


| Basic Information | |
|---|---|
| Family ID | F071193 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG |
| Number of Associated Samples | 59 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.43 % |
| % of genes near scaffold ends (potentially truncated) | 27.05 % |
| % of genes from short scaffolds (< 2000 bps) | 81.97 % |
| Associated GOLD sequencing projects | 42 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.754 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (78.688 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.902 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.164 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.39% β-sheet: 11.11% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 3.28 |
| PF06074 | DUF935 | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG4383 | Mu-like prophage protein gp29 | Mobilome: prophages, transposons [X] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.75 % |
| All Organisms | root | All Organisms | 35.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10067605 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10205292 | Not Available | 657 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10099297 | Not Available | 958 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10017756 | All Organisms → Viruses → Predicted Viral | 3790 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10248127 | Not Available | 522 | Open in IMG/M |
| 3300006025|Ga0075474_10010259 | Not Available | 3590 | Open in IMG/M |
| 3300006025|Ga0075474_10180795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300006026|Ga0075478_10009630 | Not Available | 3303 | Open in IMG/M |
| 3300006026|Ga0075478_10026988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 1922 | Open in IMG/M |
| 3300006027|Ga0075462_10082886 | Not Available | 1004 | Open in IMG/M |
| 3300006637|Ga0075461_10017288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 2380 | Open in IMG/M |
| 3300006752|Ga0098048_1012457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 2968 | Open in IMG/M |
| 3300006802|Ga0070749_10140033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1412 | Open in IMG/M |
| 3300006802|Ga0070749_10284681 | Not Available | 930 | Open in IMG/M |
| 3300006810|Ga0070754_10073720 | All Organisms → Viruses → Predicted Viral | 1738 | Open in IMG/M |
| 3300006810|Ga0070754_10077741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 1680 | Open in IMG/M |
| 3300006810|Ga0070754_10122845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 1263 | Open in IMG/M |
| 3300006810|Ga0070754_10136221 | Not Available | 1185 | Open in IMG/M |
| 3300006810|Ga0070754_10150187 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300006810|Ga0070754_10183853 | Not Available | 982 | Open in IMG/M |
| 3300006810|Ga0070754_10232731 | Not Available | 847 | Open in IMG/M |
| 3300006810|Ga0070754_10307346 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 710 | Open in IMG/M |
| 3300006810|Ga0070754_10342085 | Not Available | 663 | Open in IMG/M |
| 3300006810|Ga0070754_10482972 | Not Available | 534 | Open in IMG/M |
| 3300006810|Ga0070754_10516905 | Not Available | 513 | Open in IMG/M |
| 3300006867|Ga0075476_10063786 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
| 3300006867|Ga0075476_10244902 | Not Available | 641 | Open in IMG/M |
| 3300006867|Ga0075476_10293491 | Not Available | 571 | Open in IMG/M |
| 3300006868|Ga0075481_10021692 | Not Available | 2531 | Open in IMG/M |
| 3300006868|Ga0075481_10097414 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300006868|Ga0075481_10228014 | Not Available | 661 | Open in IMG/M |
| 3300006869|Ga0075477_10444177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300006870|Ga0075479_10288266 | Not Available | 645 | Open in IMG/M |
| 3300006874|Ga0075475_10203476 | Not Available | 847 | Open in IMG/M |
| 3300006874|Ga0075475_10347956 | Not Available | 603 | Open in IMG/M |
| 3300006916|Ga0070750_10131303 | Not Available | 1144 | Open in IMG/M |
| 3300006916|Ga0070750_10199576 | Not Available | 886 | Open in IMG/M |
| 3300006916|Ga0070750_10213166 | Not Available | 850 | Open in IMG/M |
| 3300006916|Ga0070750_10350396 | Not Available | 623 | Open in IMG/M |
| 3300006916|Ga0070750_10452555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300006919|Ga0070746_10096031 | All Organisms → Viruses → Predicted Viral | 1483 | Open in IMG/M |
| 3300006919|Ga0070746_10233249 | Not Available | 865 | Open in IMG/M |
| 3300006919|Ga0070746_10306419 | Not Available | 728 | Open in IMG/M |
| 3300006919|Ga0070746_10377673 | Not Available | 638 | Open in IMG/M |
| 3300006919|Ga0070746_10413460 | Not Available | 603 | Open in IMG/M |
| 3300006922|Ga0098045_1070866 | Not Available | 841 | Open in IMG/M |
| 3300007234|Ga0075460_10059056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1427 | Open in IMG/M |
| 3300007236|Ga0075463_10133246 | Not Available | 802 | Open in IMG/M |
| 3300007236|Ga0075463_10251915 | Not Available | 567 | Open in IMG/M |
| 3300007344|Ga0070745_1120504 | Not Available | 1011 | Open in IMG/M |
| 3300007344|Ga0070745_1204127 | Not Available | 729 | Open in IMG/M |
| 3300007344|Ga0070745_1214210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 707 | Open in IMG/M |
| 3300007344|Ga0070745_1224544 | Not Available | 687 | Open in IMG/M |
| 3300007344|Ga0070745_1296660 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 576 | Open in IMG/M |
| 3300007346|Ga0070753_1054089 | All Organisms → Viruses → Predicted Viral | 1643 | Open in IMG/M |
| 3300007346|Ga0070753_1112281 | Not Available | 1055 | Open in IMG/M |
| 3300007346|Ga0070753_1143835 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 906 | Open in IMG/M |
| 3300007346|Ga0070753_1157557 | Not Available | 858 | Open in IMG/M |
| 3300007346|Ga0070753_1175107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 803 | Open in IMG/M |
| 3300007346|Ga0070753_1204448 | Not Available | 730 | Open in IMG/M |
| 3300007539|Ga0099849_1026217 | Not Available | 2513 | Open in IMG/M |
| 3300007540|Ga0099847_1066535 | Not Available | 1119 | Open in IMG/M |
| 3300007640|Ga0070751_1218602 | Not Available | 734 | Open in IMG/M |
| 3300007640|Ga0070751_1268358 | Not Available | 643 | Open in IMG/M |
| 3300007640|Ga0070751_1291943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300008012|Ga0075480_10139574 | All Organisms → Viruses → Predicted Viral | 1325 | Open in IMG/M |
| 3300008012|Ga0075480_10428648 | Not Available | 647 | Open in IMG/M |
| 3300008012|Ga0075480_10479967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300008012|Ga0075480_10519197 | Not Available | 571 | Open in IMG/M |
| 3300009507|Ga0115572_10202890 | Not Available | 1145 | Open in IMG/M |
| 3300010149|Ga0098049_1096708 | Not Available | 925 | Open in IMG/M |
| 3300010296|Ga0129348_1007379 | All Organisms → Viruses → Predicted Viral | 4001 | Open in IMG/M |
| 3300010297|Ga0129345_1300060 | Not Available | 556 | Open in IMG/M |
| 3300011253|Ga0151671_1024758 | Not Available | 647 | Open in IMG/M |
| 3300017697|Ga0180120_10214190 | Not Available | 793 | Open in IMG/M |
| 3300017763|Ga0181410_1141447 | Not Available | 679 | Open in IMG/M |
| 3300017771|Ga0181425_1238110 | Not Available | 565 | Open in IMG/M |
| 3300019756|Ga0194023_1041584 | Not Available | 927 | Open in IMG/M |
| 3300019756|Ga0194023_1057346 | Not Available | 783 | Open in IMG/M |
| 3300020166|Ga0206128_1097833 | Not Available | 1277 | Open in IMG/M |
| 3300021373|Ga0213865_10216187 | Not Available | 938 | Open in IMG/M |
| 3300021425|Ga0213866_10032089 | Not Available | 3054 | Open in IMG/M |
| 3300022065|Ga0212024_1012520 | Not Available | 1292 | Open in IMG/M |
| 3300022065|Ga0212024_1058820 | Not Available | 679 | Open in IMG/M |
| 3300022071|Ga0212028_1002126 | Not Available | 2349 | Open in IMG/M |
| 3300022167|Ga0212020_1050150 | Not Available | 708 | Open in IMG/M |
| 3300022183|Ga0196891_1003120 | All Organisms → Viruses → Predicted Viral | 3533 | Open in IMG/M |
| 3300022183|Ga0196891_1098010 | Not Available | 516 | Open in IMG/M |
| 3300022187|Ga0196899_1010827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 3600 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10662525 | Not Available | 504 | Open in IMG/M |
| 3300025070|Ga0208667_1005578 | All Organisms → Viruses → Predicted Viral | 3370 | Open in IMG/M |
| 3300025070|Ga0208667_1014257 | Not Available | 1703 | Open in IMG/M |
| 3300025083|Ga0208791_1007711 | All Organisms → Viruses → Predicted Viral | 2720 | Open in IMG/M |
| 3300025098|Ga0208434_1014624 | All Organisms → Viruses → Predicted Viral | 2067 | Open in IMG/M |
| 3300025108|Ga0208793_1034592 | Not Available | 1654 | Open in IMG/M |
| 3300025653|Ga0208428_1018031 | Not Available | 2352 | Open in IMG/M |
| 3300025653|Ga0208428_1139884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300025653|Ga0208428_1145255 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 638 | Open in IMG/M |
| 3300025671|Ga0208898_1065572 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300025671|Ga0208898_1067302 | Not Available | 1208 | Open in IMG/M |
| 3300025671|Ga0208898_1085139 | Not Available | 1004 | Open in IMG/M |
| 3300025671|Ga0208898_1109844 | Not Available | 819 | Open in IMG/M |
| 3300025671|Ga0208898_1144573 | Not Available | 651 | Open in IMG/M |
| 3300025759|Ga0208899_1031875 | Not Available | 2455 | Open in IMG/M |
| 3300025759|Ga0208899_1188880 | Not Available | 665 | Open in IMG/M |
| 3300025769|Ga0208767_1019078 | Not Available | 3878 | Open in IMG/M |
| 3300025769|Ga0208767_1160745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 804 | Open in IMG/M |
| 3300025815|Ga0208785_1010125 | Not Available | 3412 | Open in IMG/M |
| 3300025840|Ga0208917_1208021 | Not Available | 648 | Open in IMG/M |
| 3300025840|Ga0208917_1250113 | Not Available | 569 | Open in IMG/M |
| 3300025853|Ga0208645_1021330 | All Organisms → Viruses → Predicted Viral | 3559 | Open in IMG/M |
| 3300025853|Ga0208645_1105673 | All Organisms → Viruses → Predicted Viral | 1155 | Open in IMG/M |
| 3300025889|Ga0208644_1077931 | Not Available | 1710 | Open in IMG/M |
| 3300034374|Ga0348335_015423 | Not Available | 3918 | Open in IMG/M |
| 3300034374|Ga0348335_053053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 1547 | Open in IMG/M |
| 3300034374|Ga0348335_087859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1023 | Open in IMG/M |
| 3300034374|Ga0348335_120564 | Not Available | 778 | Open in IMG/M |
| 3300034375|Ga0348336_021489 | Not Available | 3318 | Open in IMG/M |
| 3300034418|Ga0348337_041749 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
| 3300034418|Ga0348337_057714 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
| 3300034418|Ga0348337_079160 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300034418|Ga0348337_173806 | Not Available | 573 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 78.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.56% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.10% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.46% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.64% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.64% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.64% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.82% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.82% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100676053 | 3300000101 | Marine | MQQTSKQALTANRIAATVTATKPVKIGGSFVLDFSNPRYAKRE* |
| DelMOSum2010_102052923 | 3300000101 | Marine | MQQTARQAVAARRIAATVTATKPVKIGGSFVLDFSDKPERRFIE* |
| DelMOSum2011_100992972 | 3300000115 | Marine | MGMTQQTSKQALMANRIAATVTATKPVKIGSVSVLDFSDRPKRRFIE* |
| DelMOWin2010_100177564 | 3300000117 | Marine | MQQTNKQALAASRVAATVEAAKPVKIGNSFVLDFSNPRHVKRE* |
| DelMOWin2010_102481271 | 3300000117 | Marine | MQQTSKQALTANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE* |
| Ga0075474_100102597 | 3300006025 | Aqueous | MQQTSKQALAANRIAATVEATKPVKIGNSFVLDFSSKPKRRFTG* |
| Ga0075474_101807953 | 3300006025 | Aqueous | MVKQQANKQALAANRVAATVEAAKPVKIGSSYVLDFSSKPKRRFTG* |
| Ga0075478_100096301 | 3300006026 | Aqueous | MQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSSKPKRRFTG* |
| Ga0075478_100269881 | 3300006026 | Aqueous | MQQTSKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKRRFTG* |
| Ga0075462_100828862 | 3300006027 | Aqueous | MQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG* |
| Ga0075461_100172887 | 3300006637 | Aqueous | MGLKQQTTRQALIANRIAATVEAAKPTKIGNSFVLDFSDRPKRRFIE* |
| Ga0098048_10124572 | 3300006752 | Marine | MVKQQTSKQALAANRIAATVTATKPVKIGGSFVLDFSARPKRRFTG* |
| Ga0070749_101400334 | 3300006802 | Aqueous | MVMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG* |
| Ga0070749_102846811 | 3300006802 | Aqueous | MQQTSKQALAANRVAETVEAAKPVKIGSSYVLDFSNKPKRRFTG* |
| Ga0070754_100737203 | 3300006810 | Aqueous | MQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE* |
| Ga0070754_100777412 | 3300006810 | Aqueous | MGLKQQTTRQALIANRIAATVEAAKPTKIGNSFLLDFSDRPKRRFIE* |
| Ga0070754_101228454 | 3300006810 | Aqueous | MQQANKQALAANRVAATVEAAKPIKIGSSYVLDFSDKPKRRFTG* |
| Ga0070754_101362212 | 3300006810 | Aqueous | MQQTTRQALTANRIAATVEATKPKKIGNSFVLDFSNPRYAKRE* |
| Ga0070754_101501872 | 3300006810 | Aqueous | MVKQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG* |
| Ga0070754_101838533 | 3300006810 | Aqueous | MVMQQTTKRALAANRIAATVEAAKPVKIGNSFVLDFSNKPKRRFTG* |
| Ga0070754_102327312 | 3300006810 | Aqueous | MQQTTKQALTASRIAATVEATKPMKIGNSFVLDFSNPRHVKRE* |
| Ga0070754_103073462 | 3300006810 | Aqueous | MVMQQTTKQALTASRVAATVEATKPMKIGNSFVLDFSDKPKRRFTG* |
| Ga0070754_103420852 | 3300006810 | Aqueous | MVMQQANKQALAASRIAATVEAAKPVKIGSSFVLDFSSKPKRRFTG* |
| Ga0070754_104829723 | 3300006810 | Aqueous | MQQANKQALAASRLAATVEATKPVKIGSSYVLDFSNKPKRRFTG* |
| Ga0070754_105169052 | 3300006810 | Aqueous | MQQTSKQALAASRIAATVEATKPVKIGNSFVLDFSNPRHVK |
| Ga0075476_100637863 | 3300006867 | Aqueous | MVKQQANKRALTANRVAATVEATKPVKIGSSYVLDFSDKPKRRFTG* |
| Ga0075476_102449022 | 3300006867 | Aqueous | MVMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE* |
| Ga0075476_102934912 | 3300006867 | Aqueous | MQQANKQALAASRIAATVEATKPVKIGNSFVLDFSSKPKRRFTG* |
| Ga0075481_100216922 | 3300006868 | Aqueous | MQQTNRQALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE* |
| Ga0075481_100974142 | 3300006868 | Aqueous | MVMQQTTRQALTANRIAATVEATKPKKIGNSFVLDFSNPRYAKRE* |
| Ga0075481_102280142 | 3300006868 | Aqueous | TTKQALTANRIAATVTATKPVKVGGSFVLDFSDRPKRRFIE* |
| Ga0075477_104441771 | 3300006869 | Aqueous | MVKQQANKQALAASRIAATVAATKPMKIGNSFVLDFSDKPK |
| Ga0075479_102882661 | 3300006870 | Aqueous | MVKQQANKRALTANRVAATVEATKPVKIGSSYVLDFSSKPKRRFTG* |
| Ga0075475_102034762 | 3300006874 | Aqueous | MQQTTKQALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE* |
| Ga0075475_103479561 | 3300006874 | Aqueous | MQQTTKQALAANRVAATVEAAKPVKIGSSFVLDFSSKPKRRFTG* |
| Ga0070750_101313032 | 3300006916 | Aqueous | MGLKQQVTRQALTANRIAATVEAAKPVKIGSSYVLDFSDKPERRFTD* |
| Ga0070750_101995762 | 3300006916 | Aqueous | MQQASKQALAANRIAATVEATKPTKIGNSFVLDFSNPRYAKRE* |
| Ga0070750_102131661 | 3300006916 | Aqueous | MVMQQTNKQALAANRIAATVEAAKPVKIGNSFVLDFSNKPKRRFTG* |
| Ga0070750_103503962 | 3300006916 | Aqueous | MQQTNKQALAANRIAATVEATKPVKIGNSFVLDFSNKPKRRFTG* |
| Ga0070750_104525554 | 3300006916 | Aqueous | MVMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPK |
| Ga0070746_100960314 | 3300006919 | Aqueous | MQQTSKQALAASRIAATVEATKPTKIGNSFVLDFSNPRHAKRE* |
| Ga0070746_102332491 | 3300006919 | Aqueous | MQQTTKRALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG* |
| Ga0070746_103064193 | 3300006919 | Aqueous | MVMQQANKQALAANRIAATVEATKPVKIGNSFVLDFSSKPKRRFTG* |
| Ga0070746_103776732 | 3300006919 | Aqueous | MQQTTKQALAANRVAATVAATKPMKIGNSFVLDFSDKPKRRFTG* |
| Ga0070746_104134601 | 3300006919 | Aqueous | MQQTTRQALAANRVAATVEATKPVKIGSSYVLDFSDKPKRRFTG* |
| Ga0098045_10708661 | 3300006922 | Marine | MVKQQTSKQALAANRIAATVTATKPVKIGGSFVLDFSARPKRR |
| Ga0075460_100590561 | 3300007234 | Aqueous | MELMQQTTKQALTASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG* |
| Ga0075463_101332462 | 3300007236 | Aqueous | MVMQQTTKQALTASRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG* |
| Ga0075463_102519151 | 3300007236 | Aqueous | MVKQQANKQALTANRVAATVEAAKPVKIGSSYVLDFSSKPKRRFTG* |
| Ga0070745_11205042 | 3300007344 | Aqueous | MQQTSKQALAASRIAATVEAAKPVKVGNSFVLDFSSKPRRRFIE* |
| Ga0070745_12041272 | 3300007344 | Aqueous | MQQTTKQALAASRIAATVEATKPMKIGNSFVLDFSNPRHVKRE* |
| Ga0070745_12142103 | 3300007344 | Aqueous | MQQTTKQALTASRVAATVEATKPMKIGNSFVLDFSDKPKRRFTG* |
| Ga0070745_12245442 | 3300007344 | Aqueous | MELMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG* |
| Ga0070745_12966601 | 3300007344 | Aqueous | MVMQQTTKQALTASRVAATVEAATPVKIGSSYVLD |
| Ga0070753_10540895 | 3300007346 | Aqueous | MQQTTKQALAASRVAATVAATKPMKIGNSFVLDFSDKPKRRFTG* |
| Ga0070753_11122811 | 3300007346 | Aqueous | MGLKQQVTRQALTANRIAATVEAAKPVKIGNSFVLDFSDRPKRRFIE* |
| Ga0070753_11438351 | 3300007346 | Aqueous | MQQTTKQALTASRVAATVEATKPVKIGSSYVLDFSDKPKRRFTG* |
| Ga0070753_11575571 | 3300007346 | Aqueous | MQQTTKQALAANRVAATVEAAKPVKIGNSFVLDFSSKPKRRFTG* |
| Ga0070753_11751072 | 3300007346 | Aqueous | MQQTTKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPK |
| Ga0070753_12044482 | 3300007346 | Aqueous | SGKHRLQGLGLMQQTTKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE* |
| Ga0099849_10262172 | 3300007539 | Aqueous | MQQTSKQALAANRIAATVEATKPTKIGNSFVLDFSNPRYAKRE* |
| Ga0099847_10665352 | 3300007540 | Aqueous | MGMMQQTSKQALMASRIAATVTATKPVKVGSSYVLDFSDKPKRRFIE* |
| Ga0070751_12186023 | 3300007640 | Aqueous | MQQTTKKALAANRVAATVEAAKPVKIGSSYVLDFSNKPKR |
| Ga0070751_12683581 | 3300007640 | Aqueous | MQQTTKQALTANRVAATVEAAKPVKIGNSFVLDFSDKPKRRFTG* |
| Ga0070751_12919432 | 3300007640 | Aqueous | MVKQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFT |
| Ga0075480_101395741 | 3300008012 | Aqueous | QQTTKQALTASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG* |
| Ga0075480_104286481 | 3300008012 | Aqueous | MQQTSKQALAASRIAATVEATKPMKIGNSFVLDFSNKPKRRFTG* |
| Ga0075480_104799671 | 3300008012 | Aqueous | MQQTTKQALTASRVAATVEATKPVKIGNSFVLDFSDKSKRRF |
| Ga0075480_105191971 | 3300008012 | Aqueous | MVMQQTSKQALAASRIAATVEATKPVKIGSSYVLDFSDKPKRRFTD* |
| Ga0115572_102028902 | 3300009507 | Pelagic Marine | MGMMQQTSKQALMASRIAATVAATKPVKIGSVSVLDFSDRPKRRFIE* |
| Ga0098049_10967084 | 3300010149 | Marine | MVKQQTSKQAQAARRIAATVEAAKPVKVGSSFVLDFSNPRHAKRE* |
| Ga0129348_10073791 | 3300010296 | Freshwater To Marine Saline Gradient | SKQALTANRVAATVEATKPVKIGNSFVLDFSNKPKRRFTG* |
| Ga0129345_13000601 | 3300010297 | Freshwater To Marine Saline Gradient | MVKQQTTKQALAANRVAATVEAAKPTKIGNSFVLDFSDKPKRRFTG* |
| Ga0151671_10247581 | 3300011253 | Marine | TTSQALASRRMAATVAATKPVKVGGSFVLDFSDRPKRRFIE* |
| Ga0180120_102141903 | 3300017697 | Freshwater To Marine Saline Gradient | MGLKQQTSKQALMANRIAATVEATKPTKIGSVSVLDFSDKPE |
| Ga0181410_11414472 | 3300017763 | Seawater | ALTANRIAATVTATKPVRVGSVSVLDFSNPRHAKRE |
| Ga0181425_12381101 | 3300017771 | Seawater | QALTANRLAATVTATKPVRVGSVSVLDFSARPKRRFTG |
| Ga0194023_10415841 | 3300019756 | Freshwater | MQQANKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKRRFTG |
| Ga0194023_10573462 | 3300019756 | Freshwater | MQQTTRQALTANRIAATVEATKPKKIGNSFVLDFSNPRYAKRE |
| Ga0206128_10978332 | 3300020166 | Seawater | MQQSKQALAASRIAATVTATKPVKIGGSFVLDFSNPRHAKRE |
| Ga0213865_102161872 | 3300021373 | Seawater | MGLKQQATRQALTANRIAATVTATKPVKIGNSFVLDFSNKSKRRFIE |
| Ga0213866_100320892 | 3300021425 | Seawater | MGLKQQTTRQALAANRIAATVEATKPTKIGSVSVLDFSDKPERRFTG |
| Ga0212024_10125202 | 3300022065 | Aqueous | MVMQQASKQALAANRIAATVEATKPTKIGNSFVLDFSNPRYAKRE |
| Ga0212024_10588203 | 3300022065 | Aqueous | MQQTTKQALAANRVAATVAATKPMKIGNSFVLAFS |
| Ga0212028_10021266 | 3300022071 | Aqueous | MQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSSKPKRRFTG |
| Ga0212020_10501503 | 3300022167 | Aqueous | MQQANKQALAANRVAATVEAAKPIKIGSSYVLDFSDKPKRRFTG |
| Ga0196891_10031204 | 3300022183 | Aqueous | MGLKQQTTRQALIANRIAATVEAAKPTKIGNSFVLDFSDRPKRRFIE |
| Ga0196891_10980102 | 3300022183 | Aqueous | MQQASKQALAANRIAATVEATKPTKIGNSFVLDFSNPRYAKRE |
| Ga0196899_10108277 | 3300022187 | Aqueous | MQQTSKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKRRFTG |
| (restricted) Ga0255048_106625252 | 3300024518 | Seawater | MMQQTSRQALAASRIAATVAATKPVKIGSSFVLDFSARPKRRF |
| Ga0208667_10055783 | 3300025070 | Marine | MVKQQTSKQALAANRIAATVTATKPVKIGGSFVLDFSARPKRRFTG |
| Ga0208667_10142574 | 3300025070 | Marine | QAQAARRIAATVEAAKPVKVGSSFVLDFSNPRHAKRE |
| Ga0208791_10077114 | 3300025083 | Marine | MVKRQTSKQALAANRIAATVEAAKPVKVGSSFVLDFSNPRHAKRE |
| Ga0208434_10146241 | 3300025098 | Marine | MVKQQTSKQAQAARRIAATVEAAKPVKVGSSFVLDFSNPRHAKR |
| Ga0208793_10345924 | 3300025108 | Marine | MVKQQTSKQAQAARRIAATVEAAKPVKVGSSFVLDFSNPRHAKRE |
| Ga0208428_10180312 | 3300025653 | Aqueous | MQQTTKQALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE |
| Ga0208428_11398843 | 3300025653 | Aqueous | MQQTTKQALTASRVAATVEAAKPVKIGSSYVLDFS |
| Ga0208428_11452553 | 3300025653 | Aqueous | MVMQQTTKQALTASRVAATVEATKPMKIGNSFVLDF |
| Ga0208898_10655721 | 3300025671 | Aqueous | MVMQQTSKQALAASRIAATVEAAKPVKVGNSFVLDFSSKPRRRFIE |
| Ga0208898_10673022 | 3300025671 | Aqueous | MQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE |
| Ga0208898_10851391 | 3300025671 | Aqueous | MQQTTKQALTASRVAATVEATKPMKIGNSFVLDFSDKPKRRFTG |
| Ga0208898_11098441 | 3300025671 | Aqueous | MQQTTKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKRRFTG |
| Ga0208898_11445731 | 3300025671 | Aqueous | MELMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG |
| Ga0208899_10318751 | 3300025759 | Aqueous | MQQTTKQALAANRVAATVAATKPMKIGNSFVLDFSDKPKRRFTG |
| Ga0208899_11888801 | 3300025759 | Aqueous | MVMQQTNKQALAANRIAATVEAAKPVKIGNSFVLDFSNKPKRRFTG |
| Ga0208767_10190782 | 3300025769 | Aqueous | MQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG |
| Ga0208767_11607453 | 3300025769 | Aqueous | MVMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFS |
| Ga0208785_10101257 | 3300025815 | Aqueous | MQQTSKQALAANRIAATVEATKPVKIGNSFVLDFSSKPKRRFTG |
| Ga0208917_12080211 | 3300025840 | Aqueous | LSRQHRFQGMVMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE |
| Ga0208917_12501131 | 3300025840 | Aqueous | ALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE |
| Ga0208645_10213301 | 3300025853 | Aqueous | MVMQQTTKQALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE |
| Ga0208645_11056731 | 3300025853 | Aqueous | MQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG |
| Ga0208644_10779312 | 3300025889 | Aqueous | MVMQQTNKQALAANRIAATVEAAKPVKIGNSFVLDFSNPRYAKRE |
| Ga0348335_015423_959_1096 | 3300034374 | Aqueous | MVMQQTTRQALTANRIAATVEATKPKKIGNSFVLDFSNPRYAKRE |
| Ga0348335_053053_1426_1545 | 3300034374 | Aqueous | MQQTSKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKR |
| Ga0348335_087859_806_946 | 3300034374 | Aqueous | MVMQQTTKQALTASRVAATVEATKPMKIGNSFVLDFSDKPKRRFTG |
| Ga0348335_120564_624_755 | 3300034374 | Aqueous | MQQTTKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE |
| Ga0348336_021489_3_113 | 3300034375 | Aqueous | MQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNP |
| Ga0348337_041749_12_152 | 3300034418 | Aqueous | MVMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG |
| Ga0348337_057714_1339_1473 | 3300034418 | Aqueous | MQQTSKQALAASRIAATVEATKPVKIGSSYVLDFSSKPKRRFTG |
| Ga0348337_079160_922_1062 | 3300034418 | Aqueous | MVKQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG |
| Ga0348337_173806_2_115 | 3300034418 | Aqueous | ALTANRIAATVEAAKPTKIGNSFVLDFSNKPKRRFTG |
| ⦗Top⦘ |