


| Basic Information | |
|---|---|
| Family ID | F071005 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MADALERLKILLSSSTPIVVMETVEEMRAVRLVRAA |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 30.83 % |
| % of genes near scaffold ends (potentially truncated) | 92.62 % |
| % of genes from short scaffolds (< 2000 bps) | 85.25 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.623 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.934 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.049 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.262 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.94% β-sheet: 0.00% Coil/Unstructured: 64.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF01649 | Ribosomal_S20p | 53.28 |
| PF01966 | HD | 4.92 |
| PF13487 | HD_5 | 4.92 |
| PF00797 | Acetyltransf_2 | 4.10 |
| PF04140 | ICMT | 3.28 |
| PF07992 | Pyr_redox_2 | 2.46 |
| PF03681 | Obsolete Pfam Family | 1.64 |
| PF07394 | DUF1501 | 1.64 |
| PF02562 | PhoH | 0.82 |
| PF13432 | TPR_16 | 0.82 |
| PF02852 | Pyr_redox_dim | 0.82 |
| PF01734 | Patatin | 0.82 |
| PF00034 | Cytochrom_C | 0.82 |
| PF07498 | Rho_N | 0.82 |
| PF00578 | AhpC-TSA | 0.82 |
| PF15919 | HicB_lk_antitox | 0.82 |
| PF03054 | tRNA_Me_trans | 0.82 |
| PF14870 | PSII_BNR | 0.82 |
| PF13620 | CarboxypepD_reg | 0.82 |
| PF02224 | Cytidylate_kin | 0.82 |
| PF01408 | GFO_IDH_MocA | 0.82 |
| PF02265 | S1-P1_nuclease | 0.82 |
| PF07731 | Cu-oxidase_2 | 0.82 |
| PF00044 | Gp_dh_N | 0.82 |
| PF09720 | Unstab_antitox | 0.82 |
| PF06144 | DNA_pol3_delta | 0.82 |
| PF00069 | Pkinase | 0.82 |
| PF07690 | MFS_1 | 0.82 |
| PF11954 | DUF3471 | 0.82 |
| PF04390 | LptE | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0268 | Ribosomal protein S20 | Translation, ribosomal structure and biogenesis [J] | 53.28 |
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.10 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.28 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.82 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.82 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG1466 | DNA polymerase III, delta subunit | Replication, recombination and repair [L] | 0.82 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.82 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.82 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.82 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.82 |
| COG2812 | DNA polymerase III, gamma/tau subunits | Replication, recombination and repair [L] | 0.82 |
| COG2980 | Outer membrane lipoprotein LptE/RlpB (LPS assembly) | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.82 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.62 % |
| Unclassified | root | N/A | 7.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003219|JGI26341J46601_10186909 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005436|Ga0070713_100179610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1901 | Open in IMG/M |
| 3300005439|Ga0070711_100706525 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005537|Ga0070730_10426882 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005555|Ga0066692_11036954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 502 | Open in IMG/M |
| 3300005587|Ga0066654_10237041 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300005587|Ga0066654_10334016 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005616|Ga0068852_100508069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300005921|Ga0070766_10798675 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005993|Ga0080027_10040657 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300006047|Ga0075024_100729797 | Not Available | 547 | Open in IMG/M |
| 3300006052|Ga0075029_100275850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1067 | Open in IMG/M |
| 3300006102|Ga0075015_100406242 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300006804|Ga0079221_10657861 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300006854|Ga0075425_100047107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4819 | Open in IMG/M |
| 3300006893|Ga0073928_10442400 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300006893|Ga0073928_11192338 | Not Available | 513 | Open in IMG/M |
| 3300009038|Ga0099829_11435981 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009094|Ga0111539_13082983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300009665|Ga0116135_1336501 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300009665|Ga0116135_1465850 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010046|Ga0126384_11076544 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300010303|Ga0134082_10464097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300010361|Ga0126378_11981121 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 663 | Open in IMG/M |
| 3300010375|Ga0105239_10668965 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300010376|Ga0126381_103858758 | Not Available | 585 | Open in IMG/M |
| 3300010398|Ga0126383_10719032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1078 | Open in IMG/M |
| 3300010399|Ga0134127_10010971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6747 | Open in IMG/M |
| 3300011270|Ga0137391_10130583 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300011271|Ga0137393_10996029 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300012198|Ga0137364_11079176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300012203|Ga0137399_11086047 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012206|Ga0137380_10029794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5031 | Open in IMG/M |
| 3300012354|Ga0137366_10025159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4632 | Open in IMG/M |
| 3300012357|Ga0137384_10801027 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012359|Ga0137385_10645865 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012361|Ga0137360_10683347 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300012925|Ga0137419_11871863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300012944|Ga0137410_10454123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1041 | Open in IMG/M |
| 3300012958|Ga0164299_11054679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300012960|Ga0164301_10220806 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300012960|Ga0164301_10679199 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300012961|Ga0164302_10775149 | Not Available | 720 | Open in IMG/M |
| 3300012961|Ga0164302_11554663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012961|Ga0164302_11902430 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012986|Ga0164304_10193854 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300013307|Ga0157372_10028555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6089 | Open in IMG/M |
| 3300015241|Ga0137418_10990393 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300015357|Ga0134072_10376936 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300016422|Ga0182039_12074136 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
| 3300016445|Ga0182038_11765229 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300016702|Ga0181511_1433729 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300017659|Ga0134083_10591098 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300017823|Ga0187818_10207850 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300017927|Ga0187824_10082126 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300017930|Ga0187825_10329376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300017936|Ga0187821_10465451 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300017995|Ga0187816_10331966 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300017999|Ga0187767_10242092 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300018007|Ga0187805_10090167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1385 | Open in IMG/M |
| 3300018085|Ga0187772_10013899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4460 | Open in IMG/M |
| 3300018468|Ga0066662_11199846 | Not Available | 768 | Open in IMG/M |
| 3300019361|Ga0173482_10174920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300019789|Ga0137408_1235604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300019877|Ga0193722_1046813 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300020006|Ga0193735_1055683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1167 | Open in IMG/M |
| 3300020010|Ga0193749_1035599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300020021|Ga0193726_1238017 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300020579|Ga0210407_11026967 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300020579|Ga0210407_11317174 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300020581|Ga0210399_10144001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1969 | Open in IMG/M |
| 3300020583|Ga0210401_10963145 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300021171|Ga0210405_10648600 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300021181|Ga0210388_10570661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 991 | Open in IMG/M |
| 3300021404|Ga0210389_11301944 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021405|Ga0210387_11462509 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300021433|Ga0210391_10323412 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300021433|Ga0210391_11084091 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300021474|Ga0210390_10000001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088388 | Open in IMG/M |
| 3300021474|Ga0210390_10055906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3249 | Open in IMG/M |
| 3300021478|Ga0210402_10436612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1216 | Open in IMG/M |
| 3300025913|Ga0207695_10714376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300025921|Ga0207652_10521448 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300025923|Ga0207681_11178843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300025929|Ga0207664_10004851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9146 | Open in IMG/M |
| 3300025929|Ga0207664_11437283 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025942|Ga0207689_10869262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300026095|Ga0207676_11071544 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300026116|Ga0207674_12173833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300026118|Ga0207675_100078916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3085 | Open in IMG/M |
| 3300026118|Ga0207675_102507413 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026317|Ga0209154_1186658 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300026323|Ga0209472_1267160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300026514|Ga0257168_1149743 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027080|Ga0208237_1032380 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300027376|Ga0209004_1069668 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027521|Ga0209524_1082787 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027545|Ga0209008_1050520 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300027562|Ga0209735_1104806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300027884|Ga0209275_10040088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2205 | Open in IMG/M |
| 3300027894|Ga0209068_10379490 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300027911|Ga0209698_10033781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4650 | Open in IMG/M |
| 3300027911|Ga0209698_10080372 | All Organisms → cellular organisms → Bacteria | 2766 | Open in IMG/M |
| 3300030057|Ga0302176_10013736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3051 | Open in IMG/M |
| 3300031128|Ga0170823_14445041 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300031715|Ga0307476_10549251 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031718|Ga0307474_11190889 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031718|Ga0307474_11269905 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031833|Ga0310917_10889379 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031962|Ga0307479_10018435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6571 | Open in IMG/M |
| 3300032089|Ga0318525_10734355 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032205|Ga0307472_102385996 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300032261|Ga0306920_102196758 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300032770|Ga0335085_10334899 | Not Available | 1779 | Open in IMG/M |
| 3300032805|Ga0335078_10989856 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300032828|Ga0335080_10692588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1063 | Open in IMG/M |
| 3300032829|Ga0335070_10332003 | Not Available | 1467 | Open in IMG/M |
| 3300032954|Ga0335083_11061649 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300033289|Ga0310914_11154030 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300033755|Ga0371489_0126407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1436 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.64% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.82% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.82% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.82% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26341J46601_101869092 | 3300003219 | Bog Forest Soil | MTDGLDRLKVLINSSTPIIVMETSEETHAVNLVRAACTELSMA |
| Ga0070713_1001796101 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTGQTDMDKVLDRLKVLIDSSTPIVVMETVEESRAVRMVRLACS |
| Ga0070711_1007065253 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDVLDRLKILLNSSTPIVVMETVEEMRAVRLVRVACSSLNLATFEWS |
| Ga0070730_104268821 | 3300005537 | Surface Soil | VPDGLDRLKILIDSSTPIVVMETVEEVRAVRMVRAACSSLNLA |
| Ga0066692_110369542 | 3300005555 | Soil | MPDVLERIKVLIDSSTPIVVIETVEEMRAVRLVRAAS |
| Ga0066654_102370413 | 3300005587 | Soil | MPDVLERLKVLIDSSTPIIVMETIEEMRAVRLVRAAS |
| Ga0066654_103340161 | 3300005587 | Soil | MVNTLDRLKILINSSTPIVVMETVEEMRAIGLVRAA |
| Ga0068852_1005080692 | 3300005616 | Corn Rhizosphere | MADVLERLKILIDSSTPIIVVETVEETRAVQLVRE |
| Ga0070766_107986752 | 3300005921 | Soil | MAWPAIPDPLARLKVLLDSSTPIVVMETIEETRAVRLVRAACAALNL |
| Ga0080027_100406573 | 3300005993 | Prmafrost Soil | MAIPSIADALQRLKTLIDSSTPIVVMETVEEMRAVRMVRSA |
| Ga0075024_1007297971 | 3300006047 | Watersheds | MAEPQKKDGCSGKVLIDSSTPIVVIETVEELRRSYGAR* |
| Ga0075029_1002758501 | 3300006052 | Watersheds | MAEPQKKDALQRLKVLIDSSTPIVVIETVEELRRSYGAR* |
| Ga0075015_1004062421 | 3300006102 | Watersheds | MSDGLDRLKVLINSSTPIVVMETSEEMRAVNMVRS |
| Ga0079221_106578612 | 3300006804 | Agricultural Soil | MPDGLDRLKVLINSSTPIIVMETSEEMRAVSLVRAA |
| Ga0075425_1000471077 | 3300006854 | Populus Rhizosphere | MADTLERLKILLSSSTPIVVMETVEEMRAVRLVRA |
| Ga0073928_104424003 | 3300006893 | Iron-Sulfur Acid Spring | MTDGLDRLKVLINSSTPIIVMETSEEMHAIGLVRAACAELKMA |
| Ga0073928_111923381 | 3300006893 | Iron-Sulfur Acid Spring | MATVSRMTDGLDRLKVLINSSTPIIVMETPEETHA |
| Ga0099829_114359811 | 3300009038 | Vadose Zone Soil | MSDALERLKILLSSSTPIVVMETVEEMRAVRLVRAACSSLNLA |
| Ga0111539_130829831 | 3300009094 | Populus Rhizosphere | MADVLERLKILIDSSTPIIVVETVEETRAVQLVREASSG |
| Ga0116135_13365011 | 3300009665 | Peatland | MAGPLTADALQRLKILIDSSTPIIAMETVEEVRAVRMVRAACASLNL |
| Ga0116135_14658501 | 3300009665 | Peatland | MAWPLIPDPLARLKVLLDSSTPIVAIETVEEVRAVRLVRAACASLNL |
| Ga0126384_110765441 | 3300010046 | Tropical Forest Soil | MPDGLDRLKVLINSSTPIVVMETSEEMRAVSLVRA |
| Ga0134082_104640971 | 3300010303 | Grasslands Soil | MADVLERLKILIDSSTPIVVMETVEEMRAVRLVREASSSLRLVA |
| Ga0126378_119811211 | 3300010361 | Tropical Forest Soil | MADVRDRLKILIDSSTPIVVMETAEEMRAVRLVREAAASLN |
| Ga0105239_106689653 | 3300010375 | Corn Rhizosphere | MPDALERLKILLSSSTPIVVMETVEEMRAVRLVRAACSSLNLAT |
| Ga0126381_1038587582 | 3300010376 | Tropical Forest Soil | MVDPLARLKILISSSTPVVVIETVEETRAVRLIRSAAD |
| Ga0126383_107190321 | 3300010398 | Tropical Forest Soil | MTNPSERLKILLNSSTPIVILETVEELRVIRMVRFVCA |
| Ga0134127_100109711 | 3300010399 | Terrestrial Soil | MADVLERLKILIDSSTPIIVMETVEEMRAVQLVREAAAPL |
| Ga0137391_101305833 | 3300011270 | Vadose Zone Soil | MADVLDRLKVLIDSSTPIIVMETVEETRAVRLVRAASS |
| Ga0137393_109960291 | 3300011271 | Vadose Zone Soil | MADALERLKILLNSSTPIVVMETVEEMRAVRLVRVACSSLNLATF |
| Ga0137364_110791761 | 3300012198 | Vadose Zone Soil | MPDVLDRLKILIDSSTPIVVMETVEEMRAVRLVREASSSLRLVAF |
| Ga0137399_110860473 | 3300012203 | Vadose Zone Soil | MPDALERLKILLSSSTPIVVMETVEEVRAVRLVRAACSSLNLAT |
| Ga0137380_100297941 | 3300012206 | Vadose Zone Soil | MAVPSIADALQRLKMLIDSSTPIVVMETVEEMRAVRMVRSSCSALNLATFE |
| Ga0137366_100251596 | 3300012354 | Vadose Zone Soil | MADVLERLKILIDSSTPIIVMETVEEMRAVQLVREASSPLNLA |
| Ga0137384_108010271 | 3300012357 | Vadose Zone Soil | MLDVLERLKVLIDSSTPIIVMETVEEMRAVRLVRAASAPLTLAV |
| Ga0137385_106458651 | 3300012359 | Vadose Zone Soil | MVDVLERLRILIDSSTPIIVMETVEEMRAVRLVRAASAGL |
| Ga0137360_106833471 | 3300012361 | Vadose Zone Soil | MPDALERLKILINSSTPIVVMETVEETRAVGLVRAA |
| Ga0137419_118718632 | 3300012925 | Vadose Zone Soil | MPIPSTAEALQRLKTLIDSSTPIVVMETVEETRAVRMVRSA* |
| Ga0137410_104541233 | 3300012944 | Vadose Zone Soil | MPDALERLKILFNSSTPIVVMETVEEMRAVRLVRVACSSLNLATFEWS |
| Ga0164299_110546791 | 3300012958 | Soil | MADVLERLKILIDSSTPIVVMETVEEMRAVRLVREASSPLRLAV |
| Ga0164301_102208061 | 3300012960 | Soil | MADVRERLKVLIDSSTPIVVMETVEEMRAVRLVREASSPL |
| Ga0164301_106791993 | 3300012960 | Soil | MADPLERLKILLSSSTPIVVMETVEEMRVVRLVRA |
| Ga0164302_107751492 | 3300012961 | Soil | MPDVLDRLKVLIDSSTPIIVMETVEEMRAVRLVRAASSP |
| Ga0164302_115546631 | 3300012961 | Soil | MADVLERLKILIDSSTPIVVMETVEEMRAVRLVREASSPLRLA |
| Ga0164302_119024302 | 3300012961 | Soil | MADTLERLKILLNSSTPIVVMETAEEMRVVNMVRVACASLN |
| Ga0164304_101938543 | 3300012986 | Soil | MADTLERLKILLSSSTPIVVMETVEEMRAVRLVRAACSSL |
| Ga0157372_100285559 | 3300013307 | Corn Rhizosphere | MADVLERLKILIDSSTPIVVMETVEEMRAVRLVREASSPLRLAVF |
| Ga0137418_109903931 | 3300015241 | Vadose Zone Soil | MADALERLKILLSSSTPIVVMETVEEMRAVRLVRAACSSLNLAT |
| Ga0134072_103769361 | 3300015357 | Grasslands Soil | MADALERLKILINSSTPIVVMETIEETRAVCLVRAA |
| Ga0182039_120741361 | 3300016422 | Soil | MADVPDRLKILLDSSTPIVVMETAEEMRAVRLVREAAASLN |
| Ga0182038_117652292 | 3300016445 | Soil | MDKVLERLKVLIDSSTPIVVMETVEETRAVRMVRAACA |
| Ga0181511_14337292 | 3300016702 | Peatland | MDRLKVLINSSTPIVVMETIEELRAVRMVRIACAD |
| Ga0134083_105910981 | 3300017659 | Grasslands Soil | MPDALERLKILINPSTPIVVMETVEEMRAVSLVRTACADLNMAVFE |
| Ga0187818_102078503 | 3300017823 | Freshwater Sediment | LRLVKPLADALGTLKVLIDSSAPIVVMETVEEVRAVRLVRVACAAL |
| Ga0187824_100821263 | 3300017927 | Freshwater Sediment | MDKILERLKVLIDSSTPIVVIETVEESRAVRMVRLACA |
| Ga0187825_103293761 | 3300017930 | Freshwater Sediment | MDKVLDRLKVLLDSSTPIVVMETVEETRAVHMVRLACAALNLAAFEWT |
| Ga0187821_104654512 | 3300017936 | Freshwater Sediment | MDKVLDRLKVLIDSSTPMVVMETVEESRAVRMVRAACS |
| Ga0187816_103319661 | 3300017995 | Freshwater Sediment | MTDGLDRLKVLINSSTPIIVMETSEETHAVSMVRTA |
| Ga0187767_102420922 | 3300017999 | Tropical Peatland | MPSNTTDALHRLTVLIDSSTPIIAMETVEEIRAVRMVRAACSALNLA |
| Ga0187805_100901673 | 3300018007 | Freshwater Sediment | MRDGLDRLKVLIDSSTPIVVMETSEEMRAVNVVRA |
| Ga0187772_100138991 | 3300018085 | Tropical Peatland | MPGAQATDALQRLKVLIDSSTPIVVMETVEEVRAVRMVRAACAALNLA |
| Ga0066662_111998461 | 3300018468 | Grasslands Soil | MSTPIERLKVLINSSTPIVIMETVEEMRVIDLVRMAS |
| Ga0173482_101749202 | 3300019361 | Soil | MADVLERLKILIDSSTPIIVVETVEETRAVQLVREA |
| Ga0137408_12356041 | 3300019789 | Vadose Zone Soil | MADPRERLKVLINSLTPIVVIESVEEVRAVDLVCAACAEAESSRV |
| Ga0193722_10468132 | 3300019877 | Soil | MADALDRLKILIDSSTPIVVMETVEEMRAVRLVRD |
| Ga0193735_10556831 | 3300020006 | Soil | MPDVLERLKILIDSSTPIVVMETVEEMRAVRLVRAASSPLN |
| Ga0193749_10355991 | 3300020010 | Soil | MPDVLDRLKILIDSSTPIVVMETVEEVRAVRLVREAS |
| Ga0193726_12380171 | 3300020021 | Soil | MADALERLKILLNSSTPIVVIETVEEMRAVRLVRVA |
| Ga0210407_110269671 | 3300020579 | Soil | MASALILDPLTRLKVLLDSSTPIVAMETVEEVRAVRLVRAACAALNL |
| Ga0210407_113171742 | 3300020579 | Soil | MPDALERLKILLDSSTPIVVMETVEEVRAVRLVRAACSSLNLATF |
| Ga0210399_101440013 | 3300020581 | Soil | MTDGLDRLKVLINSSTPIVVMETSEEMQAVNLVRN |
| Ga0210401_109631453 | 3300020583 | Soil | MADALERLKILVDSSTPIVVLETVEEMRAVRMVRA |
| Ga0210405_106486001 | 3300021171 | Soil | MTDGLDRLKVLINSSTPIIVMETSEETHAVSMVRTACA |
| Ga0210388_105706613 | 3300021181 | Soil | MAVASIADALQRLKTLIDSSTPIVVMETVEEMRAVRMVRS |
| Ga0210389_113019442 | 3300021404 | Soil | MTDGLDRLKVLINSSTPIIVMETSEETHAVSMVRAACS |
| Ga0210387_114625092 | 3300021405 | Soil | MSNALDRLKVLINSSTPIVVMETSEEMRAVSVVRS |
| Ga0210391_103234122 | 3300021433 | Soil | MTDTLDRLKVLINSSTPIVVMETSEEMRAVNMVRAACTALNMATF |
| Ga0210391_110840911 | 3300021433 | Soil | MDALASLKVLIDSSAPIVVMETVEEVRAVRLVRVACA |
| Ga0210390_10000001397 | 3300021474 | Soil | MAWPAIPDPLARLKVLLDSSTPIVVMETIEETRAVRLVRAACAALNLAAF |
| Ga0210390_100559061 | 3300021474 | Soil | MAEPQKKDALQRLKVLIDSSTPIIVMETVEEVRAVRMV |
| Ga0210402_104366121 | 3300021478 | Soil | MAVPSIADALQRLKTLIDSSTPIIVMETVEEMRAVRMVR |
| Ga0207695_107143761 | 3300025913 | Corn Rhizosphere | MADVLERLKILIDSSTPIIVMETVEEMRAVQLVREAA |
| Ga0207652_105214481 | 3300025921 | Corn Rhizosphere | MADVLERLKVLINSSTPIVVMETVEEVRAVDAVRS |
| Ga0207681_111788431 | 3300025923 | Switchgrass Rhizosphere | MADVLERLKILIDSSTPIIVVETVEETRAVQLVREASSGL |
| Ga0207664_100048518 | 3300025929 | Agricultural Soil | MADVLERLKILIDSSMPIIVMETVEEMRAVQLVREASS |
| Ga0207664_114372832 | 3300025929 | Agricultural Soil | MDKVLERLKVLIDSSTPIVVMETVEESRAVRMVRLACAAL |
| Ga0207689_108692622 | 3300025942 | Miscanthus Rhizosphere | MADVLERLKILIDSSTPIIVVETVEETRAVQLVREASSGLN |
| Ga0207676_110715441 | 3300026095 | Switchgrass Rhizosphere | MADTLERLKILLSSSTPIVVMETVEEMRAVRLVRAACSSLS |
| Ga0207674_121738331 | 3300026116 | Corn Rhizosphere | MADVLERLKILIDSSTPIVVMETVEEMRAVRLVREASSPLRLAVFEW |
| Ga0207675_1000789161 | 3300026118 | Switchgrass Rhizosphere | MADTLERLKILLSSSTPIVVMETVEEMRAVRLVRAACSS |
| Ga0207675_1025074131 | 3300026118 | Switchgrass Rhizosphere | MADTLERLKILLNSSTPIVVMETAEEMRVVNMVRVACASLNLA |
| Ga0209154_11866581 | 3300026317 | Soil | MPDALERLKILINSSTPIVVMETVEETRAVGLVCAA |
| Ga0209472_12671601 | 3300026323 | Soil | MADVLERLKILIDSSTPIVVMETVEEMRAVRLVREASSSLRLVAF |
| Ga0209152_103786841 | 3300026325 | Soil | MPDVLERLRVLIDSSTPIVILETVEETRAVRLVHAAASPLNLAVFEWTIAS |
| Ga0257168_11497431 | 3300026514 | Soil | MADALERLKILLSSSTPIVVMETVEEMRAVRLVRAA |
| Ga0208237_10323801 | 3300027080 | Forest Soil | MANVLERLKVLIGSSTPIVVMETVEEMRAVRLVRSA |
| Ga0209004_10696681 | 3300027376 | Forest Soil | MTDTLDRLKVLINSSTPILVMETSEEMRAVNMVRTACSAL |
| Ga0209332_10622632 | 3300027439 | Forest Soil | MTWPLAPDPLARLKVLLESSTPIVVIESVEEVRAVRLVRAACSALSL |
| Ga0209524_10827871 | 3300027521 | Forest Soil | MADALERLKILLSSSTPIVVMETVEELRAVRLVRAACSS |
| Ga0209008_10505203 | 3300027545 | Forest Soil | MTDGLDRLKVLINSSTPIVVMETSEEMRAVNMVRAA |
| Ga0209735_11048061 | 3300027562 | Forest Soil | MDKVLDRLKVLMDSSTPIVVMETVEETRAVRMVRYACTALNLAA |
| Ga0209275_100400881 | 3300027884 | Soil | MNPIDRLKILFNSSTPIVVMETVEEVHALTLVRAA |
| Ga0209068_103794901 | 3300027894 | Watersheds | MADALERLKILLNSSTPIVVMETVEEMRAVRLVRVA |
| Ga0209698_100337815 | 3300027911 | Watersheds | MAEPQKKDALQRLKVLIDSSTPIVVIETVEELRRSYGAR |
| Ga0209698_100803723 | 3300027911 | Watersheds | MCKILTCTLADALERLKILLSSSTPIVVMETVEEMRAVRLV |
| Ga0302176_100137361 | 3300030057 | Palsa | MASPVIPDPLARLKVLLDSSTPIVVMQTVEEVRAVRLVRAACTALNLAA |
| Ga0170823_144450411 | 3300031128 | Forest Soil | MTDGLDRLKVLINSSTPIVVMETSEEMHAVNMVRKACGELNMAT |
| Ga0307476_105492512 | 3300031715 | Hardwood Forest Soil | MTDGFDRLKVLINSSTPILVMETSEEVHAVNMVRAACAELNM |
| Ga0307474_111908891 | 3300031718 | Hardwood Forest Soil | MTDGFDRLKVLINSSTPILVMETSGEVHAVNMVRA |
| Ga0307474_112699051 | 3300031718 | Hardwood Forest Soil | MTDGLDRLKVLINSSTPIIVMETSEETQAVNLVRAACTE |
| Ga0310917_108893791 | 3300031833 | Soil | MDKVLERLKVLIDSSTPIVVMETVEETRAVRMVRA |
| Ga0307479_100184351 | 3300031962 | Hardwood Forest Soil | MADALERLKILLNSSTPIVVMETVEEMRAVRLVRVACSA |
| Ga0318525_107343551 | 3300032089 | Soil | MNKALDRLKVLIDSSTPIVVMETVEEVRAVRMVRA |
| Ga0307472_1023859961 | 3300032205 | Hardwood Forest Soil | MPEPQKKDALQRLKVLIDSSTPIVVMETVEEMRAVRMV |
| Ga0306920_1021967581 | 3300032261 | Soil | MDKVLDRPKVLMDSSTPIVVMETVEETRAVRMARAACSAL |
| Ga0335085_103348993 | 3300032770 | Soil | MTDVLDRLKVLINSSTPIIVMETSEETHAVNMVRTACSQLNMAT |
| Ga0335078_109898561 | 3300032805 | Soil | MSDTLDHLKILINSSTPILVMETSEEMRAVNMVRSACSELNMA |
| Ga0335080_106925883 | 3300032828 | Soil | MVKQMADVLERLKILIDSSTPIVVMETVEEIRAVRLVRVACSALNLAT |
| Ga0335070_103320031 | 3300032829 | Soil | MDALQRLKILIDSSTPIVVIETAEEVCAVRLVRQACAALQLATFEWS |
| Ga0335083_110616493 | 3300032954 | Soil | MSSTLDRLKVLLDSSTPIVVMETVEEVRAVRLVRAAC |
| Ga0310914_111540303 | 3300033289 | Soil | MADALARLKILIDSSTPIVVLETVEEMRAVRMVRMAC |
| Ga0371489_0126407_1_114 | 3300033755 | Peat Soil | MADILERLKVLINSSTPIVVMETVEEVRAVAFVRAACA |
| ⦗Top⦘ |