Switchgrass Rhizosphere | RPLQDFETLYIGVATPAVRRGFVGYHRAESRLCATAKEV* |
| Ga0099792_108417402 | 3300009143 | Vadose Zone Soil | MITEPSTERQRTPLQDFETLYIGGGEPARVRRAFVGYDGAKSRLRAIAKEV* |
| Ga0116138_11418632 | 3300009552 | Peatland | MITEPPADGQRTPLQDIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV* |
| Ga0127436_1534121 | 3300010079 | Grasslands Soil | QEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0127481_10508452 | 3300010101 | Grasslands Soil | QDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV* |
| Ga0127449_11030133 | 3300010117 | Grasslands Soil | PLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0127484_11382681 | 3300010134 | Grasslands Soil | TRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0127483_11299801 | 3300010142 | Grasslands Soil | RDFETLYIGGAAPAVVRRALVGYDGAKSRLCAIARKV* |
| Ga0134080_101985843 | 3300010333 | Grasslands Soil | EFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0126360_11346301 | 3300010854 | Boreal Forest Soil | YSQGLGSMITEPSTERQRTPLQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV* |
| Ga0126358_10490761 | 3300010856 | Boreal Forest Soil | RTPLQDFETLYIGGAEPARVRWAFVGYDGAKSRLCAIAKEV* |
| Ga0126345_10542692 | 3300010858 | Boreal Forest Soil | QRTPLQEIETLYIGGAEPAVVRRARLGYGGAKSRLSAIAKEV* |
| Ga0126349_10419121 | 3300010861 | Boreal Forest Soil | QRNALQDVETLYIGVATPAVRRGLIGTDRAESRLCAIELN* |
| Ga0126346_10143451 | 3300010865 | Boreal Forest Soil | QRRPLQDFETLYIGVASPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0126359_14444691 | 3300010869 | Boreal Forest Soil | ERQRTPLQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV* |
| Ga0137425_11331571 | 3300011422 | Soil | TDGQRRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0137376_106680901 | 3300012208 | Vadose Zone Soil | RPLQDFETLYIGVATPAVRRGFVGYQRAESRLCAIAKEV* |
| Ga0134040_11923532 | 3300012389 | Grasslands Soil | DFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0134043_12338321 | 3300012392 | Grasslands Soil | TRPLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0134051_12069161 | 3300012398 | Grasslands Soil | KNALRDFETLYIGGAELAVVRRALVGYDGAKSRLCAIARKV* |
| Ga0137398_106633472 | 3300012683 | Vadose Zone Soil | MITEPPTDGQRRPLQDFETLYIGVATPAVRRAFIGYHRAESSLCAIAKEV* |
| Ga0137413_104782941 | 3300012924 | Vadose Zone Soil | MGKRRPLQDFETLYIGVATPAVRRAFIGYHRAESSLCAIAKEV* |
| Ga0137416_114147222 | 3300012927 | Vadose Zone Soil | MITEPPTDGQRTPLQDFETLYIGEAEPAVVRRAFVGYDGAKSRLCAIAKEV* |
| Ga0181531_104674831 | 3300014169 | Bog | EPSADGQRTPLQDIETLYIGDAEPAVVRRVRVGHHVAKSRLCAIAKEV* |
| Ga0137411_11173501 | 3300015052 | Vadose Zone Soil | LQEFETLYIGGAEPARRSLGPFVGYDGAKSRLCAIAKRV* |
| Ga0173483_105757961 | 3300015077 | Soil | PPTDGQTRPLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV* |
| Ga0173480_108727472 | 3300015200 | Soil | MITEPATDGQRTPLQDFETLYIGETEPAVVRRAFVGYDGAKSRLCAIAKEV* |
| Ga0173478_101866402 | 3300015201 | Soil | MVTEPATDGQRTPLQDFETLYIGETEPAVVRRAFVGYDGAKSRLCAIAKEV* |
| Ga0137412_110179051 | 3300015242 | Vadose Zone Soil | MITEPPTDGQRTPLQDIETLYIGGAEPAVVRRVRVGHDGAKSRLCAIAKEIH |
| Ga0187885_101657273 | 3300018025 | Peatland | MITEPPADGQRTPLQDIETLYIGDAEPAVVRQVRVGHDVAKSRLCAIAKEV |
| Ga0187869_104074341 | 3300018030 | Peatland | MITEPPADGQRTPLQDIETLYIGDAEPAVVRRVRVSHDVAKSRLCAIAKEV |
| Ga0187855_104614882 | 3300018038 | Peatland | MITEPPADGQRTPLQDIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV |
| Ga0187871_105956932 | 3300018042 | Peatland | QGLGSMITEPPADGQRTPLQDIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV |
| Ga0181506_12122382 | 3300019260 | Peatland | TPLQDFETLYIGGAEPAVVRQVRVGHDGAKSRLCAIAKEV |
| Ga0184647_10348622 | 3300019263 | Groundwater Sediment | GQTRPLQDFETLYIGVATPAVRRGFVGYQRAESRLCAIAKEV |
| Ga0137408_13514143 | 3300019789 | Vadose Zone Soil | TEPPTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0193743_10137275 | 3300019889 | Soil | MDGQRTPLQDFETLYIGEVEPAVVRRAFVGHVLVGYVLQNQDLAKSRLCAIAKEV |
| Ga0193757_10314272 | 3300020008 | Soil | LGSMITEPLTDKQRTPLQEFETLYIGGAEPARRSLGPFVGYDGAKSRLCAIAKRV |
| Ga0179594_102253043 | 3300020170 | Vadose Zone Soil | PLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV |
| Ga0179585_10790951 | 3300021307 | Vadose Zone Soil | QRTPLQDFETLYIGEVEPAVVRRASVGCHGAKSRLCAIAKEV |
| Ga0179958_10040141 | 3300021315 | Vadose Zone Soil | ITEPPRDGQRTPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0210402_112001561 | 3300021478 | Soil | GQRNALQDVETLYIGVATPAVRRGLIGTDRAESRLCAIELN |
| Ga0242648_10592352 | 3300022506 | Soil | TPLQDIETLYIGDAEHAVVRRVRVGRDGTKSRLCAIAKEV |
| Ga0242663_11416552 | 3300022523 | Soil | QRTPLQDIETLYIGDAEHAVVRRVRVGRDGTKSRLCAIAKEV |
| Ga0242653_10973332 | 3300022712 | Soil | LQDIETLYIGDAEPTVVRRVRLGHDGAKSRLCAIAKEV |
| Ga0242661_10853581 | 3300022717 | Soil | ALQDFETLYIGVAEPAVVRWALVGDDGAKSRLCAIAKEV |
| Ga0242665_100942043 | 3300022724 | Soil | TPLQDVETLYIGGAEPAVVRWVRVGHDGAKSRLCAIAKEI |
| Ga0247756_11188132 | 3300023078 | Plant Litter | EPSTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0207697_105288522 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGSMITEPATDGQRTPLQDFETLYIGETEPAVVRRAFVGYDGAKSRLCAIAKEV |
| Ga0207692_109721742 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQRTPLQDIETLYIGGAEPAVVRRVRVGHDGAKSRLCAIAKE |
| Ga0207680_113129391 | 3300025903 | Switchgrass Rhizosphere | EPPTDGQTRPLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV |
| Ga0207645_100761351 | 3300025907 | Miscanthus Rhizosphere | QDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV |
| Ga0207705_106088931 | 3300025909 | Corn Rhizosphere | TDGQRRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV |
| Ga0207701_115832291 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | TDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0207679_103414191 | 3300025945 | Corn Rhizosphere | DGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV |
| Ga0207677_119180441 | 3300026023 | Miscanthus Rhizosphere | LQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKE |
| Ga0208996_10562512 | 3300027257 | Forest Soil | PATDGQRTPLQDFETLYIGGAEPAVVRWAFVGYDGAKSRLCAIAKEV |
| Ga0208637_10423091 | 3300027401 | Soil | PTDGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV |
| Ga0208998_10475881 | 3300027524 | Forest Soil | YSQGMGSMITEPATDGQRTPLQDFETLYIGGAEPAVVRRAFVGYDGAKSRLCAIAKEV |
| Ga0209736_11112613 | 3300027660 | Forest Soil | DFESLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0209011_10998681 | 3300027678 | Forest Soil | MITEPPTDGQRTPLQDFETLYIGEAEPAVVRRAFVGYDGAKSRLCAI |
| Ga0209481_106647731 | 3300027880 | Populus Rhizosphere | RPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV |
| Ga0209068_109447762 | 3300027894 | Watersheds | FETLYIGGAEPARRSPGPFVGYDGAKSRLCAIAKRV |
| Ga0209067_106162441 | 3300027898 | Watersheds | MITEPSADGQRTPLQDIETLYIGGAEPAVVRWVHVGHDGANSRRCAIAKEI |
| Ga0311347_103703141 | 3300029923 | Fen | EFETLYIGVAASAVRRGFVGYHWAESRLCAIAKEV |
| Ga0302181_104210442 | 3300030056 | Palsa | DIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV |
| Ga0075384_112723341 | 3300030841 | Soil | QRRPLQDFETLYIGVATPAVRRAFIGYLRAESSLCAIAKEV |
| Ga0265723_10318101 | 3300030872 | Soil | LQEFETLYIGVATSAVRRAFVGYHRAESRLCAIAKEV |
| Ga0308200_11095361 | 3300030905 | Soil | QTRPLQDFETLYIGVAAPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0265768_1083981 | 3300030963 | Soil | RTPLQDIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV |
| Ga0308183_10724713 | 3300030988 | Soil | RQRTPLQDFETLYIGGAEPAVVRWAFAGNGEAKSRQCATANRD |
| Ga0308183_11496902 | 3300030988 | Soil | MVTEPATDGQRTPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0308199_11573091 | 3300031094 | Soil | RTPLQEFETLYIGGAEPARRSLGPFVGYDGAKSRLCAIAKRV |
| Ga0308191_10233921 | 3300031098 | Soil | QRTPLQEFETLYIGGAEPARRSLGPFVGYDGAKSRLCAIAKRV |
| Ga0308181_11346951 | 3300031099 | Soil | TDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0308180_10123203 | 3300031100 | Soil | RPLQDFESLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0308194_102958802 | 3300031421 | Soil | DGQRRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0308186_10411051 | 3300031422 | Soil | RTPLQDFETLYIGHAEPARVRRAFVGYDGAKSRLCAIAKRV |
| Ga0308177_10259382 | 3300031423 | Soil | QTRPLQDFETLYIGVATPAVRRGFVGYQRAESRLCAIAKEV |
| Ga0307476_103797853 | 3300031715 | Hardwood Forest Soil | LQDIETLYIGDAEPAVVRRVHVGRDGAKSRLCAIAKEV |
| Ga0307407_117098012 | 3300031903 | Rhizosphere | MITERPTDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV |
| Ga0316613_106591283 | 3300033434 | Soil | FETLYIGGAEPAVVRRAFVGDDGAKSRLCVIAKEV |
| Ga0372946_0032215_1725_1880 | 3300034384 | Soil | MITEPATDGQRTPLQDFETLYIGGAEPAVVRRASIGYDGAKSRLCATAKEV |
| Ga0370548_006222_684_842 | 3300034644 | Soil | MITEPLTDKQRTPLQEFETLYIGGAEPARRSPWPFVGYDGAKSRLCAIAKRV |
| ⦗Top⦘ |