


| Basic Information | |
|---|---|
| Family ID | F070823 |
| Family Type | Metagenome |
| Number of Sequences | 122 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MNGTECRPQAPVAEGGPESYEGYLGDAPKTLFIFLATPYPLR |
| Number of Associated Samples | 29 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.61 % |
| % of genes near scaffold ends (potentially truncated) | 34.43 % |
| % of genes from short scaffolds (< 2000 bps) | 36.07 % |
| Associated GOLD sequencing projects | 26 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.787 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (62.295 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.393 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (63.115 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00282 | Pyridoxal_deC | 4.10 |
| PF10143 | PhosphMutase | 2.46 |
| PF04055 | Radical_SAM | 2.46 |
| PF09976 | TPR_21 | 2.46 |
| PF07085 | DRTGG | 2.46 |
| PF13464 | DUF4115 | 1.64 |
| PF00005 | ABC_tran | 1.64 |
| PF08713 | DNA_alkylation | 1.64 |
| PF03575 | Peptidase_S51 | 1.64 |
| PF00246 | Peptidase_M14 | 1.64 |
| PF06452 | CBM9_1 | 1.64 |
| PF08245 | Mur_ligase_M | 1.64 |
| PF00756 | Esterase | 1.64 |
| PF12679 | ABC2_membrane_2 | 1.64 |
| PF13683 | rve_3 | 1.64 |
| PF02769 | AIRS_C | 1.64 |
| PF13620 | CarboxypepD_reg | 1.64 |
| PF12705 | PDDEXK_1 | 1.64 |
| PF04015 | DUF362 | 1.64 |
| PF14332 | DUF4388 | 0.82 |
| PF05193 | Peptidase_M16_C | 0.82 |
| PF01063 | Aminotran_4 | 0.82 |
| PF00759 | Glyco_hydro_9 | 0.82 |
| PF00682 | HMGL-like | 0.82 |
| PF09852 | DUF2079 | 0.82 |
| PF01050 | MannoseP_isomer | 0.82 |
| PF02545 | Maf | 0.82 |
| PF00156 | Pribosyltran | 0.82 |
| PF03572 | Peptidase_S41 | 0.82 |
| PF11175 | DUF2961 | 0.82 |
| PF09397 | FtsK_gamma | 0.82 |
| PF11741 | AMIN | 0.82 |
| PF14559 | TPR_19 | 0.82 |
| PF04389 | Peptidase_M28 | 0.82 |
| PF03606 | DcuC | 0.82 |
| PF01850 | PIN | 0.82 |
| PF00144 | Beta-lactamase | 0.82 |
| PF12675 | DUF3795 | 0.82 |
| PF02321 | OEP | 0.82 |
| PF12836 | HHH_3 | 0.82 |
| PF13520 | AA_permease_2 | 0.82 |
| PF04893 | Yip1 | 0.82 |
| PF02518 | HATPase_c | 0.82 |
| PF01228 | Gly_radical | 0.82 |
| PF13453 | zf-TFIIB | 0.82 |
| PF01145 | Band_7 | 0.82 |
| PF14595 | Thioredoxin_9 | 0.82 |
| PF02417 | Chromate_transp | 0.82 |
| PF00881 | Nitroreductase | 0.82 |
| PF08530 | PepX_C | 0.82 |
| PF14684 | Tricorn_C1 | 0.82 |
| PF06439 | 3keto-disac_hyd | 0.82 |
| PF00120 | Gln-synt_C | 0.82 |
| PF14498 | Glyco_hyd_65N_2 | 0.82 |
| PF09371 | Tex_N | 0.82 |
| PF13646 | HEAT_2 | 0.82 |
| PF13186 | SPASM | 0.82 |
| PF00486 | Trans_reg_C | 0.82 |
| PF14242 | DUF4342 | 0.82 |
| PF00111 | Fer2 | 0.82 |
| PF13692 | Glyco_trans_1_4 | 0.82 |
| PF13181 | TPR_8 | 0.82 |
| PF04519 | Bactofilin | 0.82 |
| PF02687 | FtsX | 0.82 |
| PF07690 | MFS_1 | 0.82 |
| PF10431 | ClpB_D2-small | 0.82 |
| PF00326 | Peptidase_S9 | 0.82 |
| PF01810 | LysE | 0.82 |
| PF01321 | Creatinase_N | 0.82 |
| PF02472 | ExbD | 0.82 |
| PF00383 | dCMP_cyt_deam_1 | 0.82 |
| PF00892 | EamA | 0.82 |
| PF02481 | DNA_processg_A | 0.82 |
| PF02578 | Cu-oxidase_4 | 0.82 |
| PF00152 | tRNA-synt_2 | 0.82 |
| PF03169 | OPT | 0.82 |
| PF08448 | PAS_4 | 0.82 |
| PF07676 | PD40 | 0.82 |
| PF02896 | PEP-utilizers_C | 0.82 |
| PF02146 | SIR2 | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 4.10 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.64 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 1.64 |
| COG4912 | 3-methyladenine DNA glycosylase AlkD | Replication, recombination and repair [L] | 1.64 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.64 |
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.64 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 0.82 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.82 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.82 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.82 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.82 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.82 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.82 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.82 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.82 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.82 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.79 % |
| Unclassified | root | N/A | 17.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009039|Ga0105152_10026801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 2270 | Open in IMG/M |
| 3300009039|Ga0105152_10074636 | Not Available | 1368 | Open in IMG/M |
| 3300009111|Ga0115026_11459337 | Not Available | 568 | Open in IMG/M |
| 3300012964|Ga0153916_10005782 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 9465 | Open in IMG/M |
| 3300012964|Ga0153916_10024216 | All Organisms → cellular organisms → Bacteria | 5183 | Open in IMG/M |
| 3300012964|Ga0153916_10043351 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 4011 | Open in IMG/M |
| 3300012964|Ga0153916_10233602 | Not Available | 1848 | Open in IMG/M |
| 3300013088|Ga0163200_1088916 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300018055|Ga0184616_10308544 | Not Available | 598 | Open in IMG/M |
| 3300022553|Ga0212124_10269225 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300025843|Ga0209182_10001958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Aminicenantes bacterium SCGC AAA255-A06 | 6114 | Open in IMG/M |
| 3300025843|Ga0209182_10020347 | Not Available | 1983 | Open in IMG/M |
| 3300027740|Ga0214474_1136281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 916 | Open in IMG/M |
| 3300027740|Ga0214474_1158538 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300027740|Ga0214474_1343776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 523 | Open in IMG/M |
| 3300027811|Ga0256868_10010279 | All Organisms → cellular organisms → Bacteria | 4545 | Open in IMG/M |
| 3300027811|Ga0256868_10013872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 3876 | Open in IMG/M |
| 3300027811|Ga0256868_10045262 | All Organisms → cellular organisms → Bacteria | 2024 | Open in IMG/M |
| 3300027811|Ga0256868_10181074 | Not Available | 904 | Open in IMG/M |
| 3300027900|Ga0209253_10481801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 928 | Open in IMG/M |
| 3300030613|Ga0299915_10000778 | All Organisms → cellular organisms → Bacteria | 23648 | Open in IMG/M |
| 3300030613|Ga0299915_10001892 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 15310 | Open in IMG/M |
| 3300030613|Ga0299915_10008827 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 7453 | Open in IMG/M |
| 3300030613|Ga0299915_10016180 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 5551 | Open in IMG/M |
| 3300030613|Ga0299915_10019003 | All Organisms → cellular organisms → Bacteria | 5135 | Open in IMG/M |
| 3300030613|Ga0299915_10028053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 4215 | Open in IMG/M |
| 3300030613|Ga0299915_10038108 | All Organisms → cellular organisms → Bacteria | 3587 | Open in IMG/M |
| 3300030613|Ga0299915_10060159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 2807 | Open in IMG/M |
| 3300030613|Ga0299915_10195731 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300030613|Ga0299915_10401026 | Not Available | 919 | Open in IMG/M |
| 3300030613|Ga0299915_10627429 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300030613|Ga0299915_10636471 | Not Available | 682 | Open in IMG/M |
| 3300030613|Ga0299915_10965239 | Not Available | 519 | Open in IMG/M |
| 3300031707|Ga0315291_10001454 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 31645 | Open in IMG/M |
| 3300031707|Ga0315291_10004728 | All Organisms → cellular organisms → Bacteria | 17242 | Open in IMG/M |
| 3300031707|Ga0315291_10016757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 8790 | Open in IMG/M |
| 3300031707|Ga0315291_10026196 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 6857 | Open in IMG/M |
| 3300031707|Ga0315291_10036110 | All Organisms → cellular organisms → Bacteria | 5714 | Open in IMG/M |
| 3300031707|Ga0315291_10085202 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 3446 | Open in IMG/M |
| 3300031707|Ga0315291_10110392 | All Organisms → cellular organisms → Bacteria | 2948 | Open in IMG/M |
| 3300031707|Ga0315291_10209414 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 1980 | Open in IMG/M |
| 3300031707|Ga0315291_10363219 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300031707|Ga0315291_11146868 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031746|Ga0315293_10001301 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 24178 | Open in IMG/M |
| 3300031746|Ga0315293_10042839 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 3952 | Open in IMG/M |
| 3300031746|Ga0315293_10049578 | All Organisms → cellular organisms → Bacteria | 3645 | Open in IMG/M |
| 3300031746|Ga0315293_10057858 | Not Available | 3350 | Open in IMG/M |
| 3300031746|Ga0315293_10090887 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
| 3300031746|Ga0315293_10104711 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300031746|Ga0315293_10191763 | Not Available | 1685 | Open in IMG/M |
| 3300031746|Ga0315293_10250613 | Not Available | 1437 | Open in IMG/M |
| 3300031746|Ga0315293_10655288 | Not Available | 787 | Open in IMG/M |
| 3300031772|Ga0315288_10017699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 8843 | Open in IMG/M |
| 3300031772|Ga0315288_10271365 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300031772|Ga0315288_10866718 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300031885|Ga0315285_10056839 | All Organisms → cellular organisms → Bacteria | 3619 | Open in IMG/M |
| 3300031885|Ga0315285_10061199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 3455 | Open in IMG/M |
| 3300031885|Ga0315285_10091047 | All Organisms → cellular organisms → Bacteria | 2691 | Open in IMG/M |
| 3300031885|Ga0315285_10151254 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300031885|Ga0315285_10172073 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300031885|Ga0315285_10695728 | Not Available | 655 | Open in IMG/M |
| 3300031952|Ga0315294_10134382 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 2528 | Open in IMG/M |
| 3300031952|Ga0315294_10165549 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300031952|Ga0315294_10845417 | Not Available | 782 | Open in IMG/M |
| 3300031999|Ga0315274_10033662 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 7057 | Open in IMG/M |
| 3300031999|Ga0315274_10157958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 2867 | Open in IMG/M |
| 3300031999|Ga0315274_10213684 | All Organisms → cellular organisms → Bacteria | 2376 | Open in IMG/M |
| 3300031999|Ga0315274_10390390 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300031999|Ga0315274_10479911 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300031999|Ga0315274_10521105 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300032046|Ga0315289_10039725 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 6005 | Open in IMG/M |
| 3300032046|Ga0315289_10206075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2140 | Open in IMG/M |
| 3300032046|Ga0315289_11501096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Calotrichaceae → Calothrix → unclassified Calothrix → Calothrix sp. HK-06 | 514 | Open in IMG/M |
| 3300032046|Ga0315289_11542876 | Not Available | 503 | Open in IMG/M |
| 3300032053|Ga0315284_10085320 | All Organisms → cellular organisms → Bacteria | 4258 | Open in IMG/M |
| 3300032053|Ga0315284_10107466 | All Organisms → cellular organisms → Bacteria | 3721 | Open in IMG/M |
| 3300032070|Ga0315279_10006051 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 15407 | Open in IMG/M |
| 3300032070|Ga0315279_10012228 | All Organisms → cellular organisms → Bacteria | 9842 | Open in IMG/M |
| 3300032070|Ga0315279_10023833 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 6420 | Open in IMG/M |
| 3300032070|Ga0315279_10029109 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium RBG_16_63_16 | 5644 | Open in IMG/M |
| 3300032070|Ga0315279_10029769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 5565 | Open in IMG/M |
| 3300032070|Ga0315279_10046047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 4198 | Open in IMG/M |
| 3300032070|Ga0315279_10054293 | All Organisms → cellular organisms → Bacteria | 3764 | Open in IMG/M |
| 3300032070|Ga0315279_10060043 | All Organisms → cellular organisms → Bacteria | 3521 | Open in IMG/M |
| 3300032070|Ga0315279_10071861 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
| 3300032070|Ga0315279_10074419 | All Organisms → cellular organisms → Bacteria | 3046 | Open in IMG/M |
| 3300032070|Ga0315279_10111129 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 2324 | Open in IMG/M |
| 3300032118|Ga0315277_10006879 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 14804 | Open in IMG/M |
| 3300032118|Ga0315277_10072830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 3925 | Open in IMG/M |
| 3300032118|Ga0315277_10115404 | All Organisms → cellular organisms → Bacteria | 3011 | Open in IMG/M |
| 3300032118|Ga0315277_10210794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 2106 | Open in IMG/M |
| 3300032118|Ga0315277_11240366 | Not Available | 658 | Open in IMG/M |
| 3300032143|Ga0315292_10041634 | All Organisms → cellular organisms → Bacteria | 3348 | Open in IMG/M |
| 3300032143|Ga0315292_10658550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300032143|Ga0315292_10998605 | Not Available | 695 | Open in IMG/M |
| 3300032143|Ga0315292_11516285 | Not Available | 542 | Open in IMG/M |
| 3300032156|Ga0315295_10006970 | All Organisms → cellular organisms → Bacteria | 9662 | Open in IMG/M |
| 3300032156|Ga0315295_10077646 | All Organisms → cellular organisms → Bacteria | 3189 | Open in IMG/M |
| 3300032156|Ga0315295_11740525 | Not Available | 593 | Open in IMG/M |
| 3300032163|Ga0315281_10007380 | All Organisms → cellular organisms → Bacteria | 15491 | Open in IMG/M |
| 3300032163|Ga0315281_10012524 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 11540 | Open in IMG/M |
| 3300032177|Ga0315276_10064889 | All Organisms → cellular organisms → Bacteria | 3626 | Open in IMG/M |
| 3300032177|Ga0315276_11350459 | Not Available | 746 | Open in IMG/M |
| 3300032342|Ga0315286_10021049 | All Organisms → cellular organisms → Bacteria | 6674 | Open in IMG/M |
| 3300032401|Ga0315275_10007678 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 10440 | Open in IMG/M |
| 3300032401|Ga0315275_10029058 | All Organisms → cellular organisms → Bacteria | 5776 | Open in IMG/M |
| 3300032401|Ga0315275_10039493 | All Organisms → cellular organisms → Bacteria | 5005 | Open in IMG/M |
| 3300032401|Ga0315275_10360671 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300032401|Ga0315275_10455582 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300033489|Ga0299912_10008514 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 8513 | Open in IMG/M |
| 3300033489|Ga0299912_10009319 | All Organisms → cellular organisms → Bacteria | 8198 | Open in IMG/M |
| 3300033489|Ga0299912_10018961 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Aminicenantes bacterium SCGC AAA252-K07 | 5900 | Open in IMG/M |
| 3300033489|Ga0299912_10026212 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 5043 | Open in IMG/M |
| 3300033489|Ga0299912_10033799 | All Organisms → cellular organisms → Bacteria | 4448 | Open in IMG/M |
| 3300033489|Ga0299912_10038245 | All Organisms → cellular organisms → Bacteria | 4184 | Open in IMG/M |
| 3300033489|Ga0299912_10040074 | All Organisms → cellular organisms → Bacteria | 4088 | Open in IMG/M |
| 3300033489|Ga0299912_10052659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 3560 | Open in IMG/M |
| 3300033489|Ga0299912_10106923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 2450 | Open in IMG/M |
| 3300033489|Ga0299912_10134315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes | 2159 | Open in IMG/M |
| 3300033489|Ga0299912_10234773 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300033489|Ga0299912_10719944 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300033513|Ga0316628_100001920 | All Organisms → cellular organisms → Bacteria | 15039 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 62.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 12.30% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 3.28% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.64% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.82% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013088 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0105152_100268011 | 3300009039 | Lake Sediment | MNGTECRPQAPVAEGGPEPYEGYIGDPPKALSIFLATPYPLR* |
| Ga0105152_100746362 | 3300009039 | Lake Sediment | MNGTECRPQAPVAEGGPEPYEGYIGDPPKTLSIFLAT |
| Ga0115026_114593372 | 3300009111 | Wetland | PQAPVAEGGPESYEGHIGDTPKTLFIFLATPYPLR* |
| Ga0153916_1000578210 | 3300012964 | Freshwater Wetlands | MNGTECRPQAPVAEGGPESYEGHIGDTPKTLLIFLATPYPLR* |
| Ga0153916_100242163 | 3300012964 | Freshwater Wetlands | MKGTECRPQAPVAEGGPESYEGYIGDTPKTLFIFIATPYPLRYLYSPDT* |
| Ga0153916_100433514 | 3300012964 | Freshwater Wetlands | MNGAECRPQAPVAEGGPESYEGLIGDTPKTPFIFLATPYPLR* |
| Ga0153916_102336021 | 3300012964 | Freshwater Wetlands | MPPETPVAEGGPESYEGYIGDTPKTLSIFLATPYPLR* |
| Ga0163200_10889162 | 3300013088 | Freshwater | MNGTECRPQAPVAEGGTEFYEGYLGNAPKTLFIFLATPYPLR* |
| Ga0184616_103085441 | 3300018055 | Groundwater Sediment | MNGTECRPQATVAEGGPESYEGYIGDTPKTLFIFIATPYPL |
| Ga0212124_102692251 | 3300022553 | Freshwater | MNGTECRPQAPVAEGGPEPYEGSLGDAPKTLFIFLATPY |
| Ga0209182_100019581 | 3300025843 | Lake Sediment | MNGTECRPQAPVAEGGPEPYEGYIGDPPKTLSIFLATPYPLR |
| Ga0209182_100203472 | 3300025843 | Lake Sediment | AKKKHLCMNGTECRPQAPVAEGGPEPYEGYIGDPPKTLSIFLATPYPLR |
| Ga0214474_11362813 | 3300027740 | Soil | MNGTERRPQAPVAEGGPESYEGYIGDTPKTLFIFIATPYPLR |
| Ga0214474_11585381 | 3300027740 | Soil | MNGTECRPQAPVAEGGPESYEGYLGDAPKTLFIFLATPYPLR |
| Ga0214474_13437761 | 3300027740 | Soil | MNGTECRPQAPVAEGGLESYEGYLGDSPKTLFIFLATP |
| Ga0256868_100102792 | 3300027811 | Soil | MNGTECRPQAPVAEGGPEPYEGYIGDTPKTLSIFLATPYPLR |
| Ga0256868_100138721 | 3300027811 | Soil | MNGTECRPQAPVAEGGPESYEGYLGDAPKTLFIFLATP |
| Ga0256868_100452622 | 3300027811 | Soil | MNGTECLPQAPVAEGGPESYEGYFGDAPKTLFIFLATPYPLR |
| Ga0256868_101810742 | 3300027811 | Soil | MNGTERRPQAPVAEGGPESYEGYIGDTPKTLFIFLATPYPLR |
| Ga0209253_104818011 | 3300027900 | Freshwater Lake Sediment | MNGTECRPQAPVAEGGPESYEGYPGDTPKTLSIFLATPPP |
| Ga0299915_100007785 | 3300030613 | Soil | MKGIECRPQAPVAEGGPESYEGYIGDTPKTLSIFLATPYPLR |
| Ga0299915_100018924 | 3300030613 | Soil | MNGTECRPQAPVAEGGPEPYEGYIGHTPKTLSIFLATPYPLR |
| Ga0299915_100088274 | 3300030613 | Soil | MNGTECRPQAPVAEGGPESYEGYLGDAPKTLFIFLATPNPLR |
| Ga0299915_100161802 | 3300030613 | Soil | MNGPECRPQAPVAEGGPESYEGHIDDTPKTLSIFLATPYPLR |
| Ga0299915_100190033 | 3300030613 | Soil | MNGTECRPQAPVAEGGPEPYEGYIGDTPKTLSIFLATPYPL |
| Ga0299915_100280534 | 3300030613 | Soil | MNGPECRPQAPVAEGGPESYEGYLGDAPKTLFIFLATPYPLR |
| Ga0299915_100381081 | 3300030613 | Soil | MNGTECRPQVPVAEGGPESYEGYLGDAPKTLFIFLATPYPLR |
| Ga0299915_100601592 | 3300030613 | Soil | MKGTECRPQAPVAEGGPESYESYLGDAPETLFIFLTTPYPLR |
| Ga0299915_101957311 | 3300030613 | Soil | PQAPVAEGGPESYEGYLGDAPKTLFIFLATPYPLR |
| Ga0299915_104010261 | 3300030613 | Soil | MNGTECRPQAPVAEGGPESYEGYFGDAPKTLFIFLATPYPLR |
| Ga0299915_106274292 | 3300030613 | Soil | MNGTECRPQAPVAEGGPEPYEGYIGDTPKTLSIFLAT |
| Ga0299915_106364712 | 3300030613 | Soil | MNGTECRPQAPVEEGGPESYEGYLGDAPETLFIFLATPYPLR |
| Ga0299915_109652391 | 3300030613 | Soil | MNGTECRPQDPVAEGGPEPYEGYLGDAPKTLFIFLATPYPLR |
| Ga0315291_1000145427 | 3300031707 | Sediment | MNGTECRPQAPVAEGGPESYEGYIGDTPKTLSIFLATPYPLR |
| Ga0315291_100047288 | 3300031707 | Sediment | MNGTECRPQAPVAEGGPEPYEGYLGDAPKTLFIFLATPYPLR |
| Ga0315291_100167574 | 3300031707 | Sediment | MNGTECRPQAPVAEGGPESYEGHIGDTPKTLSIFLATPYPLR |
| Ga0315291_100261965 | 3300031707 | Sediment | MNGTECRPQAPVAEGGREFYEGYLGNAPKTLSMFLATPYPLR |
| Ga0315291_100361101 | 3300031707 | Sediment | CRPQAPVAEGGPEPYEGYLGDAPKTLFIFLATPCPLR |
| Ga0315291_100852025 | 3300031707 | Sediment | MNGTECRPQAPVAEGGPEPYEGSLGDAPKTLFIFLATPYPLR |
| Ga0315291_101103921 | 3300031707 | Sediment | MNGTECRPQAPVAEGGPEPYEGYLGDAPKTLFIFLATPYPL |
| Ga0315291_102094142 | 3300031707 | Sediment | MNGTECRPQAPVAEGGPEPYEGYLGGAPETLFIFLATPYPLR |
| Ga0315291_103632191 | 3300031707 | Sediment | RLQTPVAEGGPESYEGFLGDAPKTLFIFLSTPSPLR |
| Ga0315291_111468681 | 3300031707 | Sediment | NRMNGTECRPQAPVAEGGPEFYEGYLGNAPKTLFIFLATPYPLR |
| Ga0315293_1000130120 | 3300031746 | Sediment | VNGTECRPQAPVAEGGPEPYEGYLGDAPKTLFIFLATP |
| Ga0315293_100428393 | 3300031746 | Sediment | MNGIECRPQAPVAEGGPESYEGYIGDTPKTLSIFLATPYPLR |
| Ga0315293_100495783 | 3300031746 | Sediment | MNGTECRPQAPVAEGGPEPYEGSLGDTPKTLFIFLATPYPLR |
| Ga0315293_100578583 | 3300031746 | Sediment | MSGTECRLQTPVAEGGPESYEGFLGDAPKTLFIFLSTPYPLR |
| Ga0315293_100908871 | 3300031746 | Sediment | MNGTECRLQVPVAEGGPESYEGYLGDPPKTLFMFLTTPYPLR |
| Ga0315293_101047112 | 3300031746 | Sediment | MNGTECRPQAPVAEGGAESNEGYIGDTPKTLSIFLATPYPLR |
| Ga0315293_101917631 | 3300031746 | Sediment | PQAPVAEGGPEPYEGYIGDPPKTLSIFLATPYPLR |
| Ga0315293_102506133 | 3300031746 | Sediment | MNGTECRPQAPVAEGGPESYEGHIGDTPKTLSIFLA |
| Ga0315293_106552881 | 3300031746 | Sediment | MNGTECRPQAPVAEGGPESYEGYIGDTPKTLPIFLATPYPL |
| Ga0315288_100176991 | 3300031772 | Sediment | MNGTECRPQAPVAERGPAPYEGSLGDAPKTLFIFLATPYPLR |
| Ga0315288_102713651 | 3300031772 | Sediment | NGTECRPQAPVAEGGPEPYEGYLGDAPKTLFIFLATPYPLR |
| Ga0315288_108667182 | 3300031772 | Sediment | MNGTECRPQAPVAEGGIEFYEGYLGNAPKTLFIFLATPYPLR |
| Ga0315285_100568392 | 3300031885 | Sediment | MNGTECRTQAPVAEGGPESYEGYIGDTPKTLFIFIATPYPLR |
| Ga0315285_100611996 | 3300031885 | Sediment | MNGTECRPQAPVAEGGPEFYEGYLGNAPKTLFIFLATPYPLR |
| Ga0315285_100910472 | 3300031885 | Sediment | MNGTECRPQAPVAEGGPESYEGYFGDAPKTLFIFLATPYLLR |
| Ga0315285_101512541 | 3300031885 | Sediment | MNGTECRPQAPVAERGPESYEGYIGDTPKTLFIFIATPYPLR |
| Ga0315285_101720731 | 3300031885 | Sediment | PQAPVAERGPEFYEGYLGNAPKTLFIFLATPYPLR |
| Ga0315285_106957281 | 3300031885 | Sediment | MNGTECRPQAPVAEGGPESYEGYIGDTPKTLFIFIATPYP |
| Ga0315294_101343824 | 3300031952 | Sediment | MNGTECRPQAPVAEGGPEPYEGSLGDAPKTLFIFLATPYP |
| Ga0315294_101655491 | 3300031952 | Sediment | MNGTECRPQAPVAEGGPSFNESYHYGDTPKTLFIFLATPYPLR |
| Ga0315294_108454172 | 3300031952 | Sediment | TECRPQAPVAEGGPEPYEGSLGDAPKTLFIFLATPYPLR |
| Ga0315274_100336625 | 3300031999 | Sediment | MDGPECRPQAPVAEGGPEPYEGYLGDAPKTLFIFLATPYPLR |
| Ga0315274_101579583 | 3300031999 | Sediment | MNGYECRPQAPVAEGGPESYEGYIGDTSKTLSIFLATPYPLR |
| Ga0315274_102136843 | 3300031999 | Sediment | MNGTECRPQAPVAEGGPEPYEGYTGDTPKTLSIFLATPYPLR |
| Ga0315274_103903901 | 3300031999 | Sediment | MNGTECRPQAPVAEGGPEFYEGYLGNAPKTLSMFIATPYPLR |
| Ga0315274_104799112 | 3300031999 | Sediment | MIYPTFMTQAQKKLQSMNGTECRSQAPVAEGGPEPYEGSLGDAPKTLFIFLATPYPLR |
| Ga0315274_105211051 | 3300031999 | Sediment | MNGTECRSQAPVAEGGPEPYEGSLGDAPKTLFIFL |
| Ga0315289_100397257 | 3300032046 | Sediment | MNGPECRPQAPVAEGGPEPYEGSLGDAPKPLFIFLATPYPLR |
| Ga0315289_102060753 | 3300032046 | Sediment | MNGTECRPHAPVEEGGPESYEGYIGDTPKTLSIFLATPYPLR |
| Ga0315289_115010961 | 3300032046 | Sediment | MNGTECRPQTLVAEGGPEPYEGYTGDTPKTLSIFLATPYPLR |
| Ga0315289_115428762 | 3300032046 | Sediment | RPQAPVAEGGPEPYEGYLGDAPKTLFIFLATPYPLR |
| Ga0315284_100853204 | 3300032053 | Sediment | MSGTECRPQAPVAEGGPESYEGHIGDTPKTLSIFLATPYPLR |
| Ga0315284_101074661 | 3300032053 | Sediment | MNGPECRPQAPVAEAGAAPYEGSLGDAPKTLFIFLATPYPLR |
| Ga0315279_100060515 | 3300032070 | Sediment | MNGTECRPQAPVAEGGPESYEGYIGDTPKTLFIFIAIPYPLR |
| Ga0315279_100122285 | 3300032070 | Sediment | MNGTECRPQAPVAEGGPEPYEGCLGDAPKTLFIFLATPYPLR |
| Ga0315279_100238331 | 3300032070 | Sediment | MNGPECRPQAPVAEGGPESYEGYIGDTPKTLFIFIATPYPLR |
| Ga0315279_100291092 | 3300032070 | Sediment | MNGTECRPQAPVAEGGSEPYEGYLGDPPKTLFIFLATPYPLR |
| Ga0315279_100297692 | 3300032070 | Sediment | MNGTECRPQAPVAEGGPESYEGYLGDAPETLFIFLATPYPLR |
| Ga0315279_100460472 | 3300032070 | Sediment | MNGTECRPQAPVAEGGPAPYEGSLGDAPKTLFIFLATPYPLR |
| Ga0315279_100542932 | 3300032070 | Sediment | MNGPECRPQAPVAEGGPESYEGHIGDTPKTLSIFLATPYPLR |
| Ga0315279_100600431 | 3300032070 | Sediment | ECRPQAPVAEGGPESYEGYIGDTPKTLFIFIATPYPLR |
| Ga0315279_100718613 | 3300032070 | Sediment | MNGTECRPQAPVAEGGPEPYEGSLGDAPKTMFIFLATPY |
| Ga0315279_100744192 | 3300032070 | Sediment | MNGTECRPQAPVAEGGPESYESYLGDAPKTLFIFLATPYPLR |
| Ga0315279_101111292 | 3300032070 | Sediment | MNGTECRPQAPVAEGGPESFEGHIGDTPKTLSMVLATPYPLR |
| Ga0315277_100068798 | 3300032118 | Sediment | MNGTECRPQAPVAEGGPESYEGYIGDTPKTLFIFIATPYPLR |
| Ga0315277_100728305 | 3300032118 | Sediment | MNGPECRPQAPVAEGGPESYEGYIGDTSKTLSIFLATPYPLR |
| Ga0315277_101154041 | 3300032118 | Sediment | MNGTECRPQAPVAEGGPEPYEGYLGDAPKTLFIFLATP |
| Ga0315277_102107941 | 3300032118 | Sediment | TGCRPQAPVAEGGPESYEGNIGDTPKTLFIFLATPYPLR |
| Ga0315277_112403661 | 3300032118 | Sediment | MNGTECRPQAPVAEGGPEPYEGYLGDAPKTLFIFLAT |
| Ga0315292_100416342 | 3300032143 | Sediment | MNGTECCPQAPVVEGGPEPYEGYLGDAPKTLFIFLATPYPLR |
| Ga0315292_106585502 | 3300032143 | Sediment | MNGTECRPQAPVAEGGPEPYEGYLGDAPKTLFIFL |
| Ga0315292_109986051 | 3300032143 | Sediment | MNGTECRPQAPVAEGGPESYEGYLGDTPKTLFIFL |
| Ga0315292_115162851 | 3300032143 | Sediment | PQAPVAEGGPESYEGNIGDTPKTLFIFLATPYPLR |
| Ga0315295_100069706 | 3300032156 | Sediment | MNGTECRPQAPVAEGGPEPYEGYLGDVPKTLFIFLATPYPLR |
| Ga0315295_100776461 | 3300032156 | Sediment | MNGTECRPQAPVAKGGPNPYEGYIGDPPKTLSIFLAPR |
| Ga0315295_117405251 | 3300032156 | Sediment | NGTECRPQAPVAERGPESYEGYIGDTPKTLFIFIATPYPLR |
| Ga0315281_1000738010 | 3300032163 | Sediment | MNGTECRPQAPVAEGGPEFYEGYIGNAPKTLFIFLATPYPLR |
| Ga0315281_100125245 | 3300032163 | Sediment | MNGTECRPQAPVAEGGPEPYEGSLGDAPKTLFIFLATPHPLR |
| Ga0315276_100648891 | 3300032177 | Sediment | MNGTECRPQAPVAEGGPEPYDGYLGDAPKTLFIFLATPYPLR |
| Ga0315276_113504591 | 3300032177 | Sediment | RPQAPVAEKRPEPYEGYIGDPPKTLSIFLATPYPLR |
| Ga0315286_100210497 | 3300032342 | Sediment | MNGTECRPQAPVAEKRPEPYEGYIGDPPKTLSIFLATPYPLR |
| Ga0315275_100076786 | 3300032401 | Sediment | MTAKFLLGGTGCRPKAPVAEGGPESYEGYIGDTPKTLSIFLATPYPLR |
| Ga0315275_100290584 | 3300032401 | Sediment | MNGTECRPQAPVAEGGPNPYEGYIGDPPKTLSIFLATPYPLR |
| Ga0315275_100394934 | 3300032401 | Sediment | MPSSSPRREGGAEPYEGSLGDAPKTLFIFLATPYPLR |
| Ga0315275_103606712 | 3300032401 | Sediment | MNGTECRPQAPVAEGGPESYEGHIGDTPKTLSMFLATPYPL |
| Ga0315275_104555822 | 3300032401 | Sediment | MNGTECRPQAPVAERGPESYEGYLGDPPKTLFIFLSTPYPLR |
| Ga0299912_100085141 | 3300033489 | Soil | MKGTECRPQAPVAEGGPESYEGYLGDAPKTLFIFL |
| Ga0299912_100093193 | 3300033489 | Soil | MKGTECRPQAPVAEGGPESYEGYIGDTPKTLFIFIATPYPLRYLYSPDT |
| Ga0299912_100189613 | 3300033489 | Soil | MNGTECRPQAPVAEGGPEFYEGYLGDAPKTLFMFLATPYPLR |
| Ga0299912_100262121 | 3300033489 | Soil | MEAALKPPVAEGDPASYEAYLGDTPKTLSIFLATPYPLR |
| Ga0299912_100337991 | 3300033489 | Soil | MNGPEWRPQAPVAEGGPDVTANAPETLFLFLATPYPLRQSEGDSEMV |
| Ga0299912_100382453 | 3300033489 | Soil | MNGTECRPQASVAEGGPESYEGYLGDAPKTLFIFLATPYPLR |
| Ga0299912_100400744 | 3300033489 | Soil | MNGAERRPQAPVAEGGPESYEGYLGDAAKTLFIFLATPYPLR |
| Ga0299912_100526593 | 3300033489 | Soil | MNGTECRPQAPVAEGGPESYEGYRGDAPKTLFIFLATPHPLR |
| Ga0299912_101069232 | 3300033489 | Soil | MNGTECRPQAPVAEGGSESYEGYIGDTPKTLFIFIATPYPLR |
| Ga0299912_101343152 | 3300033489 | Soil | MNGPECRPQAPVAEGGPESNEGYIGDTPKTLSIFLATPYSLR |
| Ga0299912_102347731 | 3300033489 | Soil | MNGTERRPQAPVAEGGPESYEGYIGDTPKTLFIFL |
| Ga0299912_107199442 | 3300033489 | Soil | MPPETPVAEGGPESYEGYIGDTPKTLSIFLATPYPLR |
| Ga0316628_1000019203 | 3300033513 | Soil | MNGTECRPQAPVAEGGPESYGDTPKTLSVFIAIPYPLR |
| ⦗Top⦘ |