


| Basic Information | |
|---|---|
| Family ID | F070503 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 40 residues |
| Representative Sequence | NIALPTRSGRQIAEFSPAGLNLDRVKQACDLTPKKPSKD |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 92.68 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.854 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.756 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.699 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.528 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.93% β-sheet: 11.94% Coil/Unstructured: 73.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF04011 | LemA | 16.26 |
| PF13439 | Glyco_transf_4 | 11.38 |
| PF00490 | ALAD | 10.57 |
| PF13620 | CarboxypepD_reg | 2.44 |
| PF13505 | OMP_b-brl | 2.44 |
| PF03795 | YCII | 1.63 |
| PF01850 | PIN | 1.63 |
| PF00685 | Sulfotransfer_1 | 1.63 |
| PF13564 | DoxX_2 | 0.81 |
| PF08281 | Sigma70_r4_2 | 0.81 |
| PF11412 | DsbC | 0.81 |
| PF14196 | ATC_hydrolase | 0.81 |
| PF00892 | EamA | 0.81 |
| PF01938 | TRAM | 0.81 |
| PF12811 | BaxI_1 | 0.81 |
| PF04389 | Peptidase_M28 | 0.81 |
| PF06580 | His_kinase | 0.81 |
| PF13229 | Beta_helix | 0.81 |
| PF13469 | Sulfotransfer_3 | 0.81 |
| PF02687 | FtsX | 0.81 |
| PF00202 | Aminotran_3 | 0.81 |
| PF01433 | Peptidase_M1 | 0.81 |
| PF14845 | Glycohydro_20b2 | 0.81 |
| PF01370 | Epimerase | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 16.26 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 10.57 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.63 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.81 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.81 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.85 % |
| Unclassified | root | N/A | 34.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10325505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 547 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101883814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300004091|Ga0062387_101301256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 574 | Open in IMG/M |
| 3300004092|Ga0062389_102007941 | Not Available | 755 | Open in IMG/M |
| 3300004635|Ga0062388_101833950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 623 | Open in IMG/M |
| 3300005176|Ga0066679_10310197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1027 | Open in IMG/M |
| 3300005467|Ga0070706_100525168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1101 | Open in IMG/M |
| 3300005533|Ga0070734_10415250 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005555|Ga0066692_10701129 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005921|Ga0070766_10715234 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300006059|Ga0075017_101219154 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006102|Ga0075015_100531493 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006102|Ga0075015_100597546 | Not Available | 646 | Open in IMG/M |
| 3300006102|Ga0075015_100634518 | Not Available | 628 | Open in IMG/M |
| 3300006162|Ga0075030_101430477 | Not Available | 541 | Open in IMG/M |
| 3300006173|Ga0070716_100087620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1876 | Open in IMG/M |
| 3300006174|Ga0075014_100412322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300006358|Ga0068871_100429340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1181 | Open in IMG/M |
| 3300006794|Ga0066658_10772014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300009029|Ga0066793_10415104 | Not Available | 772 | Open in IMG/M |
| 3300009038|Ga0099829_11751874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300009520|Ga0116214_1350533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300009628|Ga0116125_1169302 | Not Available | 611 | Open in IMG/M |
| 3300009643|Ga0116110_1197305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300009643|Ga0116110_1272344 | Not Available | 540 | Open in IMG/M |
| 3300009762|Ga0116130_1306830 | Not Available | 508 | Open in IMG/M |
| 3300010046|Ga0126384_11339825 | Not Available | 665 | Open in IMG/M |
| 3300010046|Ga0126384_11634700 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 607 | Open in IMG/M |
| 3300010343|Ga0074044_10013285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 6144 | Open in IMG/M |
| 3300010343|Ga0074044_10254952 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300010360|Ga0126372_11694451 | Not Available | 673 | Open in IMG/M |
| 3300010376|Ga0126381_100559904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 1621 | Open in IMG/M |
| 3300010376|Ga0126381_104800912 | Not Available | 520 | Open in IMG/M |
| 3300010379|Ga0136449_101079172 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300010398|Ga0126383_12159185 | Not Available | 643 | Open in IMG/M |
| 3300011090|Ga0138579_1071000 | Not Available | 552 | Open in IMG/M |
| 3300011269|Ga0137392_11409661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300011270|Ga0137391_10748522 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300012202|Ga0137363_11224362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300012206|Ga0137380_10428643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1171 | Open in IMG/M |
| 3300012210|Ga0137378_11065153 | Not Available | 723 | Open in IMG/M |
| 3300012361|Ga0137360_10346548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 1243 | Open in IMG/M |
| 3300012361|Ga0137360_11700831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012927|Ga0137416_11143420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300012957|Ga0164303_10757869 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 662 | Open in IMG/M |
| 3300012971|Ga0126369_10171543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2063 | Open in IMG/M |
| 3300012971|Ga0126369_10441508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 1348 | Open in IMG/M |
| 3300012987|Ga0164307_11471838 | Not Available | 575 | Open in IMG/M |
| 3300013297|Ga0157378_12896144 | Not Available | 532 | Open in IMG/M |
| 3300014654|Ga0181525_10820708 | Not Available | 525 | Open in IMG/M |
| 3300014655|Ga0181516_10666153 | Not Available | 538 | Open in IMG/M |
| 3300016404|Ga0182037_11828837 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 543 | Open in IMG/M |
| 3300016445|Ga0182038_10348647 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300017933|Ga0187801_10098810 | Not Available | 1107 | Open in IMG/M |
| 3300017934|Ga0187803_10105724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300017934|Ga0187803_10356799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300017936|Ga0187821_10255402 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300017936|Ga0187821_10366334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 584 | Open in IMG/M |
| 3300017942|Ga0187808_10480292 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300017943|Ga0187819_10511280 | Not Available | 685 | Open in IMG/M |
| 3300017995|Ga0187816_10566387 | Not Available | 511 | Open in IMG/M |
| 3300018002|Ga0187868_1140555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 887 | Open in IMG/M |
| 3300018004|Ga0187865_1268766 | Not Available | 567 | Open in IMG/M |
| 3300018006|Ga0187804_10027358 | Not Available | 2125 | Open in IMG/M |
| 3300018007|Ga0187805_10257032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300018008|Ga0187888_1359131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300018008|Ga0187888_1379658 | Not Available | 535 | Open in IMG/M |
| 3300018035|Ga0187875_10342341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300018042|Ga0187871_10198142 | Not Available | 1123 | Open in IMG/M |
| 3300018043|Ga0187887_10606268 | Not Available | 646 | Open in IMG/M |
| 3300018062|Ga0187784_11084069 | Not Available | 636 | Open in IMG/M |
| 3300018085|Ga0187772_10715127 | Not Available | 719 | Open in IMG/M |
| 3300018088|Ga0187771_10619392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300018088|Ga0187771_11688656 | Not Available | 538 | Open in IMG/M |
| 3300019275|Ga0187798_1357899 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300019787|Ga0182031_1258556 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300020579|Ga0210407_10115237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2052 | Open in IMG/M |
| 3300020581|Ga0210399_10141540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1985 | Open in IMG/M |
| 3300020582|Ga0210395_10429378 | Not Available | 994 | Open in IMG/M |
| 3300021170|Ga0210400_10457540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
| 3300021181|Ga0210388_11179679 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300021404|Ga0210389_11401552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300021405|Ga0210387_10579616 | Not Available | 997 | Open in IMG/M |
| 3300021406|Ga0210386_10324524 | Not Available | 1322 | Open in IMG/M |
| 3300021407|Ga0210383_10817885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300021474|Ga0210390_10633419 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300021476|Ga0187846_10258810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 722 | Open in IMG/M |
| 3300021559|Ga0210409_11621646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300022726|Ga0242654_10401051 | Not Available | 526 | Open in IMG/M |
| 3300025910|Ga0207684_10972398 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300025917|Ga0207660_10930318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300025920|Ga0207649_10501150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 923 | Open in IMG/M |
| 3300025986|Ga0207658_11202402 | Not Available | 693 | Open in IMG/M |
| 3300026221|Ga0209848_1081020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300027674|Ga0209118_1087132 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300027676|Ga0209333_1198581 | All Organisms → cellular organisms → Bacteria → PVC group | 529 | Open in IMG/M |
| 3300027857|Ga0209166_10538025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300027889|Ga0209380_10540683 | Not Available | 678 | Open in IMG/M |
| 3300027911|Ga0209698_10309594 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300028766|Ga0302269_1091945 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300028800|Ga0265338_10638420 | Not Available | 739 | Open in IMG/M |
| 3300029910|Ga0311369_10946482 | Not Available | 684 | Open in IMG/M |
| 3300030007|Ga0311338_10066059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4698 | Open in IMG/M |
| 3300030503|Ga0311370_10686853 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300030520|Ga0311372_10224073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3096 | Open in IMG/M |
| 3300030878|Ga0265770_1084214 | Not Available | 626 | Open in IMG/M |
| 3300031128|Ga0170823_14708028 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031711|Ga0265314_10708505 | Not Available | 508 | Open in IMG/M |
| 3300031718|Ga0307474_10114174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2025 | Open in IMG/M |
| 3300031823|Ga0307478_10070716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2638 | Open in IMG/M |
| 3300031823|Ga0307478_11068646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300031962|Ga0307479_10880750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 868 | Open in IMG/M |
| 3300032001|Ga0306922_11996913 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 565 | Open in IMG/M |
| 3300032160|Ga0311301_10682500 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300032261|Ga0306920_101764739 | Not Available | 874 | Open in IMG/M |
| 3300032805|Ga0335078_11615944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300032895|Ga0335074_10501010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
| 3300032895|Ga0335074_10584267 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300032897|Ga0335071_10176876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2086 | Open in IMG/M |
| 3300032898|Ga0335072_10822363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300033134|Ga0335073_11279827 | Not Available | 727 | Open in IMG/M |
| 3300033158|Ga0335077_11304738 | Not Available | 705 | Open in IMG/M |
| 3300033158|Ga0335077_11419073 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.13% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.06% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.44% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.81% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_103255051 | 3300001356 | Peatlands Soil | VEVKTRTGYAIAEFSPAGLNLDEVRKSCDLTPKKPSKD* |
| JGIcombinedJ26739_1018838142 | 3300002245 | Forest Soil | GAQIFKVELPTQSGRQIAEFTPGGLSIDQVRRACDLTPKKPSKD* |
| Ga0062387_1013012562 | 3300004091 | Bog Forest Soil | RGMMGANIFNIALPTRSGRQIAEFSPSGLNFDRVKQACDLTPKKPSKD* |
| Ga0062389_1020079411 | 3300004092 | Bog Forest Soil | LIGAQVFKIQIPGQRGQEIAEFSPAGLNLAQFKQACDLTYKKPSN* |
| Ga0062388_1018339502 | 3300004635 | Bog Forest Soil | NIALPTRSGRQIAEFSPAGLNLDRVKQACDLTPKKPSKD* |
| Ga0066679_103101972 | 3300005176 | Soil | ARVFNIALPTRSGRQIAEFSPAGLNLERVRQACDLTPKKPSKD* |
| Ga0070706_1005251681 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VFKVELRTRSGRQIAEFSPGGLNLDRVKQACDLTPKKPSTD* |
| Ga0070734_104152501 | 3300005533 | Surface Soil | ALPNRNGREIAEFSPAGLNVDQVRSACDLTPKRPSKD* |
| Ga0066692_107011291 | 3300005555 | Soil | HIFKVQIPGQRGPEIAEFSPAGLDLARVKQACDLTPKKPSKN* |
| Ga0070766_107152341 | 3300005921 | Soil | LPTRNGREIAEFSPAGLNLDEVHKSCDLTPKKPSKD* |
| Ga0075017_1012191542 | 3300006059 | Watersheds | VELRGQYGPEIAEFSPSGLDLARVKQTCDLTSKKPSKN* |
| Ga0075015_1005314931 | 3300006102 | Watersheds | VFNVALPTRSGRQIAEFSPTGLNFDRVKQACDLTPKKPSKD* |
| Ga0075015_1005975462 | 3300006102 | Watersheds | LMQAHVFNIAIPTRSGRQIAEFQPDGLNIDQVHKACDLSPKKPSKD* |
| Ga0075015_1006345182 | 3300006102 | Watersheds | MGANVFNVALPTRSGRQIAEFSPGGLDFARVKQACDLTPKKPSKD* |
| Ga0075030_1014304771 | 3300006162 | Watersheds | IAIPTRSGRQIAEFQPDGLNIDQVHKACDLSPKKPSKD* |
| Ga0070716_1000876203 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TVFNIAIPTRSGRQIAEFDPAGLNIDQVRKACDITPKKPSAD* |
| Ga0075014_1004123222 | 3300006174 | Watersheds | FNVALPTRSGRQIAEFSPGGLNVDRVRQACDLTPKKPSKD* |
| Ga0068871_1004293402 | 3300006358 | Miscanthus Rhizosphere | RNGPEIAEFSPAGLDLGRVKQACDLTPKKPSSDD* |
| Ga0066658_107720142 | 3300006794 | Soil | VFKVELPTRSGRQIAKFSPGGLNLDRVRQACDLTSKKPSKD* |
| Ga0066793_104151042 | 3300009029 | Prmafrost Soil | AQVFKIELPTRSGRQIAEFTPGGLNIDQVRHACDIAPKKPSKD* |
| Ga0099829_117518742 | 3300009038 | Vadose Zone Soil | QVFKVELPTRSGRQIAEFTPGGLNVDQVRQACDLTPKKPSKD* |
| Ga0116214_13505332 | 3300009520 | Peatlands Soil | KVFKVELPTRSGRQIAEFSPGGLNFDRIKRACDLTPKKPSTD* |
| Ga0116125_11693021 | 3300009628 | Peatland | QVFNVALPTRNGREIAEFAPAGLNIDQVRQACDITPKKPSKD* |
| Ga0116110_11973052 | 3300009643 | Peatland | FKVELPTRSGRQIAEFSPGGLNPDRIKQACDLTPKKPSTD* |
| Ga0116110_12723442 | 3300009643 | Peatland | AAQVFNIAMPTRSGRQIAEFSPAGLNVERVKQACDLTPKKPSKD* |
| Ga0116130_13068302 | 3300009762 | Peatland | ELPTRSGRQIAEFSPGGLNLDRIRQACELTPKKPSTD* |
| Ga0126384_113398251 | 3300010046 | Tropical Forest Soil | NVALPTRSGRQIAEFSPAGLYTDQVLRACDLTPKKPSKD* |
| Ga0126384_116347002 | 3300010046 | Tropical Forest Soil | AIPTRSGRQIAEFDPAGLDPQEVRKACDLTPKKPSGD* |
| Ga0074044_100132851 | 3300010343 | Bog Forest Soil | LPTRSGRQIAEFSPAGLDFGRVKEACDLTPKKPSKE* |
| Ga0074044_102549521 | 3300010343 | Bog Forest Soil | MPTRSGRQIAEFSPAGLNLDRVKEACDLTPKKPSKD* |
| Ga0126372_116944511 | 3300010360 | Tropical Forest Soil | QAQVFNIAIPTRSGRQIAEFDPDGLDTGQVQKVCDLTPKKPSKD* |
| Ga0126381_1005599043 | 3300010376 | Tropical Forest Soil | GMIQAQVFNIAIPTRSGRQIAEFDPDGLDTGQVQKVCDLTPKKPSKD* |
| Ga0126381_1048009121 | 3300010376 | Tropical Forest Soil | GSQVFNISLPTRSGRQIAEFSPFGLDLDQVRHACDITPKKPSKD* |
| Ga0136449_1010791724 | 3300010379 | Peatlands Soil | WAKVFKVELRTRSGRQIAEFSPGELNFDRIKQACDLTPKKPSTD* |
| Ga0126383_121591851 | 3300010398 | Tropical Forest Soil | IQAQVFNIAIPTRSGRQIAEFDPDGLDTGQVQKVCDLTPKKPSKD* |
| Ga0138579_10710002 | 3300011090 | Peatlands Soil | IGAQVFNVKLPTRSGRQIAEFSPSGLDLDRAKHPCDLTPKKPSSD* |
| Ga0137392_114096612 | 3300011269 | Vadose Zone Soil | VFKVELPTRSGRQIAEFTPGGLNVDQVRQACDLTPKKPSKD* |
| Ga0137391_107485222 | 3300011270 | Vadose Zone Soil | QVFKVELPTRSGRQIAEFSPGGLNLDRVRQACDLTPKKPSRD* |
| Ga0137363_112243622 | 3300012202 | Vadose Zone Soil | EIRGRRGPEIAEFSPGGLDLARVKQACDLTAKRPGKD* |
| Ga0137380_104286432 | 3300012206 | Vadose Zone Soil | KVEIRGRRGPEIAEFSPGGLDLARVKHVCDLTPKR* |
| Ga0137378_110651531 | 3300012210 | Vadose Zone Soil | LRTRSGRQIAEFAPAGLNVDQVRQACDVTPKKPSKD* |
| Ga0137360_103465482 | 3300012361 | Vadose Zone Soil | KVELPTRSGRQIAEFSPGGLNLDRVRQACDLTPKKPSKD* |
| Ga0137360_117008311 | 3300012361 | Vadose Zone Soil | VELPTRSGRQIAEFSPGGLNLDRVRQACDLTPKKPSKD* |
| Ga0137416_111434202 | 3300012927 | Vadose Zone Soil | FKIEIPGRRGPEIAEFSPAGLDLARVKQVCDLTPKRPGGN* |
| Ga0164303_107578691 | 3300012957 | Soil | IPTRSGRQIAEYQPEGLDINQVNKACDLTPKKPSKD* |
| Ga0126369_101715431 | 3300012971 | Tropical Forest Soil | QAHIFNIAISTGGGRQIAEFQPAGLDIDQVRKACDLTPKKPSN* |
| Ga0126369_104415081 | 3300012971 | Tropical Forest Soil | TRSGRQIAEFDPDGLDTGQVQKVCDLTPKKPSKD* |
| Ga0164307_114718382 | 3300012987 | Soil | GVMGAQLVRIALPTRNGREIAEFSPSGLDANEVRRACDITPKKPSKD* |
| Ga0157378_128961441 | 3300013297 | Miscanthus Rhizosphere | KVELRGRTGSEIAEFSPGGLDLGRVKQSCDLTPKKTSKN* |
| Ga0181525_108207081 | 3300014654 | Bog | ALPMRNGREIAEFSPAGLDLGRVREACDLKPKKPSGD* |
| Ga0181516_106661531 | 3300014655 | Bog | TRSGREIAEFAPAGLNIDQVRQACDITPKKPSKD* |
| Ga0182037_118288371 | 3300016404 | Soil | NVAIPTRSGRQSAEFQPEGLDIDQVRRACDLTPKKPSKD |
| Ga0182038_103486472 | 3300016445 | Soil | ARGMIQAQIFNIAIQTRSGRQIAEFDPDGLDAGEVRKACDMTPKKPSKD |
| Ga0187801_100988102 | 3300017933 | Freshwater Sediment | VELPTRSGRQIAEFSPGGLDFARVKEGCDLTTQKPGHD |
| Ga0187803_101057241 | 3300017934 | Freshwater Sediment | RGRNGPEIAEFSPAGLDLARVKQACDLTPRKPSKD |
| Ga0187803_103567991 | 3300017934 | Freshwater Sediment | RGRNGPEIAEFSPAGLDLARVKQACDLTPRKPSKN |
| Ga0187821_102554021 | 3300017936 | Freshwater Sediment | NVELRGRSGPEMAEFSPDGLDAGRFKEACNLTPKKPSND |
| Ga0187821_103663342 | 3300017936 | Freshwater Sediment | NIAIPTRSGRQIAEFQPDGLNIDQVRKACDLSPKKPSKD |
| Ga0187808_104802921 | 3300017942 | Freshwater Sediment | NIALPTRSGRQIAEFSPDGLDLDMVRKECDLTPKKPSKD |
| Ga0187819_105112802 | 3300017943 | Freshwater Sediment | VFNVAIPTRSGRQIAEFRPDGLNIDQVRIACDLAPKKPSKD |
| Ga0187816_105663872 | 3300017995 | Freshwater Sediment | NIEARTRGGAEIAEFSPAGLKLDLVRQSCDLTPKKPSKD |
| Ga0187868_11405551 | 3300018002 | Peatland | PTPSSRQIAEFSPAGLNLDRVRQACDLTPKKPSKD |
| Ga0187865_12687662 | 3300018004 | Peatland | AQVFKVELPTRSGRQIAEFSPGGLSLDRFKQACDLTPKKPSTD |
| Ga0187804_100273583 | 3300018006 | Freshwater Sediment | MQAHVFNVAIPTRSGRQIAEFRPDGLNIDQVRIACDLAPKKPSKD |
| Ga0187805_102570321 | 3300018007 | Freshwater Sediment | AHVFNIAIPTRSGRQIAEFQPDGLDIQQVRSACDLTPKKPSKD |
| Ga0187888_13591312 | 3300018008 | Peatland | NIALPTRSGRQIAEFTPGGLNFDRVKQACDLTPKKPSKD |
| Ga0187888_13796582 | 3300018008 | Peatland | QVFNIELPTFRSREIAEFSPAGLDFGRVREACDLKPKKPSKD |
| Ga0187875_103423412 | 3300018035 | Peatland | VELPTRSGRQIAEFSPGGLNPDRIKQACDLTPKKPSTD |
| Ga0187871_101981421 | 3300018042 | Peatland | VFNIALPTRSGRQIAEFSPAGLNLDEIKKSCDLTPKRPSKD |
| Ga0187887_106062682 | 3300018043 | Peatland | LLGGQIFNIALPTRSGRQIAEFSPEGLNFDRVKQACDLAPKKPSKD |
| Ga0187784_110840691 | 3300018062 | Tropical Peatland | IALPTRSGRQIAEFSPEGLNIDQVKQACDLTPKKPRAD |
| Ga0187772_107151271 | 3300018085 | Tropical Peatland | GQIFNVQVRTRSGSQIAEFSPAGLNLDSVRQSCDLTPKKP |
| Ga0187771_106193921 | 3300018088 | Tropical Peatland | IRGRSGPEIAEFSPAGLDLTRVKQACDLTPKKPAKY |
| Ga0187771_116886561 | 3300018088 | Tropical Peatland | TIFKIEVRTRGGREIAEFSPAGLNLDAVRQSCDLTPKKP |
| Ga0187798_13578992 | 3300019275 | Peatland | GAQVFKVELPTRSGRQIAEFSPGGLDFDRVRQDCDITPKKPSGD |
| Ga0182031_12585561 | 3300019787 | Bog | MSAQVFNIALPTRSGRQIAEFTPGGLNFDRVKQACDLTPKKPSKD |
| Ga0210407_101152371 | 3300020579 | Soil | TTRGLIGSQVFKVELPTRSGRQIAEFTPAGLDLDQVRHACDLTPKKPGKD |
| Ga0210399_101415401 | 3300020581 | Soil | NVELPTRSGRQIAEFSPSGLNLDRIRQACDLTPKKPSKD |
| Ga0210395_104293783 | 3300020582 | Soil | FNVALPTRSGREIAEFAPAGLNIDQVRQACDITPKKPSKD |
| Ga0210400_104575402 | 3300021170 | Soil | TTRGLIGAQIFKVELPTQSGRQIAEFTPGGLSIDQVRRACDLTPKKPSKD |
| Ga0210388_111796792 | 3300021181 | Soil | ALPTGSGRQIAEFSPVGLNLDRVKQACDLTPKKPSKD |
| Ga0210389_114015522 | 3300021404 | Soil | KIELPGRRGSEIAEFSPGGLDLSQVKQACDLTPKKPSKD |
| Ga0210387_105796162 | 3300021405 | Soil | PTRSGRQIAEFSPSGLNLDRIRQACDLTSKKPSKD |
| Ga0210386_103245241 | 3300021406 | Soil | VFNVALPTRSGREIAEFAPAGLNIDQVRQACDITPKKPSKD |
| Ga0210383_108178851 | 3300021407 | Soil | LPTRSGREIAEFSPAGLNLDEVRKSCDLSPKKPSKD |
| Ga0210390_106334192 | 3300021474 | Soil | FNIALPTRSGRQIAEFSPAGLDFGRVGKACDLTPKKPSKD |
| Ga0187846_102588102 | 3300021476 | Biofilm | ARGMIQAHVFNIAIQNRRGGRQIAEFQPDGLNVDEVRKACDITPKKPSRD |
| Ga0210409_116216462 | 3300021559 | Soil | LIGAQIFKVELPTQSGRQIAEFTPGGLSIDQVRRACDLTPKKPSKD |
| Ga0242654_104010511 | 3300022726 | Soil | VFKVELPTRSGQQIAEFSPAGLNLDRVRQACDITPKKP |
| Ga0207684_109723981 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VFKVELRTRSGRQIAEFSPGGLNLDRVKQACDLTPKKPSTD |
| Ga0207660_109303181 | 3300025917 | Corn Rhizosphere | RGRNGPEIAEFSPAGLDLARVKEACDLTVKKPSKD |
| Ga0207649_105011501 | 3300025920 | Corn Rhizosphere | RGRNGPEIAEFSPAGLDLARVKQTCDLTAKKPSRD |
| Ga0207658_112024022 | 3300025986 | Switchgrass Rhizosphere | RGRKGPEIAEFSPAGLDLARVKQTCDLTPKKPSKN |
| Ga0209848_10810202 | 3300026221 | Permafrost Soil | LGRRNPEIAEFSPAGLDLARVKQACDLNPKKPSKN |
| Ga0209118_10871321 | 3300027674 | Forest Soil | FKVELPTRSGRQIAEFSPGGLNLDRIRQACDLTPKKPSKD |
| Ga0209333_11985812 | 3300027676 | Forest Soil | GLLGAQLFNIELPTASGRQIAEFTPAGLNLDEVRKACDLTPKKPSKD |
| Ga0209166_105380251 | 3300027857 | Surface Soil | KIEFLGRRGSQIAEFSPDGLDLTRVSQACGLTPKQP |
| Ga0209380_105406831 | 3300027889 | Soil | ARGGREIAEFSPAGLDLGAVRQACDLKPKKPSSDD |
| Ga0209698_103095944 | 3300027911 | Watersheds | FNVALPTRSGRQIAEFSPSGLNVDRVRQACDLTPKKPSKD |
| Ga0302269_10919452 | 3300028766 | Bog | VFNIALPTRSGRQIAEFSPAGLNFDRIRQACDLTPKKPSKD |
| Ga0265338_106384202 | 3300028800 | Rhizosphere | QVFKVELPTKSGRQIAEFSPAGLNVDEVRKACDLTPKKPSND |
| Ga0311369_109464822 | 3300029910 | Palsa | SAQVFNIALPTRSGRQIAEFSPGGLNFERVKQACDLTPKKPSKD |
| Ga0311338_100660595 | 3300030007 | Palsa | LPTRSGRQIAEFSPAGLDFDRVRKACDLTPKKPSKD |
| Ga0311370_106868531 | 3300030503 | Palsa | QLFNIAAPTRFGREIAEFSPSGLNLDEVKKSCDLTPKKP |
| Ga0311372_102240733 | 3300030520 | Palsa | FKIEVPTPSGRQIAEFTPAGLNQDEVRHACDLAPKKPSKD |
| Ga0265770_10842141 | 3300030878 | Soil | ELRGRAGSEIAEFSPGGLDLAQARQACDLTPKKPGKD |
| Ga0170823_147080282 | 3300031128 | Forest Soil | IFKVEIPGRRGPEIAEFSPAGLDLARVKQDCDLNPKKPSKN |
| Ga0265314_107085051 | 3300031711 | Rhizosphere | KVELPTKSGRQIAEFSPAGLNVDEVRKACDLTPKKPSND |
| Ga0307474_101141741 | 3300031718 | Hardwood Forest Soil | TTRGLMQAHVFNIAIPTRSGRQIAEFQPEGLDVDQVRKACDLTPKKPSKD |
| Ga0307478_100707161 | 3300031823 | Hardwood Forest Soil | QVFNIALPTPSGRQIAEFSPAGLNLDQVRQYCDLTPKKPSKD |
| Ga0307478_110686462 | 3300031823 | Hardwood Forest Soil | AIPTRSGRQIAEFQPEGLDVDQVRKACDLTPKKPSKD |
| Ga0307479_108807501 | 3300031962 | Hardwood Forest Soil | FKIELPTRSGRQIAEFSPAGLNLDQVRHACDLTPKKPSKD |
| Ga0306922_119969131 | 3300032001 | Soil | KAQVFKIALPTRSGRQIAEFSPDGLDVDQVRKACDITPKKPSKD |
| Ga0311301_106825001 | 3300032160 | Peatlands Soil | WAKVFKVELRTRSGRQIAEFSPGELNFDRIKQACDLTPKKPSTD |
| Ga0306920_1017647391 | 3300032261 | Soil | VFKIALPTRSGRQIAEFSPDGLDVDQVRKACDITPKKPSKD |
| Ga0335078_116159442 | 3300032805 | Soil | VFNIALPTASGRQIAEFSPAGLNVDQVRKACDLTPKKPD |
| Ga0335074_105010101 | 3300032895 | Soil | FNIALPTPSGRQIAEFSPAGLNIDEVRKVCDLTPKKPSKD |
| Ga0335074_105842671 | 3300032895 | Soil | ALPTRSGRQIAEFSPAGLDLGLVKKECDLTPKKPSKD |
| Ga0335071_101768763 | 3300032897 | Soil | GTARGMVGAHIFNIAIPTRSGRQIAEFDPAGLNIDQVHKACDITPKKPSSD |
| Ga0335072_108223632 | 3300032898 | Soil | FKVELPTRSGREIAEFSPAGLDLDQVRKACDITPKKPSKD |
| Ga0335073_112798272 | 3300033134 | Soil | VFNVALPTRSGREIAEFSPAGLNVDQVRQSCDITPKRPSKD |
| Ga0335077_113047382 | 3300033158 | Soil | TIFKIEVRTRGGREIAEFSPAGLNLDTVRQSCDLTPKKP |
| Ga0335077_114190732 | 3300033158 | Soil | FNVALPTRSGRQIAQFSPAGLDFSRVKEACDLTPKKPSND |
| ⦗Top⦘ |