


| Basic Information | |
|---|---|
| Family ID | F070529 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 39 residues |
| Representative Sequence | CPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.76 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 99.19 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.561 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (34.959 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.772 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.650 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.05% β-sheet: 2.63% Coil/Unstructured: 76.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13936 | HTH_38 | 84.55 |
| PF04392 | ABC_sub_bind | 1.63 |
| PF13924 | Lipocalin_5 | 1.63 |
| PF00578 | AhpC-TSA | 1.63 |
| PF03401 | TctC | 0.81 |
| PF07282 | OrfB_Zn_ribbon | 0.81 |
| PF04986 | Y2_Tnp | 0.81 |
| PF05598 | DUF772 | 0.81 |
| PF01527 | HTH_Tnp_1 | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF09423 | PhoD | 0.81 |
| PF07536 | HWE_HK | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.63 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.81 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.81 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.56 % |
| Unclassified | root | N/A | 2.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000532|CNAas_1013245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 570 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1008797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC394B00 | 1124 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1010174 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300000652|ARCol0yngRDRAFT_1008900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 725 | Open in IMG/M |
| 3300000709|KanNP_Total_F14TBDRAFT_1002554 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300000912|JGI12032J12867_1005712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 727 | Open in IMG/M |
| 3300001661|JGI12053J15887_10146420 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300002075|JGI24738J21930_10059085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 786 | Open in IMG/M |
| 3300005566|Ga0066693_10296826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 645 | Open in IMG/M |
| 3300005578|Ga0068854_101708360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 575 | Open in IMG/M |
| 3300006038|Ga0075365_10176527 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300006038|Ga0075365_10666014 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300006172|Ga0075018_10091700 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300006880|Ga0075429_100495509 | Not Available | 1070 | Open in IMG/M |
| 3300006914|Ga0075436_100250151 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300009094|Ga0111539_13222429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 526 | Open in IMG/M |
| 3300009100|Ga0075418_10676241 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300009100|Ga0075418_12071583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 620 | Open in IMG/M |
| 3300010159|Ga0099796_10536375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300010379|Ga0136449_101046109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1307 | Open in IMG/M |
| 3300012924|Ga0137413_10161331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L2C054A000 | 1474 | Open in IMG/M |
| 3300018466|Ga0190268_10109121 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300019871|Ga0193702_1009720 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300019875|Ga0193701_1023267 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300019877|Ga0193722_1037275 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300019879|Ga0193723_1068176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC394B00 | 1028 | Open in IMG/M |
| 3300019881|Ga0193707_1055030 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300019883|Ga0193725_1035757 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300019887|Ga0193729_1078605 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300019890|Ga0193728_1110948 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300019997|Ga0193711_1028644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 700 | Open in IMG/M |
| 3300019999|Ga0193718_1026075 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300020000|Ga0193692_1030131 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300020001|Ga0193731_1038154 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300020002|Ga0193730_1045144 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300020004|Ga0193755_1030076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1797 | Open in IMG/M |
| 3300020006|Ga0193735_1050343 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300020015|Ga0193734_1056146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 716 | Open in IMG/M |
| 3300020021|Ga0193726_1113661 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300020022|Ga0193733_1044465 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300020579|Ga0210407_10443228 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300020581|Ga0210399_10333341 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300021080|Ga0210382_10041434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1778 | Open in IMG/M |
| 3300021082|Ga0210380_10072414 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300021086|Ga0179596_10293808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 809 | Open in IMG/M |
| 3300021168|Ga0210406_10308788 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300021170|Ga0210400_10325492 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300021178|Ga0210408_10307255 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300021344|Ga0193719_10208811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 832 | Open in IMG/M |
| 3300021404|Ga0210389_10405413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC394B00 | 1072 | Open in IMG/M |
| 3300021415|Ga0193694_1011698 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300021418|Ga0193695_1025621 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300021432|Ga0210384_10379155 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300021478|Ga0210402_10403307 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300021479|Ga0210410_10379253 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300021559|Ga0210409_10337529 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300024288|Ga0179589_10077290 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300024288|Ga0179589_10085956 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300024432|Ga0209977_10097347 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300025898|Ga0207692_10420906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 836 | Open in IMG/M |
| 3300025928|Ga0207700_10364884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1260 | Open in IMG/M |
| 3300025937|Ga0207669_10279408 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300025938|Ga0207704_10610252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 894 | Open in IMG/M |
| 3300025961|Ga0207712_10640881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 923 | Open in IMG/M |
| 3300025972|Ga0207668_10742278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 865 | Open in IMG/M |
| 3300025981|Ga0207640_11475788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 610 | Open in IMG/M |
| 3300026285|Ga0209438_1053665 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300026301|Ga0209238_1060648 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300026340|Ga0257162_1007283 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300026341|Ga0257151_1013198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 862 | Open in IMG/M |
| 3300026355|Ga0257149_1009572 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300026356|Ga0257150_1010821 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300026480|Ga0257177_1010602 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300026481|Ga0257155_1008977 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300026497|Ga0257164_1006464 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300026995|Ga0208761_1007094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 893 | Open in IMG/M |
| 3300027310|Ga0207983_1017932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 844 | Open in IMG/M |
| 3300027903|Ga0209488_10449392 | Not Available | 949 | Open in IMG/M |
| 3300027903|Ga0209488_11115642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300028380|Ga0268265_10819308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 908 | Open in IMG/M |
| 3300028589|Ga0247818_10227280 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300028592|Ga0247822_10243615 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300028705|Ga0307276_10021210 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300028711|Ga0307293_10050691 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300028717|Ga0307298_10038437 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300028721|Ga0307315_10038054 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300028722|Ga0307319_10031256 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300028744|Ga0307318_10099222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 985 | Open in IMG/M |
| 3300028754|Ga0307297_10026074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1686 | Open in IMG/M |
| 3300028768|Ga0307280_10027978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1668 | Open in IMG/M |
| 3300028790|Ga0307283_10025107 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300028799|Ga0307284_10023414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2004 | Open in IMG/M |
| 3300028799|Ga0307284_10069057 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300028802|Ga0307503_10091960 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300028814|Ga0307302_10089162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1465 | Open in IMG/M |
| 3300028872|Ga0307314_10031457 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300028880|Ga0307300_10042066 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300028884|Ga0307308_10110970 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300030847|Ga0075405_11603789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1361 | Open in IMG/M |
| 3300030902|Ga0308202_1008792 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300030966|Ga0075383_11266595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 796 | Open in IMG/M |
| 3300031170|Ga0307498_10160734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 753 | Open in IMG/M |
| 3300031199|Ga0307495_10012602 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300031199|Ga0307495_10031649 | Not Available | 977 | Open in IMG/M |
| 3300031422|Ga0308186_1013331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 737 | Open in IMG/M |
| 3300031546|Ga0318538_10465920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 684 | Open in IMG/M |
| 3300031547|Ga0310887_10333574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 874 | Open in IMG/M |
| 3300031640|Ga0318555_10120664 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300031744|Ga0306918_11132221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 605 | Open in IMG/M |
| 3300031792|Ga0318529_10437733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 608 | Open in IMG/M |
| 3300031797|Ga0318550_10613405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 522 | Open in IMG/M |
| 3300031880|Ga0318544_10296329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 627 | Open in IMG/M |
| 3300032052|Ga0318506_10399517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 609 | Open in IMG/M |
| 3300032065|Ga0318513_10470602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 614 | Open in IMG/M |
| 3300032068|Ga0318553_10153876 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300032076|Ga0306924_10583261 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300032205|Ga0307472_101173687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 731 | Open in IMG/M |
| 3300032261|Ga0306920_100550663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1710 | Open in IMG/M |
| 3300032261|Ga0306920_100793729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster | 1390 | Open in IMG/M |
| 3300033290|Ga0318519_10646120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 644 | Open in IMG/M |
| 3300033550|Ga0247829_10667997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 864 | Open in IMG/M |
| 3300034151|Ga0364935_0023014 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300034818|Ga0373950_0060881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 758 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 34.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.44% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.63% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.81% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Host-Associated | Open in IMG/M |
| 3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
| 3300000912 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019871 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030966 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| CNAas_10132451 | 3300000532 | Quercus Rhizosphere | PLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| KanNP_Total_noBrdU_T14TCDRAFT_10087972 | 3300000596 | Soil | SSGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| AP72_2010_repI_A10DRAFT_10101741 | 3300000651 | Forest Soil | LSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| ARCol0yngRDRAFT_10089002 | 3300000652 | Arabidopsis Rhizosphere | GGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| KanNP_Total_F14TBDRAFT_10025542 | 3300000709 | Soil | SGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| JGI12032J12867_10057121 | 3300000912 | Forest Soil | VGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| JGI12053J15887_101464201 | 3300001661 | Forest Soil | CPLSIGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| JGI24738J21930_100590851 | 3300002075 | Corn Rhizosphere | AGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| Ga0066693_102968261 | 3300005566 | Soil | PLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG* |
| Ga0068854_1017083601 | 3300005578 | Corn Rhizosphere | LYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| Ga0075365_101765271 | 3300006038 | Populus Endosphere | MSDLSPKSGGGFNWSAQHLLILLDEEVADGDVTDIVHGE |
| Ga0075365_106660142 | 3300006038 | Populus Endosphere | MSALRPLPGGGFNWSAQHLLILLDEEVADGDVTDIIHGEAEGR |
| Ga0075018_100917003 | 3300006172 | Watersheds | CRANRAEQCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| Ga0075429_1004955091 | 3300006880 | Populus Rhizosphere | MAPRPVLTGGFNWSAQHLLILLDEEVADGDVTDIIHG |
| Ga0075436_1002501511 | 3300006914 | Populus Rhizosphere | PGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG* |
| Ga0111539_132224292 | 3300009094 | Populus Rhizosphere | MSALRPLPGGGFNWSAQHLLILLDEEVADGDVTDIIHGEAEG |
| Ga0075418_106762412 | 3300009100 | Populus Rhizosphere | MSDLSPKSGGGFNWSAQHLLILLDEEVADGDVTDIVHGEAEGR |
| Ga0075418_120715832 | 3300009100 | Populus Rhizosphere | MSDLRPLSGDGFNWSAQHLLISLDEEVADGDVTDIVHGEAE |
| Ga0099796_105363752 | 3300010159 | Vadose Zone Soil | MAGSRPLCPGDLNRSTQHLLILLDKEVADGDVTDIV |
| Ga0136449_1010461091 | 3300010379 | Peatlands Soil | MARQVLGGGFNWSAQHLLILLDEEVAHVDVPDIVHGEAEGR |
| Ga0137413_101613313 | 3300012924 | Vadose Zone Soil | MPRPRPLLPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAE |
| Ga0190268_101091211 | 3300018466 | Soil | HRKSADRLPFSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193702_10097202 | 3300019871 | Soil | QGPLCPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193701_10232671 | 3300019875 | Soil | VMLAQCPVYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193722_10372751 | 3300019877 | Soil | SGNPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193723_10681762 | 3300019879 | Soil | TSLIWPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193707_10550301 | 3300019881 | Soil | ECLLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193725_10357571 | 3300019883 | Soil | PSPLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193729_10786051 | 3300019887 | Soil | RVEQCPVSEGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193728_11109482 | 3300019890 | Soil | QCPVYSGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193711_10286442 | 3300019997 | Soil | CPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193718_10260752 | 3300019999 | Soil | AQCPVYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193692_10301311 | 3300020000 | Soil | SRPDYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193731_10381542 | 3300020001 | Soil | RANQCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193730_10451442 | 3300020002 | Soil | ASRPVYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193755_10300763 | 3300020004 | Soil | RLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193735_10503432 | 3300020006 | Soil | CPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193734_10561461 | 3300020015 | Soil | IWPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193726_11136612 | 3300020021 | Soil | VSPLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193733_10444651 | 3300020022 | Soil | PVSEGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0210407_104432281 | 3300020579 | Soil | MALFCRASRATQCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEA |
| Ga0210399_103333411 | 3300020581 | Soil | YLGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0210382_100414341 | 3300021080 | Groundwater Sediment | AARLLCPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0210380_100724142 | 3300021082 | Groundwater Sediment | MPRPRPLLPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0179596_102938081 | 3300021086 | Vadose Zone Soil | TEGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0210406_103087881 | 3300021168 | Soil | QCPDYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0210400_103254922 | 3300021170 | Soil | QCLICRGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0210408_103072551 | 3300021178 | Soil | SAQCPDYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0193719_102088112 | 3300021344 | Soil | LAECPVYAGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0210389_104054132 | 3300021404 | Soil | LYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0193694_10116982 | 3300021415 | Soil | ALCLFVPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0193695_10256211 | 3300021418 | Soil | LCPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0210384_103791551 | 3300021432 | Soil | PAHDRFWGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0210402_104033072 | 3300021478 | Soil | AARPLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0210410_103792532 | 3300021479 | Soil | VRCPLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0210409_103375291 | 3300021559 | Soil | SLDGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0179589_100772902 | 3300024288 | Vadose Zone Soil | MALSGHARRVDDCPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGE |
| Ga0179589_100859562 | 3300024288 | Vadose Zone Soil | EGPLLGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0209977_100973473 | 3300024432 | Deep Subsurface | HLWSVGQCPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0207692_104209061 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | CPVYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0207700_103648841 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | CPSDLNRSTQHLLILLDKEVVDGDVTDIVHGEAEG |
| Ga0207669_102794082 | 3300025937 | Miscanthus Rhizosphere | RAEQCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0207704_106102521 | 3300025938 | Miscanthus Rhizosphere | CRLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0207712_106408812 | 3300025961 | Switchgrass Rhizosphere | RISAARLLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0207668_107422782 | 3300025972 | Switchgrass Rhizosphere | PVSAFEGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0207640_114757882 | 3300025981 | Corn Rhizosphere | CPDYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0209438_10536651 | 3300026285 | Grasslands Soil | LARSCRVGGAYQCPKLGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0209238_10606482 | 3300026301 | Grasslands Soil | ANDGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0257162_10072832 | 3300026340 | Soil | AEAAGACPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0257151_10131982 | 3300026341 | Soil | LSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0257149_10095721 | 3300026355 | Soil | LSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0257150_10108211 | 3300026356 | Soil | LGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0257177_10106022 | 3300026480 | Soil | DFDGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0257155_10089773 | 3300026481 | Soil | YPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0257164_10064642 | 3300026497 | Soil | PNSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0208761_10070941 | 3300026995 | Soil | PLWPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0207983_10179321 | 3300027310 | Soil | TNRAERCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0209488_104493922 | 3300027903 | Vadose Zone Soil | MPGLSPQSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAK |
| Ga0209488_111156422 | 3300027903 | Vadose Zone Soil | MSAHCPVYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEA |
| Ga0268265_108193082 | 3300028380 | Switchgrass Rhizosphere | RPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0247818_102272801 | 3300028589 | Soil | PLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0247822_102436153 | 3300028592 | Soil | LFLGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307276_100212102 | 3300028705 | Soil | RHFRDGDLNRSTQHLLILLDKEVADGDVTDIVHGEAKG |
| Ga0307293_100506912 | 3300028711 | Soil | PPMSVIWPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307298_100384372 | 3300028717 | Soil | FDLRPNRGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307315_100380542 | 3300028721 | Soil | SAERCPFSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307319_100312563 | 3300028722 | Soil | NRAERCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307318_100992222 | 3300028744 | Soil | MSQPLALFCRANSAERCPFSGGDLNRSTQHLLILLDKEVADGDVTDIV |
| Ga0307297_100260743 | 3300028754 | Soil | ISAARLLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307280_100279781 | 3300028768 | Soil | MSATRPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAE |
| Ga0307283_100251071 | 3300028790 | Soil | YLAAFGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307284_100234143 | 3300028799 | Soil | MPRPRPLLPGDLNRSTQHLLILLDKEVADGDVTDIV |
| Ga0307284_100690571 | 3300028799 | Soil | GACPFWVGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307503_100919602 | 3300028802 | Soil | AEQCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307302_100891623 | 3300028814 | Soil | SRTSAVSPLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307314_100314571 | 3300028872 | Soil | SAARLLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307300_100420662 | 3300028880 | Soil | NSDWPDLPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307308_101109702 | 3300028884 | Soil | FCRANRAEQCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0075405_116037893 | 3300030847 | Soil | VSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0308202_10087921 | 3300030902 | Soil | PVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0075383_112665951 | 3300030966 | Soil | SGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307498_101607341 | 3300031170 | Soil | GMSASRQLYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307495_100126022 | 3300031199 | Soil | RANGAERCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307495_100316492 | 3300031199 | Soil | MPRPRPLLPGDLNRSTQHLLILLDKEVADGDVTDIVHGEA |
| Ga0308186_10133312 | 3300031422 | Soil | VYPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0318538_104659202 | 3300031546 | Soil | RTAGPYISGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0310887_103335742 | 3300031547 | Soil | ALFCRANRAERCPVSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0318555_101206641 | 3300031640 | Soil | ERLIASQQIGCPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0306918_111322212 | 3300031744 | Soil | SLCPDCLGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0318529_104377331 | 3300031792 | Soil | FCPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0318550_106134052 | 3300031797 | Soil | GPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0318544_102963291 | 3300031880 | Soil | SGVPCPLYPGEFNRSVQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0318506_103995171 | 3300032052 | Soil | ISGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0318513_104706021 | 3300032065 | Soil | CPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0318553_101538762 | 3300032068 | Soil | FMGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0306924_105832612 | 3300032076 | Soil | GCPLSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0307472_1011736872 | 3300032205 | Hardwood Forest Soil | PDYSGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0306920_1005506631 | 3300032261 | Soil | MSDLSPQSGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAE |
| Ga0306920_1007937291 | 3300032261 | Soil | VARNGRSMRAGECLFMGGDLNRSTQHLLILLDKEVADGDVTDIVHGEA |
| Ga0318519_106461201 | 3300033290 | Soil | RNGRSMRAGECLFMGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0247829_106679972 | 3300033550 | Soil | PLLTGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0364935_0023014_1582_1698 | 3300034151 | Sediment | CPLIGGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| Ga0373950_0060881_2_109 | 3300034818 | Rhizosphere Soil | LPGDLNRSTQHLLILLDKEVADGDVTDIVHGEAEG |
| ⦗Top⦘ |