


| Basic Information | |
|---|---|
| Family ID | F070593 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MEMAGLWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKPKKKP |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.99 % |
| % of genes near scaffold ends (potentially truncated) | 18.70 % |
| % of genes from short scaffolds (< 2000 bps) | 60.98 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds (7.317 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.699 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (19.512 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF03061 | 4HBT | 40.65 |
| PF14317 | YcxB | 13.01 |
| PF09670 | Cas_Cas02710 | 6.50 |
| PF10263 | SprT-like | 1.63 |
| PF13408 | Zn_ribbon_recom | 0.81 |
| PF05635 | 23S_rRNA_IVP | 0.81 |
| PF01035 | DNA_binding_1 | 0.81 |
| PF13580 | SIS_2 | 0.81 |
| PF03457 | HA | 0.81 |
| PF02801 | Ketoacyl-synt_C | 0.81 |
| PF13624 | SurA_N_3 | 0.81 |
| PF13701 | DDE_Tnp_1_4 | 0.81 |
| PF10947 | DUF2628 | 0.81 |
| PF07110 | EthD | 0.81 |
| PF01957 | NfeD | 0.81 |
| PF06769 | YoeB_toxin | 0.81 |
| PF08241 | Methyltransf_11 | 0.81 |
| PF02643 | DUF192 | 0.81 |
| PF00202 | Aminotran_3 | 0.81 |
| PF01206 | TusA | 0.81 |
| PF13419 | HAD_2 | 0.81 |
| PF09195 | Endonuc-BglII | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.81 |
| COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1430 | Uncharacterized conserved membrane protein, UPF0127 family | Function unknown [S] | 0.81 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.81 |
| COG4115 | Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB family | Defense mechanisms [V] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000881|JGI10215J12807_1286644 | All Organisms → cellular organisms → Bacteria | 3603 | Open in IMG/M |
| 3300000891|JGI10214J12806_10839398 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1183 | Open in IMG/M |
| 3300000956|JGI10216J12902_105769493 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300003310|D1draft_1000067 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 207666 | Open in IMG/M |
| 3300003859|Ga0031653_10039594 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1297 | Open in IMG/M |
| 3300003861|Ga0031654_10001083 | All Organisms → cellular organisms → Bacteria | 7696 | Open in IMG/M |
| 3300003861|Ga0031654_10034306 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 1447 | Open in IMG/M |
| 3300004052|Ga0055490_10000587 | All Organisms → cellular organisms → Bacteria | 5024 | Open in IMG/M |
| 3300004145|Ga0055489_10055368 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1071 | Open in IMG/M |
| 3300004282|Ga0066599_100119867 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1288 | Open in IMG/M |
| 3300004463|Ga0063356_100024945 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 5668 | Open in IMG/M |
| 3300004643|Ga0062591_100001509 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 7090 | Open in IMG/M |
| 3300004782|Ga0062382_10281346 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005205|Ga0068999_10059492 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005330|Ga0070690_101301900 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 582 | Open in IMG/M |
| 3300005332|Ga0066388_100338653 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2150 | Open in IMG/M |
| 3300005332|Ga0066388_102843897 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005334|Ga0068869_101572495 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005341|Ga0070691_10858513 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005354|Ga0070675_102035365 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 529 | Open in IMG/M |
| 3300005438|Ga0070701_10069921 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1874 | Open in IMG/M |
| 3300005444|Ga0070694_100473272 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 993 | Open in IMG/M |
| 3300005444|Ga0070694_101447424 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 581 | Open in IMG/M |
| 3300005471|Ga0070698_100182667 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300005713|Ga0066905_100005545 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 5369 | Open in IMG/M |
| 3300005829|Ga0074479_10331555 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 5565 | Open in IMG/M |
| 3300005830|Ga0074473_10176716 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005833|Ga0074472_10167151 | All Organisms → cellular organisms → Bacteria | 4639 | Open in IMG/M |
| 3300005833|Ga0074472_10480745 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 5016 | Open in IMG/M |
| 3300005833|Ga0074472_10576457 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 4316 | Open in IMG/M |
| 3300005833|Ga0074472_10655421 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 4273 | Open in IMG/M |
| 3300005833|Ga0074472_10788885 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1134 | Open in IMG/M |
| 3300005833|Ga0074472_11318427 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 802 | Open in IMG/M |
| 3300005943|Ga0073926_10008750 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1783 | Open in IMG/M |
| 3300005956|Ga0073920_1008583 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1287 | Open in IMG/M |
| 3300005991|Ga0073923_1033927 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005992|Ga0073924_1016158 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1050 | Open in IMG/M |
| 3300006041|Ga0075023_100009976 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300006041|Ga0075023_100023350 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300006041|Ga0075023_100088955 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300006041|Ga0075023_100162559 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 832 | Open in IMG/M |
| 3300006050|Ga0075028_100821018 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 568 | Open in IMG/M |
| 3300006057|Ga0075026_100024628 | All Organisms → cellular organisms → Bacteria | 2704 | Open in IMG/M |
| 3300006163|Ga0070715_10714679 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006853|Ga0075420_100054321 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 3561 | Open in IMG/M |
| 3300006854|Ga0075425_100160457 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300007004|Ga0079218_10014520 | All Organisms → cellular organisms → Bacteria | 4052 | Open in IMG/M |
| 3300007521|Ga0105044_10142434 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2558 | Open in IMG/M |
| 3300009038|Ga0099829_10697093 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 844 | Open in IMG/M |
| 3300009078|Ga0105106_10029821 | All Organisms → cellular organisms → Bacteria | 4031 | Open in IMG/M |
| 3300009084|Ga0105046_10363709 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1489 | Open in IMG/M |
| 3300009091|Ga0102851_10043898 | All Organisms → cellular organisms → Bacteria | 3536 | Open in IMG/M |
| 3300009100|Ga0075418_11360733 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300009777|Ga0105164_10005795 | All Organisms → cellular organisms → Bacteria | 7332 | Open in IMG/M |
| 3300010047|Ga0126382_12417246 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 510 | Open in IMG/M |
| 3300010360|Ga0126372_10570022 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1079 | Open in IMG/M |
| 3300010360|Ga0126372_12902096 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010391|Ga0136847_10242308 | All Organisms → cellular organisms → Bacteria | 4704 | Open in IMG/M |
| 3300011406|Ga0137454_1072448 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 579 | Open in IMG/M |
| 3300011421|Ga0137462_1000109 | All Organisms → cellular organisms → Bacteria | 9946 | Open in IMG/M |
| 3300012096|Ga0137389_10729496 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300012152|Ga0137347_1094740 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 534 | Open in IMG/M |
| 3300012212|Ga0150985_112494228 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 587 | Open in IMG/M |
| 3300012226|Ga0137447_1007630 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1390 | Open in IMG/M |
| 3300012226|Ga0137447_1104074 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 565 | Open in IMG/M |
| 3300012668|Ga0157216_10053216 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2013 | Open in IMG/M |
| 3300012931|Ga0153915_12143898 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012948|Ga0126375_10018775 | All Organisms → cellular organisms → Bacteria | 3170 | Open in IMG/M |
| 3300012960|Ga0164301_11866146 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 507 | Open in IMG/M |
| 3300015254|Ga0180089_1070399 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 709 | Open in IMG/M |
| 3300015360|Ga0163144_10060228 | All Organisms → cellular organisms → Bacteria | 6571 | Open in IMG/M |
| 3300015360|Ga0163144_10962494 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 824 | Open in IMG/M |
| 3300015374|Ga0132255_105066330 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 558 | Open in IMG/M |
| 3300017695|Ga0180121_10036281 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1738 | Open in IMG/M |
| 3300018028|Ga0184608_10037578 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300018071|Ga0184618_10480711 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 521 | Open in IMG/M |
| 3300018077|Ga0184633_10056050 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300018469|Ga0190270_10081903 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2398 | Open in IMG/M |
| 3300019360|Ga0187894_10000034 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 191794 | Open in IMG/M |
| 3300019360|Ga0187894_10000814 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 42058 | Open in IMG/M |
| 3300019377|Ga0190264_10003777 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 3797 | Open in IMG/M |
| 3300019377|Ga0190264_10024311 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2097 | Open in IMG/M |
| 3300019458|Ga0187892_10000018 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 328536 | Open in IMG/M |
| 3300020057|Ga0163151_10002933 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 25356 | Open in IMG/M |
| 3300020167|Ga0194035_1000032 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 85777 | Open in IMG/M |
| 3300020596|Ga0163149_10150704 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300021272|Ga0213899_100592 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300021333|Ga0210324_1121985 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300022549|Ga0212091_10195944 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 812 | Open in IMG/M |
| 3300025905|Ga0207685_10533292 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300025926|Ga0207659_11732762 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 532 | Open in IMG/M |
| 3300025959|Ga0210116_1056469 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300025971|Ga0210102_1028520 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1205 | Open in IMG/M |
| 3300026902|Ga0209851_1029250 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 548 | Open in IMG/M |
| 3300027393|Ga0209867_1016423 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1049 | Open in IMG/M |
| 3300027665|Ga0209983_1136890 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 560 | Open in IMG/M |
| 3300027731|Ga0209592_1115726 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300027846|Ga0209180_10213317 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1112 | Open in IMG/M |
| 3300027850|Ga0209591_10719137 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300027886|Ga0209486_10736379 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 639 | Open in IMG/M |
| 3300027894|Ga0209068_10008850 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 4757 | Open in IMG/M |
| 3300027900|Ga0209253_10162474 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1802 | Open in IMG/M |
| 3300027900|Ga0209253_10407070 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1032 | Open in IMG/M |
| 3300027902|Ga0209048_10014315 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 7021 | Open in IMG/M |
| 3300027902|Ga0209048_10029057 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 4703 | Open in IMG/M |
| 3300027910|Ga0209583_10021742 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300027910|Ga0209583_10614527 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 555 | Open in IMG/M |
| 3300027979|Ga0209705_10051079 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2281 | Open in IMG/M |
| 3300031455|Ga0307505_10060619 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1680 | Open in IMG/M |
| 3300031538|Ga0310888_10028203 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2445 | Open in IMG/M |
| 3300031547|Ga0310887_10276953 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300031562|Ga0310886_10016299 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 2869 | Open in IMG/M |
| 3300031576|Ga0247727_10010954 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 15942 | Open in IMG/M |
| 3300031576|Ga0247727_10596682 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300031854|Ga0310904_10901377 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 625 | Open in IMG/M |
| 3300032211|Ga0310896_10162372 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1069 | Open in IMG/M |
| 3300032256|Ga0315271_10047076 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
| 3300032256|Ga0315271_10332412 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1258 | Open in IMG/M |
| 3300032275|Ga0315270_10075574 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1932 | Open in IMG/M |
| 3300032456|Ga0335394_10503369 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 988 | Open in IMG/M |
| 3300033433|Ga0326726_10024017 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 5300 | Open in IMG/M |
| 3300033513|Ga0316628_103261003 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 590 | Open in IMG/M |
| 3300034155|Ga0370498_006580 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2419 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.32% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 6.50% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.88% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 4.88% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.06% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 3.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 3.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.44% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.63% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.63% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.81% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.81% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.81% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.81% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.81% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Down-Flow Hanging Sponge Reactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003310 | Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - L1-648F-DHS | Engineered | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300005956 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_23-Sept-14 | Environmental | Open in IMG/M |
| 3300005991 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_10-June-14 | Environmental | Open in IMG/M |
| 3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300020596 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1 | Environmental | Open in IMG/M |
| 3300021272 | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hamp_Shaw_2 | Environmental | Open in IMG/M |
| 3300021333 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026902 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10215J12807_12866443 | 3300000881 | Soil | MEVAGFWSWVIMAAWTIGLFVLAWWFYMPNPMTKDRKDKKKP* |
| JGI10214J12806_108393982 | 3300000891 | Soil | MEMAGLWSWVIMAGWTIVLGILAWWFYMPNPMAKDSKRPKKKP* |
| JGI10216J12902_1057694933 | 3300000956 | Soil | MEMAGLWSWVIMAGWTIVIGILAWWFYMPNPMAKDGKK |
| D1draft_10000674 | 3300003310 | Down-Flow Hanging Sponge Reactor | METGWESFSMAGIWSWVIMAGWTIGLFVLAWWFYMPNPMDREKKHKKKS* |
| Ga0031653_100395943 | 3300003859 | Freshwater Lake Sediment | MEWVSFGMAGLWSWVIMAGWTIGLAVLAWWFFMPNPMDRDKKLKKKP* |
| Ga0031654_100010838 | 3300003861 | Freshwater Lake Sediment | MEMASLGSWIIMAGWTIGLAILAWWFFMPNPMAKDKKPKKKL* |
| Ga0031654_100343061 | 3300003861 | Freshwater Lake Sediment | MEMASLGSWLIMAGWTIGLAIIAWWFFMPNPMAKDRKPKKKP* |
| Ga0055490_100005872 | 3300004052 | Natural And Restored Wetlands | MEMAPLGGWLIMAGWTIGLAVLAWWFFMPNPMDRDKKNKKKKP* |
| Ga0055489_100553682 | 3300004145 | Natural And Restored Wetlands | METGWESFSMAGIWSWVIMAGWTIGLAILAWWFYMPNPMDREKKHKKKS* |
| Ga0066599_1001198673 | 3300004282 | Freshwater | MEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP* |
| Ga0063356_1000249455 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MEMASLGSWLIMAGWTIGLAILAWWFYMPNPMAKDSKKGKKESKKQS* |
| Ga0062591_1000015099 | 3300004643 | Soil | METGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS* |
| Ga0062382_102813462 | 3300004782 | Wetland Sediment | MEMAPLGSWLIMAGWTIGLALLAWWFFMPNPMAKGGKKDKKKP* |
| Ga0068999_100594921 | 3300005205 | Natural And Restored Wetlands | MEWSGFGMAGIWSWLIMIGWTVGLAILAWWFFMPNPMDRDKKSKKRL* |
| Ga0070690_1013019003 | 3300005330 | Switchgrass Rhizosphere | GLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS* |
| Ga0066388_1003386532 | 3300005332 | Tropical Forest Soil | METGWDSFGIAGIWSWVIMVGWTIGLFALAWWFYMPNPMDRDKKPKKKS* |
| Ga0066388_1028438973 | 3300005332 | Tropical Forest Soil | METGWDTFAMAGIWSWVIMAVWTIGIFILGWWFFMPNPMDRDRK |
| Ga0068869_1015724951 | 3300005334 | Miscanthus Rhizosphere | MAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS* |
| Ga0070691_108585132 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKK |
| Ga0070675_1020353651 | 3300005354 | Miscanthus Rhizosphere | METEWVSFGMPGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS* |
| Ga0070701_100699214 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | METGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS* |
| Ga0070694_1004732722 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | METEWVSFGMAGLWSWVIMAGWTIGLALLAWWFFMPNPMDRDRKPKKKS* |
| Ga0070694_1014474241 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS* |
| Ga0070698_1001826674 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | METEWVSFGMAGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS* |
| Ga0066905_1000055456 | 3300005713 | Tropical Forest Soil | METGMDTGWASFGMAGIWSWVIMALWTIGVFVLGWWFFMPNPMDRDRKHKKKP* |
| Ga0074479_103315553 | 3300005829 | Sediment (Intertidal) | METGWESFGMAGLGSWLIMAGWTIGLAILAWWFYMPNPMDRDKKGKKKP* |
| Ga0074473_101767162 | 3300005830 | Sediment (Intertidal) | MEMAGLWSWVIMAGWTIGLGILAWWFFMPNPMDRDKKHKKKP* |
| Ga0074472_101671516 | 3300005833 | Sediment (Intertidal) | METGWESFSIAGIWSWVIMAVWTIGLFVLAWWFFMPNPMDRDRKHKKKP* |
| Ga0074472_104807455 | 3300005833 | Sediment (Intertidal) | MEMASLGSWLIMAGWTIGLGILGWWFFMPNPMAKDKKDKKKKP* |
| Ga0074472_105764571 | 3300005833 | Sediment (Intertidal) | MMDAGWETFGMAGLGSWLIIAAWTIGIGFLAWWFFMPNPMDRDRK |
| Ga0074472_106554215 | 3300005833 | Sediment (Intertidal) | MEMAPLGSWLIMAGWTIGLAILAWWFFMPNPMAKGGKKDKKKP* |
| Ga0074472_107888851 | 3300005833 | Sediment (Intertidal) | METEWVSFGWAGIGSWLMIVGWTIGLAILAWWFFMPNPMDRDRKSKKKS* |
| Ga0074472_113184272 | 3300005833 | Sediment (Intertidal) | MEMAGLWSWVIMAGWTIGLGFLAWWFFMPNPMDRDKKPKKKA* |
| Ga0073926_100087503 | 3300005943 | Sand | METGWENFSMAGLWSWVIMAGWTIGIGVLAWWFFIPNPMDRDRKHNKKP* |
| Ga0073920_10085831 | 3300005956 | Sand | SWVIMAVWTIVLGVLAWWFFMPNPMDRDKKHKKKP* |
| Ga0073923_10339271 | 3300005991 | Sand | METGWESFGMAGLGSWLIMAGWTIGLAILAWWFYMPNPMDR |
| Ga0073924_10161583 | 3300005992 | Sand | PIGSCGMETGWENFSMAGLWSWVIMAGWTIGIGVLAWWFFIPNPMDRDRKHNKKP* |
| Ga0075023_1000099764 | 3300006041 | Watersheds | MDMAPLGSWIIMAGWTIGLVVLGWWFFMPNPMAKDKKNKKKP* |
| Ga0075023_1000233501 | 3300006041 | Watersheds | MMESGWISFGMAGLGSWLIIAAWTIGIGVLAWWFFMPNPMDRDGKPKKKP* |
| Ga0075023_1000889553 | 3300006041 | Watersheds | MEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKS* |
| Ga0075023_1001625592 | 3300006041 | Watersheds | MEMAGLWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDKKKP* |
| Ga0075028_1008210181 | 3300006050 | Watersheds | METEWVGFGWAGIGSWVIMAGWTIGLAILAWWFYMPSPMAKDGKRNKKKS* |
| Ga0075026_1000246281 | 3300006057 | Watersheds | EMEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKS* |
| Ga0070715_107146792 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDKKKP* |
| Ga0075420_1000543212 | 3300006853 | Populus Rhizosphere | MEVAGFWSWVIMAAWTIGLFILGWWFFMPNPMDRDRKSKKKP* |
| Ga0075425_1001604573 | 3300006854 | Populus Rhizosphere | METGWNSFGMAGIWSWVIMIGWTIGLFALAWWFYMPNPMDRDKKSKKKS* |
| Ga0079218_100145203 | 3300007004 | Agricultural Soil | MEMASLGSWLIMAGWTIGLAILAWWFYMPNPMAKDGKKGKKESKKQS* |
| Ga0105044_101424344 | 3300007521 | Freshwater | METDWVSFGMAGIWSWVIMIAWTIGIAVLAWWFFMPNPMDRDRKPKKKP* |
| Ga0099829_106970932 | 3300009038 | Vadose Zone Soil | MEMIQIGSWLIMAGMAIGVFVLGWWFFLENPMAKDKKNKENKKRP* |
| Ga0105106_100298214 | 3300009078 | Freshwater Sediment | METGWESFSMAGIWSWLIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS* |
| Ga0105046_103637092 | 3300009084 | Freshwater | MEMAGLWSWVIMAGWTIGIAILAWWFYMPNPMGKDRKPKKKP* |
| Ga0102851_100438985 | 3300009091 | Freshwater Wetlands | MEMAGLWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKPKKKP* |
| Ga0075418_113607332 | 3300009100 | Populus Rhizosphere | MEMAGFWSWVIMAAWTIGLFVLAWWFYMPNPMDRDKKSKKKS* |
| Ga0105164_100057958 | 3300009777 | Wastewater | MEMAPLGSWIIMAGWTIGLIVLGWWFFMPNPMAKDKKDKKKP* |
| Ga0126382_124172462 | 3300010047 | Tropical Forest Soil | WESFGIAGIWSWFIMVGWTIGLFELAWWFYMPNPMDRDKKSKKKS* |
| Ga0126372_105700222 | 3300010360 | Tropical Forest Soil | METGWDTFAMAGIWSWVIMAVWTIGIFILGWWFFMPNPMDRDRKPKKKP* |
| Ga0126372_129020961 | 3300010360 | Tropical Forest Soil | METGWDSFGIAGIWSWVIMVGWTIGLFALAWWFYMPNPMDRDKKPKK |
| Ga0136847_102423084 | 3300010391 | Freshwater Sediment | MEMVQIGSWLIMAGMAIGVFVLGWWFFMPNPMAKDRKDRNKKP* |
| Ga0137454_10724482 | 3300011406 | Soil | MEMAPLGSWIIMAGWTIGLFVLGWWFFMPNPMDRDRKNKKKP* |
| Ga0137462_10001095 | 3300011421 | Soil | MPSLGSWLMIAGWTIGIAVLGWWFYMPNPMAKDRKNKKKP* |
| Ga0137389_107294962 | 3300012096 | Vadose Zone Soil | MEMAPLGSWIIIAVMTIGVFVLGWWFFMENPMAKDKKNKKNKEKP* |
| Ga0137347_10947402 | 3300012152 | Soil | METEWVGFGIAGLGSWLMIAGWTIGLAILAWWFYMPNPMDRDRKNKKKP* |
| Ga0150985_1124942282 | 3300012212 | Avena Fatua Rhizosphere | MEMAGLWSWVIMAGWTIVIGILAWWFYMPNPMAKDGKKPKKKP* |
| Ga0137447_10076304 | 3300012226 | Soil | GMAGIWSWLIMIGWTVGLAILAWWFFMPNPMDRDRKPKKKP* |
| Ga0137447_11040741 | 3300012226 | Soil | MEMAGLWSWVIMAGWTIGLGVLAWWFFMPNPMDRDKKPKKKA* |
| Ga0157216_100532163 | 3300012668 | Glacier Forefield Soil | MEMASLGSWLIMAGWSIGLAILAWWFFMPNPMDRDRKHKKKR* |
| Ga0153915_121438981 | 3300012931 | Freshwater Wetlands | METGWQSFSIAGIWSWVIMAVWTIGIFVLAWWFFMPNPMDRDRKHKKKS* |
| Ga0126375_100187755 | 3300012948 | Tropical Forest Soil | METGWESFGIAGIWSWVIMVGWTIGLFALAWWFYMPNPMDRDKKSKKKS* |
| Ga0164301_118661462 | 3300012960 | Soil | MEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKERKDRTKKP* |
| Ga0180089_10703992 | 3300015254 | Soil | GSWLIMAGMAIGVFVLGWWFFIPNPMAKDRKDRNKKP* |
| Ga0163144_100602286 | 3300015360 | Freshwater Microbial Mat | MEMASIGSWLIMGGWTIGLAILAWWFFMPNPMAKDRKPKKKP* |
| Ga0163144_109624942 | 3300015360 | Freshwater Microbial Mat | METDWVSFGMAGLWSWAIMIGWTIGLAVLAWWFFMPNPMAKDRKPKKKP* |
| Ga0132255_1050663302 | 3300015374 | Arabidopsis Rhizosphere | METGWASFGMAGIWSWVIMVGWTIGLFALAWWFYMPNPMDRDKKSKKKS |
| Ga0180121_100362814 | 3300017695 | Polar Desert Sand | MEMAGLWSWVIMAGWTIGIAILAWWFYMPNPMGKDRKTKKKP |
| Ga0184608_100375782 | 3300018028 | Groundwater Sediment | MEMVQIGSWLIMAGMAIGVFVLGWWFFLENPMAKDKKNKKKP |
| Ga0184618_104807111 | 3300018071 | Groundwater Sediment | WLIMAGMAIGVFVLGWWFYMPNPMAKDRKDRNENP |
| Ga0184633_100560502 | 3300018077 | Groundwater Sediment | ASLGSWLIMAGMAIGVFILGWWFFMPNTMAKDRKDRNKKP |
| Ga0190270_100819032 | 3300018469 | Soil | MEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP |
| Ga0187894_1000003412 | 3300019360 | Microbial Mat On Rocks | MEMAGIWSWVIMAGWTIGLGILAWWFFMPNPMDRDKKHKKKS |
| Ga0187894_1000081418 | 3300019360 | Microbial Mat On Rocks | MEVAGFWSWVIMAAWTIGLFVLAWWFYMPNPMTKDRKDKKKQ |
| Ga0190264_100037774 | 3300019377 | Soil | MEMASLGSWLIMAGWSIGLAILAWWFFMPNPMDRDRKHKKKR |
| Ga0190264_100243113 | 3300019377 | Soil | MEMAGLWSWVIMAGWTIVIAILAWWFYMPNPMAKDSKRPKKKP |
| Ga0187892_1000001828 | 3300019458 | Bio-Ooze | MEMASLGSWIIMAVWTIGLFILGWWFFMPNPMDRDRKSKKKPPPPPA |
| Ga0163151_1000293324 | 3300020057 | Freshwater Microbial Mat | MEMASIGSWLIMGGWTIGLAILAWWFFMPNPMAKDRKPKKKP |
| Ga0194035_100003224 | 3300020167 | Anoxic Zone Freshwater | MEMAGLWSWVIMAGWTIGLGVLAWWFFMPNPMDRDKKPKKKA |
| Ga0163149_101507044 | 3300020596 | Freshwater Microbial Mat | MEMASIGSWLIMGGWTIGLAILAWWFFMPNPMAKDRKPK |
| Ga0213899_1005922 | 3300021272 | Soil | MEMASLGSWLIMAGWTIGLAILAWWFYMPNPMAKDSKKGKKENKKQP |
| Ga0210324_11219852 | 3300021333 | Estuarine | MEWSGFGMAGIWSWLIMIGWTVGLAILAWWFFMPNPMDRDKKSKKRL |
| Ga0212091_101959442 | 3300022549 | Groundwater | MEMVQIGSWLIMAGWTIGLAILAWWFYMPNPMDRDKKGKKKP |
| Ga0207685_105332921 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MEMAGLWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDKKKP |
| Ga0207659_117327621 | 3300025926 | Miscanthus Rhizosphere | METEWVSFGMPGLGSWLIMAGWTIGLALLAWWFYMPNPMAKDGKKDKKKS |
| Ga0210116_10564691 | 3300025959 | Natural And Restored Wetlands | METGWESFSMAGIWSWVIMAGWTIGLAILAWWFYMPNPMDREKKHKKKS |
| Ga0210102_10285203 | 3300025971 | Natural And Restored Wetlands | MEMAPLGGWLIMAGWTIGLAVLAWWFFMPNPMDRDKKNKKKKP |
| Ga0209851_10292501 | 3300026902 | Sand | PIGSCGMETGWENFSMAGLWSWVIMAGWTIGIGVLAWWFFIPNPMDRDRKHNKKP |
| Ga0209867_10164232 | 3300027393 | Sand | MEMAGLWSWVIMAVWTIVLGVLAWWFFMPNPMDRDKKHKKKP |
| Ga0209983_11368902 | 3300027665 | Arabidopsis Thaliana Rhizosphere | METGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS |
| Ga0209592_11157262 | 3300027731 | Freshwater Sediment | METGWESFSIAGIWSWVIMAVWTIGLFVLAWWFFMPNPMDRDRKHKKKP |
| Ga0209180_102133172 | 3300027846 | Vadose Zone Soil | MEMIQIGSWLIMAGMAIGVFVLGWWFFLENPMAKDKKNKENKKRP |
| Ga0209591_107191372 | 3300027850 | Freshwater | METDWVSFGMAGIWSWVIMIAWTIGIAVLAWWFFMPNPM |
| Ga0209486_107363792 | 3300027886 | Agricultural Soil | MEMASLGSWLIMAGWTIGLAILAWWFYMPNPMAKDGKKGKKESKKQS |
| Ga0209068_100088503 | 3300027894 | Watersheds | MDMAPLGSWIIMAGWTIGLVVLGWWFFMPNPMAKDKKNKKKP |
| Ga0209253_101624743 | 3300027900 | Freshwater Lake Sediment | MEWVSFGMAGLWSWVIMAGWTIGLAVLAWWFFMPNPMDRDKKLKKKP |
| Ga0209253_104070702 | 3300027900 | Freshwater Lake Sediment | MEMASLGSWLIMAGWTIGLAILAWWFFMPNPMAKDKKPKKKL |
| Ga0209048_100143156 | 3300027902 | Freshwater Lake Sediment | MEMASLGSWIIMAGWTIGLAILAWWFFMPNPMAKDKKPKKKL |
| Ga0209048_100290576 | 3300027902 | Freshwater Lake Sediment | MEMASLGSWLIMAGWTIGLAIIAWWFFMPNPMAKDRKPKKKP |
| Ga0209583_100217423 | 3300027910 | Watersheds | MEMAGFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKS |
| Ga0209583_106145272 | 3300027910 | Watersheds | METEWVSFGMAGLGSWLIIVAWTIGIGVLAWWFYMPNPMDRDRKPKKKP |
| Ga0209705_100510794 | 3300027979 | Freshwater Sediment | MIVTNRESRMETGWESFSMAGIWSWLIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS |
| Ga0307505_100606192 | 3300031455 | Soil | MEMAGFWSWVIMAVWTIAIFVLGWWFYMPNPMAKDGKPKKKP |
| Ga0310888_100282032 | 3300031538 | Soil | METGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS |
| Ga0310887_102769532 | 3300031547 | Soil | MEMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS |
| Ga0310886_100162991 | 3300031562 | Soil | MEMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDRKHKKKS |
| Ga0247727_100109546 | 3300031576 | Biofilm | MDMAPLGSWIIMAGMAIGVFVLGWWFFLENPMAKDRKNKENKKKP |
| Ga0247727_105966821 | 3300031576 | Biofilm | MEMVQIGSWLIMAGMAIGVFILGWWFFLENPMAKDKKNKKKP |
| Ga0310904_109013772 | 3300031854 | Soil | GFWSWVIMAVWTIGIFVLGWWFFMPNPMAKDRKDRNKKP |
| Ga0310896_101623721 | 3300032211 | Soil | IGSHEMETGWENFSMAGIWSWVIMAGWTIGLAILAWWFFMPNPMDRDKKHKKKS |
| Ga0315271_100470765 | 3300032256 | Sediment | MEMAGLWSWVIMAGWTIGLGFLAWWFFMPNPMDRDKKPKKKA |
| Ga0315271_103324123 | 3300032256 | Sediment | METEWVSFGWAGIGSWLMIVGWTIGLAILAWWFFMPNPMDRDRKSKKKS |
| Ga0315270_100755744 | 3300032275 | Sediment | MEMAGLWSWVIMAGWSIVLAILAWWFFMPNPMDRDRKPKKKP |
| Ga0335394_105033691 | 3300032456 | Freshwater | MEMAGLWSWVIMAGWTIGIAILAWWFYMPNPMGKDRKPKKKP |
| Ga0326726_100240174 | 3300033433 | Peat Soil | MMESGWISFGMAGLGSWLIIAAWTIGIGFLAWWFFMPNPMDRDKRPKKKL |
| Ga0316628_1032610032 | 3300033513 | Soil | METGWQSFSIAGIWSWVIMGVWTIGIFVLAWWFFMPNPMDRDRKHKKKP |
| Ga0370498_006580_695_823 | 3300034155 | Untreated Peat Soil | MEMAGLWSWVIMAGWTIGLGVLAWWFFMPNPMDRDRKPKKKQ |
| ⦗Top⦘ |