


| Basic Information | |
|---|---|
| Family ID | F071106 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.82 % |
| % of genes near scaffold ends (potentially truncated) | 97.54 % |
| % of genes from short scaffolds (< 2000 bps) | 90.16 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.361 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.852 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.967 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.984 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.73% Coil/Unstructured: 77.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF03824 | NicO | 24.59 |
| PF13386 | DsbD_2 | 7.38 |
| PF13795 | HupE_UreJ_2 | 6.56 |
| PF03773 | ArsP_1 | 4.92 |
| PF01717 | Meth_synt_2 | 3.28 |
| PF02683 | DsbD | 2.46 |
| PF07452 | CHRD | 1.64 |
| PF13145 | Rotamase_2 | 1.64 |
| PF00296 | Bac_luciferase | 1.64 |
| PF00753 | Lactamase_B | 1.64 |
| PF04392 | ABC_sub_bind | 0.82 |
| PF14885 | GHL15 | 0.82 |
| PF03150 | CCP_MauG | 0.82 |
| PF01471 | PG_binding_1 | 0.82 |
| PF02630 | SCO1-SenC | 0.82 |
| PF13546 | DDE_5 | 0.82 |
| PF01551 | Peptidase_M23 | 0.82 |
| PF04909 | Amidohydro_2 | 0.82 |
| PF13358 | DDE_3 | 0.82 |
| PF10282 | Lactonase | 0.82 |
| PF01548 | DEDD_Tnp_IS110 | 0.82 |
| PF01266 | DAO | 0.82 |
| PF13442 | Cytochrome_CBB3 | 0.82 |
| PF02899 | Phage_int_SAM_1 | 0.82 |
| PF13577 | SnoaL_4 | 0.82 |
| PF03466 | LysR_substrate | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 4.92 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 3.28 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.64 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.82 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.82 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.82 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.36 % |
| Unclassified | root | N/A | 1.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10423636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1390 | Open in IMG/M |
| 3300000956|JGI10216J12902_105878810 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 530 | Open in IMG/M |
| 3300004643|Ga0062591_100459538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis | 1077 | Open in IMG/M |
| 3300005176|Ga0066679_10847740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 580 | Open in IMG/M |
| 3300005177|Ga0066690_10058631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2371 | Open in IMG/M |
| 3300005180|Ga0066685_10550071 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005186|Ga0066676_10390883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 936 | Open in IMG/M |
| 3300005330|Ga0070690_101255163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis | 592 | Open in IMG/M |
| 3300005364|Ga0070673_102180806 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
| 3300005446|Ga0066686_10074701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2132 | Open in IMG/M |
| 3300005447|Ga0066689_10715564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 626 | Open in IMG/M |
| 3300005536|Ga0070697_102066361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 510 | Open in IMG/M |
| 3300005540|Ga0066697_10700908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300005549|Ga0070704_101042057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300005555|Ga0066692_10776203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300005575|Ga0066702_10633970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis | 640 | Open in IMG/M |
| 3300005617|Ga0068859_100490034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1324 | Open in IMG/M |
| 3300005719|Ga0068861_100902431 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005764|Ga0066903_100355408 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| 3300005843|Ga0068860_101220807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 772 | Open in IMG/M |
| 3300005844|Ga0068862_101830731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300006049|Ga0075417_10150815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis | 1082 | Open in IMG/M |
| 3300006755|Ga0079222_10635780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis | 825 | Open in IMG/M |
| 3300006794|Ga0066658_10188362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis | 1083 | Open in IMG/M |
| 3300006845|Ga0075421_101624414 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006852|Ga0075433_10021546 | All Organisms → cellular organisms → Bacteria | 5405 | Open in IMG/M |
| 3300006852|Ga0075433_11334945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300006854|Ga0075425_101965462 | Not Available | 654 | Open in IMG/M |
| 3300006871|Ga0075434_100501668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1234 | Open in IMG/M |
| 3300007255|Ga0099791_10118503 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300009038|Ga0099829_10302360 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1312 | Open in IMG/M |
| 3300009088|Ga0099830_11011618 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009090|Ga0099827_10571661 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 974 | Open in IMG/M |
| 3300009137|Ga0066709_100233650 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
| 3300009147|Ga0114129_10080449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4529 | Open in IMG/M |
| 3300009147|Ga0114129_10501326 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1586 | Open in IMG/M |
| 3300009162|Ga0075423_11172217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 819 | Open in IMG/M |
| 3300009176|Ga0105242_12237606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 592 | Open in IMG/M |
| 3300009177|Ga0105248_10781114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1078 | Open in IMG/M |
| 3300009553|Ga0105249_13269178 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300009678|Ga0105252_10008013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3802 | Open in IMG/M |
| 3300009810|Ga0105088_1074473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300010303|Ga0134082_10562797 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010336|Ga0134071_10718786 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300010358|Ga0126370_10389089 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1141 | Open in IMG/M |
| 3300010359|Ga0126376_10475298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1149 | Open in IMG/M |
| 3300010360|Ga0126372_10233374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1563 | Open in IMG/M |
| 3300010360|Ga0126372_10592363 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300010360|Ga0126372_12997137 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010361|Ga0126378_11878608 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300010366|Ga0126379_12951970 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010376|Ga0126381_104061190 | Not Available | 569 | Open in IMG/M |
| 3300010403|Ga0134123_11933767 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 647 | Open in IMG/M |
| 3300011416|Ga0137422_1006366 | All Organisms → cellular organisms → Bacteria | 2674 | Open in IMG/M |
| 3300012096|Ga0137389_11033811 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 704 | Open in IMG/M |
| 3300012096|Ga0137389_11236412 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012189|Ga0137388_10493771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
| 3300012199|Ga0137383_10345516 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012202|Ga0137363_11132009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 666 | Open in IMG/M |
| 3300012205|Ga0137362_11079727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 682 | Open in IMG/M |
| 3300012207|Ga0137381_10053093 | All Organisms → cellular organisms → Bacteria | 3351 | Open in IMG/M |
| 3300012349|Ga0137387_10509593 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300012350|Ga0137372_10362207 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1107 | Open in IMG/M |
| 3300012359|Ga0137385_11009214 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 686 | Open in IMG/M |
| 3300012360|Ga0137375_11311766 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 545 | Open in IMG/M |
| 3300012582|Ga0137358_10703990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 675 | Open in IMG/M |
| 3300012918|Ga0137396_10233283 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300012927|Ga0137416_10653000 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300012929|Ga0137404_11369850 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 653 | Open in IMG/M |
| 3300013306|Ga0163162_12882771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 553 | Open in IMG/M |
| 3300014325|Ga0163163_12993911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
| 3300015356|Ga0134073_10235724 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 625 | Open in IMG/M |
| 3300015373|Ga0132257_100456224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1562 | Open in IMG/M |
| 3300016341|Ga0182035_10341564 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1241 | Open in IMG/M |
| 3300016357|Ga0182032_10671794 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300016404|Ga0182037_10642084 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300016404|Ga0182037_11569949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 585 | Open in IMG/M |
| 3300016445|Ga0182038_10536435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1003 | Open in IMG/M |
| 3300017657|Ga0134074_1070179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1191 | Open in IMG/M |
| 3300018433|Ga0066667_12007198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300021078|Ga0210381_10411486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300021559|Ga0210409_10944376 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300021560|Ga0126371_11856229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 723 | Open in IMG/M |
| 3300025900|Ga0207710_10485456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 640 | Open in IMG/M |
| 3300025910|Ga0207684_11367502 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300025930|Ga0207701_11121133 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300026298|Ga0209236_1091372 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300026313|Ga0209761_1037900 | All Organisms → cellular organisms → Bacteria | 2819 | Open in IMG/M |
| 3300026318|Ga0209471_1151619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 957 | Open in IMG/M |
| 3300026324|Ga0209470_1335865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 545 | Open in IMG/M |
| 3300026326|Ga0209801_1171546 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 899 | Open in IMG/M |
| 3300026538|Ga0209056_10070026 | All Organisms → cellular organisms → Bacteria | 3015 | Open in IMG/M |
| 3300027527|Ga0209684_1013607 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1281 | Open in IMG/M |
| 3300027655|Ga0209388_1058280 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1114 | Open in IMG/M |
| 3300027875|Ga0209283_10223359 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1251 | Open in IMG/M |
| 3300027882|Ga0209590_10774892 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 610 | Open in IMG/M |
| 3300028381|Ga0268264_12165587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
| 3300028536|Ga0137415_11006675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300028587|Ga0247828_10155862 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300030336|Ga0247826_10008743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4029 | Open in IMG/M |
| 3300031170|Ga0307498_10111883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300031561|Ga0318528_10125884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1357 | Open in IMG/M |
| 3300031720|Ga0307469_10703408 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 916 | Open in IMG/M |
| 3300031720|Ga0307469_11210972 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300031720|Ga0307469_11992100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 563 | Open in IMG/M |
| 3300031720|Ga0307469_12346002 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031723|Ga0318493_10179151 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300031740|Ga0307468_100167823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1437 | Open in IMG/M |
| 3300031744|Ga0306918_10303097 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300031747|Ga0318502_10213685 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300031771|Ga0318546_10181611 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300031793|Ga0318548_10601188 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031796|Ga0318576_10335309 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
| 3300031944|Ga0310884_10113281 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300032001|Ga0306922_10456253 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300032017|Ga0310899_10407721 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032065|Ga0318513_10355233 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300032076|Ga0306924_11505883 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300032094|Ga0318540_10195189 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300032180|Ga0307471_101262448 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300033158|Ga0335077_12011518 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300034115|Ga0364945_0218309 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.46% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.64% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.82% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.82% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_104236363 | 3300000550 | Soil | GIVREFPLPRRDARPFGVAVDPANNVWYTDLSGWLGKLRADRARNE* |
| JGI10216J12902_1058788101 | 3300000956 | Soil | GRVHAAAITEFVLPRDDARPFGIAVDAANNVWYTDLSGWLGRLDAERARVR* |
| Ga0062591_1004595382 | 3300004643 | Soil | AHKLGRVRGGVIKEFALPRRDARPFGVAVDGANNVWYTDLSGWLGMLRGDRARAE* |
| Ga0066679_108477402 | 3300005176 | Soil | HDGVMAEFPLPRSDARPFDVAVDAANNVWYTDLSGWLGRLSAERARVR* |
| Ga0066690_100586311 | 3300005177 | Soil | VMAEFPLPRSDARPFDVAVDAANNVWYTDLSGWLGRLSAERARVR* |
| Ga0066685_105500712 | 3300005180 | Soil | EFRLPRPDARPFGVAVDRANNVWYTDLGGWLGMLRADRARFG* |
| Ga0066676_103908832 | 3300005186 | Soil | FRLPRPDARPFGVTVDRANNVWYTDLGGWLGMLRADHATSR* |
| Ga0070690_1012551632 | 3300005330 | Switchgrass Rhizosphere | TEYVLPRADARPFGITVDTGNNVWYTDLSGWLGRLDAERARAR* |
| Ga0070673_1021808062 | 3300005364 | Switchgrass Rhizosphere | ITEFVLPRADARPFGIAVDVANNVWYTDLSGWLGRLDADQARVR* |
| Ga0066686_100747013 | 3300005446 | Soil | EFRLPRPDARPFGVTVDRANNVWYTDLGGWLGMLRADHATSR* |
| Ga0066689_107155641 | 3300005447 | Soil | RLRDGVMAEFPLPRADARPFDVAVDAANNVWYTDLSGWVGTLSAERARAR* |
| Ga0070697_1020663612 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | FRLPRADARPFGVAVDTANNVWYTDLSGWLGMLPAVAAKAP* |
| Ga0066697_107009081 | 3300005540 | Soil | PDARPFGITVDAGNNVWYTDLGGWLGRLDADRARAR* |
| Ga0070704_1010420573 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ELSRPNARPFGITVDGANNVWYSDLSGWLGRLDASRARGR* |
| Ga0066692_107762031 | 3300005555 | Soil | IPRDGARPFGVAVDAANNVWYTDLSGWLGMLPAASATSR* |
| Ga0066702_106339701 | 3300005575 | Soil | VTEFRLPRAEGRPFGVAVDMANNVWYTDLSGWLGMLPADRAKAR* |
| Ga0068859_1004900341 | 3300005617 | Switchgrass Rhizosphere | ETRAHKLGRVRGGVIKEFALPRRDARPFGVAVDGANNVWYTDLSGWLGMLRGDRARAE* |
| Ga0068861_1009024312 | 3300005719 | Switchgrass Rhizosphere | RLRDGTITEFPLPRSDARPFGIAVDASGNVWFTDLSGGLGRLSAERTRGR* |
| Ga0066903_1003554081 | 3300005764 | Tropical Forest Soil | RSDARPFGIAVDAAGNVWYTDLSGTLGRLSAQRARRR* |
| Ga0068860_1012208072 | 3300005843 | Switchgrass Rhizosphere | PRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR* |
| Ga0068862_1018307312 | 3300005844 | Switchgrass Rhizosphere | LGRVQGSTIREFVLPREDARPFGIAVDAANNVWYTDLTGWVGRLDADRARGR* |
| Ga0075417_101508152 | 3300006049 | Populus Rhizosphere | RLGRVHGGAITEYVLPRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR* |
| Ga0079222_106357801 | 3300006755 | Agricultural Soil | SRPFAVAVDAANNVWYTDLSGRLGMLPAAAAKAP* |
| Ga0066658_101883621 | 3300006794 | Soil | PRSDARPFDVAVDAANNVWYTDLTGWVGTLSAERARAR* |
| Ga0075421_1016244141 | 3300006845 | Populus Rhizosphere | SGARPFGIAVDGSGNVWYTDLNGGLGRLSAERARGR* |
| Ga0075433_100215461 | 3300006852 | Populus Rhizosphere | LGRVHAGTITELVLPRVDARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR* |
| Ga0075433_113349451 | 3300006852 | Populus Rhizosphere | DARPFGIAVDAAGNIWYTDLSGALGRLSAERARGR* |
| Ga0075425_1019654621 | 3300006854 | Populus Rhizosphere | PRVDARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR* |
| Ga0075434_1005016683 | 3300006871 | Populus Rhizosphere | ARPFGVAVDGAGNVWYTDLSGWLGRLSAERARGR* |
| Ga0099791_101185033 | 3300007255 | Vadose Zone Soil | RLPRPDARPFGVTVDRANNVWYTDLGGWLGMLRADYATGG* |
| Ga0099829_103023602 | 3300009038 | Vadose Zone Soil | TEFALPRRDARPFGITVDAGNNVWYTDLSGWLGRLDADRARVR* |
| Ga0099830_110116181 | 3300009088 | Vadose Zone Soil | HRLGRAHAGAITEFVLPRADARPVGVNVDAGNNVWYTDLSGWLGRLAADRARVR* |
| Ga0099827_105716611 | 3300009090 | Vadose Zone Soil | ALPRRDARPFGITVDARNNVWYTDLSGWLGRLDADRARVR* |
| Ga0066709_1002336501 | 3300009137 | Grasslands Soil | ARPFGVAVDRANNVWYTDLGGWLGMLRADRARFG* |
| Ga0114129_100804491 | 3300009147 | Populus Rhizosphere | HDGVITEFVLPRPDARPFGITVDARNNVWYTDLGGWLGRLGADRARVDGRHDGG* |
| Ga0114129_105013264 | 3300009147 | Populus Rhizosphere | HDGVITEFVLPRPDARPFGITVDARNNVWYTDLGGWLGRLDADRARVDGRHDGG* |
| Ga0075423_111722171 | 3300009162 | Populus Rhizosphere | VLPRPDARPFGIAVDAGNNVWYTDLSGWIGRLDADRARVR* |
| Ga0105242_122376063 | 3300009176 | Miscanthus Rhizosphere | HAGAITEFVLPRGDARPFGIAVDAANNVWYTDLSGWVGRLEADRARVR* |
| Ga0105248_107811141 | 3300009177 | Switchgrass Rhizosphere | ITEFALPRPDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG* |
| Ga0105249_132691781 | 3300009553 | Switchgrass Rhizosphere | ITEYVLPRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR* |
| Ga0105252_100080131 | 3300009678 | Soil | IKEFALPRPDARPFGITVDGANNVWYSDLSGWLGRLDASRARDR* |
| Ga0105088_10744732 | 3300009810 | Groundwater Sand | FTELRAHKLGRVRGGVVKEFPLARRDARPFGVAVDAANNVWYTDLSGWLGMLPADRARGN |
| Ga0134082_105627972 | 3300010303 | Grasslands Soil | RDAARPFGVAVDAANNVWYTDLGGWLGVLPAASATSR* |
| Ga0134071_107187862 | 3300010336 | Grasslands Soil | GRVRAGEITEYVLPRPDARPFGITVDAGNNVWYTDLGGWLGRLAADRARAR* |
| Ga0126370_103890891 | 3300010358 | Tropical Forest Soil | ARPFGIAVDGAGNVWYTDLSGWLGRLSAERARAR* |
| Ga0126376_104752981 | 3300010359 | Tropical Forest Soil | HADARPYSVAVDAAGNIWYTDISGWLGMLPAHRARSQ* |
| Ga0126372_102333741 | 3300010360 | Tropical Forest Soil | RPDARPIGIAVDAGNNVWYADLSGWLGRLDAGRARVR* |
| Ga0126372_105923631 | 3300010360 | Tropical Forest Soil | SRPFGVAVDAADNVWYTDLSGWLGMLPASAAQAP* |
| Ga0126372_129971371 | 3300010360 | Tropical Forest Soil | RSDARPFGIAVDAAGNVWYTDLSGRLGRLSAQRALRR* |
| Ga0126378_118786081 | 3300010361 | Tropical Forest Soil | FRLPRTERRPFGVAVDAANNVWYTDLSGWLGMLPAIAATGR* |
| Ga0126379_129519703 | 3300010366 | Tropical Forest Soil | PRPNSRPFGVAVDAANNVWYTDLAGWLGMLPASAAKAP* |
| Ga0126381_1040611902 | 3300010376 | Tropical Forest Soil | DARPFGIAVDAAGNVWYTDLSGTLGRLSAQRARRR* |
| Ga0134123_119337672 | 3300010403 | Terrestrial Soil | ARPFSVAVDGEGNVWYTDLHGWLGKLSAERARAR* |
| Ga0137422_10063662 | 3300011416 | Soil | PDARPFGITVDSANNVWYSDLSGWLGRLDASRARDR* |
| Ga0137389_110338112 | 3300012096 | Vadose Zone Soil | VRDGIITEFTLPRSDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG* |
| Ga0137389_112364121 | 3300012096 | Vadose Zone Soil | GRVAEFRLPRADGRPFGVAVDAANNVWYTDLSGWFGMLPAGRAKAR* |
| Ga0137388_104937711 | 3300012189 | Vadose Zone Soil | HRLGRLHGGAITEFDLPRPDARPFGITVDAGNNVWYTDLSGWLGRLDAHRARVR* |
| Ga0137383_103455163 | 3300012199 | Vadose Zone Soil | VMEFRLPRTESRPFGVAVDAANNVWYTDLSGWLGMLPAVRAKAP* |
| Ga0137363_111320091 | 3300012202 | Vadose Zone Soil | IITEFALPRPDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG* |
| Ga0137362_110797271 | 3300012205 | Vadose Zone Soil | GRVRDGIITEFALPRPDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG* |
| Ga0137381_100530932 | 3300012207 | Vadose Zone Soil | VRDGVITEFALPRGDARPFGITVDASNNVWYTDLSGWLGRLAADRARGR* |
| Ga0137387_105095931 | 3300012349 | Vadose Zone Soil | ADSRPFGVMVDKANNVWYTDLSGWLGMLPAVAAQAP* |
| Ga0137372_103622071 | 3300012350 | Vadose Zone Soil | ISRLHGGAITEFALPRRDARPFGITVDAGNNVWYTDLSGWLGRLDADRARVR* |
| Ga0137385_110092142 | 3300012359 | Vadose Zone Soil | RDGVITEFALPRGDARPFGIAVDASNNVWYTDLSGWLGRLAADRARGR* |
| Ga0137375_113117661 | 3300012360 | Vadose Zone Soil | DARPFGITVDASNNVWYTDLSGWLGRLAADRARGR* |
| Ga0137358_107039902 | 3300012582 | Vadose Zone Soil | FVLPRADARPFGITVDAGNTVWYTDLSGWLGRLDASHARTRERR* |
| Ga0137396_102332833 | 3300012918 | Vadose Zone Soil | RRDARPFGVAVDRANNVWYTDLGGWLGMLRAAQATSR* |
| Ga0137416_106530002 | 3300012927 | Vadose Zone Soil | ARPFGVAVDAANNVWYTDLSGWLGMLPAASATSR* |
| Ga0137404_113698501 | 3300012929 | Vadose Zone Soil | ARPFGITVDASNNVWYTDLSGWLGRLAADRARGR* |
| Ga0163162_128827711 | 3300013306 | Switchgrass Rhizosphere | RGDARPFGITVDASNNVWYTDLSGWLGRLSADRARGR* |
| Ga0163163_129939111 | 3300014325 | Switchgrass Rhizosphere | ALPRRDARPFGVAVDGANNVWYTDLSGWLGMVRGERARAE* |
| Ga0134073_102357241 | 3300015356 | Grasslands Soil | SRPFGVAVDAANNVWYTDLSGSLGMLPAARAKAP* |
| Ga0132257_1004562241 | 3300015373 | Arabidopsis Rhizosphere | ARPFGVAVDAANNVWYTDRSGWLGRLDADRARVR* |
| Ga0182035_103415641 | 3300016341 | Soil | FRLPRADGRPFGVGTDAANNVWYTDLTGWLGMLPAGRARAP |
| Ga0182032_106717941 | 3300016357 | Soil | LPQSDARPFGIAVDGAGNVWYTDLSGRLGRLSAEQARGR |
| Ga0182037_106420842 | 3300016404 | Soil | VAEFRLPRADGRPFAVAVDRANNVWYTDLSGWLGMLPAGRAKAP |
| Ga0182037_115699492 | 3300016404 | Soil | RDGRITEFRLPRADGRPFGVGTDAANNVWYTDLTGWLGMLPAGRARAP |
| Ga0182038_105364352 | 3300016445 | Soil | RLPRADGRPFGVGTDAANNVWYTDLTGWLGMLPAGRARAP |
| Ga0134074_10701791 | 3300017657 | Grasslands Soil | ITEYVLPRSDARPFGITVDAGNNVWYTDLSGWLGRLDADRARVR |
| Ga0066667_120071981 | 3300018433 | Grasslands Soil | SDARPFGITVDAGNNVWYTDLSGWLGRLDADRARAR |
| Ga0210381_104114861 | 3300021078 | Groundwater Sediment | HRLGRVQATTIREFVLPRDDARPFGIAVDAGNNVWYTDLSGWVGRLDAKRARAR |
| Ga0210409_109443762 | 3300021559 | Soil | PRSDARPFGIAVDAAANVWYTDLSGALGRLSAQRARSR |
| Ga0126371_118562291 | 3300021560 | Tropical Forest Soil | VQEFALPRRDARPFGVAIDRANNVWYTDLSGWIGRLAAERARGR |
| Ga0207710_104854561 | 3300025900 | Switchgrass Rhizosphere | RGGRVKEFALPRRDARPFGVAVDGANNVWYTDLSGWLGMVRGERARAE |
| Ga0207684_113675021 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DGRVTEFRLPRADARPFGVAVDRANNVWYTDLGGWLGMLRAASATSR |
| Ga0207701_111211331 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PLPRSDARPFGIAVDGSGNVWFTDLSGGLGRLSAERTRGR |
| Ga0209236_10913721 | 3300026298 | Grasslands Soil | VLPRSDARPFGITVDAANNVWYTDLSGWVGRLDASRAQIR |
| Ga0209761_10379001 | 3300026313 | Grasslands Soil | AGAITEFVLPRADARPFGVNVDAGNNVWYTDLSGWLGRLAADRARVR |
| Ga0209471_11516192 | 3300026318 | Soil | MAEFPLPRSDARPFDVAVDAANNVWYTDLSGWLGRLSAERARVR |
| Ga0209470_13358652 | 3300026324 | Soil | KLGRVRDGVITEFALPRGDARPFGITVDASNNVWYTDLSGWLGRLDADRARVR |
| Ga0209801_11715462 | 3300026326 | Soil | GGVTEFVLPRSDARPFGITVDADNNVWYTDLSGWLGRLDADRARAR |
| Ga0209056_100700264 | 3300026538 | Soil | DGRVTEFRLPRADARPFGVAVDRANNVWYTDLGGWLGMLRAAQATSR |
| Ga0209684_10136071 | 3300027527 | Tropical Forest Soil | SDARPFGIAVDDAGNVWYTDLSGRLGRLSAEQARGR |
| Ga0209388_10582802 | 3300027655 | Vadose Zone Soil | VLPRPDARPFGITVDAGNNVWYTDLGGWLGRLAADRARAR |
| Ga0209283_102233591 | 3300027875 | Vadose Zone Soil | GRVRDGIITEFTLPRSDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG |
| Ga0209590_107748923 | 3300027882 | Vadose Zone Soil | ALPRRDARPFGITVDARNNVWYTDLSGWLGRLDADRARVR |
| Ga0268264_121655871 | 3300028381 | Switchgrass Rhizosphere | YVLPRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR |
| Ga0137415_110066752 | 3300028536 | Vadose Zone Soil | RLRDGTITEFELPRPDARPFGITVDGANNVWYSDLSGWLGRLDAGPARGR |
| Ga0247828_101558622 | 3300028587 | Soil | NAPEAITEFALPRAEARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR |
| Ga0247826_100087435 | 3300030336 | Soil | HAGAITEFALPRAEARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR |
| Ga0307498_101118831 | 3300031170 | Soil | GTIKEFALPRPDARPFGITVDGANNVWYSDLSGWLGRLDASRARDR |
| Ga0318528_101258842 | 3300031561 | Soil | TEFRLPRADGRPFGVGTDAANNVWYTDLTGWLGMLPAGRARAP |
| Ga0307469_107034082 | 3300031720 | Hardwood Forest Soil | LPRPDARPFGITVDAGNNVWYTDLSGWLGRLDADRARIR |
| Ga0307469_112109722 | 3300031720 | Hardwood Forest Soil | GRVRDGRVTEFRLPRPDARPFGIAVDRANNVWYTDLSGWLGMLRAGHARSR |
| Ga0307469_119921002 | 3300031720 | Hardwood Forest Soil | DGVITEFALPRGDARPFGITVDASNNVWYTDLSGWLGRLSADRARGR |
| Ga0307469_123460022 | 3300031720 | Hardwood Forest Soil | RVRDGIVREFPLPRRDARPFGVAVDRANNVWYTDLSGWLGMFRADRARNE |
| Ga0318493_101791512 | 3300031723 | Soil | PQSDARPFGIAVDGAGNVWYTDLSGRLGRLSAEQARGG |
| Ga0307468_1001678231 | 3300031740 | Hardwood Forest Soil | LPRPDARPFGIAVDVGNNVWYTDLSGWIGRLDADRARVR |
| Ga0306918_103030971 | 3300031744 | Soil | RVAEFRLPRADGRPFAVAVDRANNVWYTDLSGWLAMLPAVRAKAP |
| Ga0318502_102136852 | 3300031747 | Soil | RLPRPDGRPFAVAVDRANNVWYTDLSGWLAMLPAVRAKAP |
| Ga0318546_101816113 | 3300031771 | Soil | ERHPFGVAVDAANNVWYTDLSGWLGMLPASAAETP |
| Ga0318548_106011881 | 3300031793 | Soil | DGRPFAVAVDRANNVWYTDLSGWLAMLPAVRAKAP |
| Ga0318576_103353091 | 3300031796 | Soil | GKVAEFRLPRTERRPFGVAVDAANNVWYTDLSGWLGMLPASAAETP |
| Ga0310884_101132811 | 3300031944 | Soil | AGAITEFALPRAEARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR |
| Ga0306922_104562531 | 3300032001 | Soil | GRVAEFRLPRADGRPFAVAVDRANNVWYTDLSGWLAMLPAVRAKAP |
| Ga0310899_104077212 | 3300032017 | Soil | SLGRVHAGAITEFALPRAEARPFGIAVDAGNNVWYTDLSGWLGRLDAERARGR |
| Ga0318513_103552331 | 3300032065 | Soil | SLPRASARPFGVTVDSANNVWYTDLSGWLGMLPATVAKAP |
| Ga0306924_115058832 | 3300032076 | Soil | AEFRLPRTERRPFGVAVDAANNVWYTDLSGWLGMLPASAAKAP |
| Ga0318540_101951891 | 3300032094 | Soil | PRPGSRPFAVAVDPSNNVWYTDLSGWLGMLPAAQAKAP |
| Ga0307471_1012624482 | 3300032180 | Hardwood Forest Soil | GHKLGRVHAGRITEFVLPRAEARPFGIAVDAANNVWYTDLSGWLGRLDADRARVR |
| Ga0335077_120115182 | 3300033158 | Soil | PDARPFGIAVDDGGNVWFTDLTGRLGRLSAQRARGW |
| Ga0364945_0218309_3_185 | 3300034115 | Sediment | FTETRAQKLGRVRGGVIKEFALPRRDARPFGVAVDEANNVWYTDLSGWLGMLGSDRARAE |
| ⦗Top⦘ |