


| Basic Information | |
|---|---|
| Family ID | F070492 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 40 residues |
| Representative Sequence | DVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.82 % |
| % of genes near scaffold ends (potentially truncated) | 98.37 % |
| % of genes from short scaffolds (< 2000 bps) | 86.18 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.935 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.268 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.211 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.593 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.92% β-sheet: 0.00% Coil/Unstructured: 83.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13462 | Thioredoxin_4 | 9.76 |
| PF00156 | Pribosyltran | 5.69 |
| PF13537 | GATase_7 | 4.88 |
| PF04674 | Phi_1 | 3.25 |
| PF00903 | Glyoxalase | 1.63 |
| PF02661 | Fic | 1.63 |
| PF02934 | GatB_N | 1.63 |
| PF04326 | AlbA_2 | 1.63 |
| PF13857 | Ank_5 | 0.81 |
| PF11412 | DsbC | 0.81 |
| PF01636 | APH | 0.81 |
| PF12796 | Ank_2 | 0.81 |
| PF06831 | H2TH | 0.81 |
| PF02631 | RecX | 0.81 |
| PF05050 | Methyltransf_21 | 0.81 |
| PF00665 | rve | 0.81 |
| PF10094 | DUF2332 | 0.81 |
| PF05163 | DinB | 0.81 |
| PF03668 | ATP_bind_2 | 0.81 |
| PF01850 | PIN | 0.81 |
| PF03965 | Penicillinase_R | 0.81 |
| PF13181 | TPR_8 | 0.81 |
| PF00210 | Ferritin | 0.81 |
| PF13531 | SBP_bac_11 | 0.81 |
| PF13197 | DUF4013 | 0.81 |
| PF00483 | NTP_transferase | 0.81 |
| PF02637 | GatB_Yqey | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 2.44 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 2.44 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 1.63 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.81 |
| COG1610 | Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activity | General function prediction only [R] | 0.81 |
| COG1660 | RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domain | Signal transduction mechanisms [T] | 0.81 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.81 |
| COG2137 | SOS response regulatory protein OraA/RecX, interacts with RecA | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.81 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.81 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.81 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.93 % |
| Unclassified | root | N/A | 4.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0474751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300001545|JGI12630J15595_10098743 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005174|Ga0066680_10169944 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300005332|Ga0066388_104975130 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005529|Ga0070741_10406636 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300005556|Ga0066707_10427614 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005559|Ga0066700_11004832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300005566|Ga0066693_10169449 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300005574|Ga0066694_10091433 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300005575|Ga0066702_10003935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5713 | Open in IMG/M |
| 3300005576|Ga0066708_10128596 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300005598|Ga0066706_10285835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300005614|Ga0068856_102642836 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005618|Ga0068864_101353751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300006032|Ga0066696_10772617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300006034|Ga0066656_10095272 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300006173|Ga0070716_100444787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300006755|Ga0079222_10578840 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300006755|Ga0079222_11884192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300006791|Ga0066653_10060331 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300006800|Ga0066660_10344597 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300006800|Ga0066660_10694590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300006806|Ga0079220_11294800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300007265|Ga0099794_10206069 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300007265|Ga0099794_10396867 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009012|Ga0066710_100526396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1786 | Open in IMG/M |
| 3300009012|Ga0066710_102840765 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009088|Ga0099830_11390832 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009088|Ga0099830_11759738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300009093|Ga0105240_12198282 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300009098|Ga0105245_10089410 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
| 3300009137|Ga0066709_100457833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1786 | Open in IMG/M |
| 3300009137|Ga0066709_103156927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300009137|Ga0066709_103739123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300009162|Ga0075423_11561913 | Not Available | 709 | Open in IMG/M |
| 3300009174|Ga0105241_10892426 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300010321|Ga0134067_10013311 | All Organisms → cellular organisms → Bacteria | 2381 | Open in IMG/M |
| 3300010325|Ga0134064_10275589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300010326|Ga0134065_10229201 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300010335|Ga0134063_10650680 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010336|Ga0134071_10517297 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010358|Ga0126370_12518113 | Not Available | 513 | Open in IMG/M |
| 3300010360|Ga0126372_10028243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3463 | Open in IMG/M |
| 3300010361|Ga0126378_11803567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300010364|Ga0134066_10234723 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300010375|Ga0105239_10578800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1280 | Open in IMG/M |
| 3300010396|Ga0134126_11591931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300011269|Ga0137392_10776929 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300011269|Ga0137392_11482231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300011271|Ga0137393_10171370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1822 | Open in IMG/M |
| 3300012096|Ga0137389_11472661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012189|Ga0137388_10302835 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300012189|Ga0137388_11414391 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012200|Ga0137382_10335378 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300012202|Ga0137363_10107296 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
| 3300012202|Ga0137363_10377340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1178 | Open in IMG/M |
| 3300012203|Ga0137399_10287957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1355 | Open in IMG/M |
| 3300012211|Ga0137377_11641754 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012349|Ga0137387_10866218 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012350|Ga0137372_10372187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300012350|Ga0137372_10542411 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300012351|Ga0137386_10346387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300012351|Ga0137386_10636901 | Not Available | 767 | Open in IMG/M |
| 3300012361|Ga0137360_10364439 | Not Available | 1212 | Open in IMG/M |
| 3300012362|Ga0137361_11922706 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012363|Ga0137390_10080938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3192 | Open in IMG/M |
| 3300012582|Ga0137358_10426945 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300012683|Ga0137398_10932130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300012918|Ga0137396_10322044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1144 | Open in IMG/M |
| 3300012918|Ga0137396_11217333 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012923|Ga0137359_11782490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300012927|Ga0137416_11303345 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012929|Ga0137404_10309385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1373 | Open in IMG/M |
| 3300012929|Ga0137404_10996836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300012930|Ga0137407_10637865 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300012944|Ga0137410_11589315 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012948|Ga0126375_11625332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300012960|Ga0164301_11579038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300012961|Ga0164302_10035934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2327 | Open in IMG/M |
| 3300012986|Ga0164304_11885859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300013296|Ga0157374_11205605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300014166|Ga0134079_10096763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300015241|Ga0137418_11054046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300015245|Ga0137409_10707846 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300015374|Ga0132255_101339543 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300018468|Ga0066662_10286921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1372 | Open in IMG/M |
| 3300020018|Ga0193721_1045437 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300021080|Ga0210382_10177345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300025321|Ga0207656_10151258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300025898|Ga0207692_10878343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300025906|Ga0207699_10660808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300025914|Ga0207671_10338021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1193 | Open in IMG/M |
| 3300025927|Ga0207687_11927994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300025928|Ga0207700_10635186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300025949|Ga0207667_10117484 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300026078|Ga0207702_12383141 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300026295|Ga0209234_1034239 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
| 3300026298|Ga0209236_1175628 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300026310|Ga0209239_1012362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4477 | Open in IMG/M |
| 3300026314|Ga0209268_1003094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7770 | Open in IMG/M |
| 3300026325|Ga0209152_10023332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2116 | Open in IMG/M |
| 3300026328|Ga0209802_1081331 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300026329|Ga0209375_1078034 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300026329|Ga0209375_1241592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300026331|Ga0209267_1086392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1349 | Open in IMG/M |
| 3300026335|Ga0209804_1221440 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300026342|Ga0209057_1046335 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300026351|Ga0257170_1047189 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300026538|Ga0209056_10647164 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300026547|Ga0209156_10170385 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300027591|Ga0209733_1146453 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027633|Ga0208988_1022340 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300027663|Ga0208990_1083334 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300027671|Ga0209588_1018737 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300028673|Ga0257175_1129327 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300028792|Ga0307504_10008820 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300028884|Ga0307308_10015919 | All Organisms → cellular organisms → Bacteria | 3408 | Open in IMG/M |
| 3300031720|Ga0307469_10264716 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300031771|Ga0318546_10940558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300031942|Ga0310916_11503800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300031962|Ga0307479_10139074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2378 | Open in IMG/M |
| 3300032067|Ga0318524_10602524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.25% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_04747512 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | EFDVTNISDSRYKIAKESEEIPIQYAPSRTIGGSLKFHF* |
| JGI12630J15595_100987431 | 3300001545 | Forest Soil | FDITNVGNSIYQIAKESEEIPIQYAPSHTVGGSLKFHF* |
| Ga0066680_101699442 | 3300005174 | Soil | RRLDFEFDVTNVFDSIYQVAKESEEIPIQYAPSRTIGGSLKFHF* |
| Ga0066388_1049751301 | 3300005332 | Tropical Forest Soil | LEFDITNVSNSIYQMAKESEEIPIQYAPSRTVGGSLKLHF* |
| Ga0070741_104066361 | 3300005529 | Surface Soil | GVEFDVTNVSNSIYEIAKESEEIPIQFAPSRTVGGALKFHF* |
| Ga0066707_104276142 | 3300005556 | Soil | NVANNIYQVAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0066700_110048321 | 3300005559 | Soil | KLDLEFDVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0066693_101694491 | 3300005566 | Soil | DVSNSIYQIAKESEEIPIEYAPSRTVGGSLKFHF* |
| Ga0066694_100914332 | 3300005574 | Soil | EFDVTNVSNSIYQIAKESEEIPIQYAPSRTIGGSLKFHF* |
| Ga0066702_100039356 | 3300005575 | Soil | NVSNSIYKIAKESEEIPIQYAPARTVGGSLKFHF* |
| Ga0066708_101285961 | 3300005576 | Soil | LELDITNISNSIYQIAKESEEIPIQYAPSRTVGGSLRL |
| Ga0066706_102858351 | 3300005598 | Soil | TNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF* |
| Ga0068856_1026428361 | 3300005614 | Corn Rhizosphere | TNVSDSRYQIAKESEEIPIQFAPSRTVGGSMKFHF* |
| Ga0068864_1013537512 | 3300005618 | Switchgrass Rhizosphere | ALEFDVTNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF* |
| Ga0066696_107726171 | 3300006032 | Soil | PRWLELEFDVTNVSNSVYQIAKESDEIPIQYAPSRTAGGSLKFHF* |
| Ga0066656_100952723 | 3300006034 | Soil | NVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF* |
| Ga0070716_1004447872 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PRRLALEFDITNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF* |
| Ga0079222_105788402 | 3300006755 | Agricultural Soil | RLDMEFDVTNVSNSIYQIAKESDEIPIQYAPSRTVGGSLKFHF* |
| Ga0079222_118841921 | 3300006755 | Agricultural Soil | RLDLELDATNLTDNRYKVSKESEEIPVQFAPSRTLGGSLKFHF* |
| Ga0066653_100603314 | 3300006791 | Soil | TNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0066660_103445971 | 3300006800 | Soil | LDLEFDITNVSNSIYRIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0066660_106945901 | 3300006800 | Soil | TNVGDNRYQIAKESEEIPIQFAPSRTIGGTLRVRF* |
| Ga0079220_112948002 | 3300006806 | Agricultural Soil | TNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF* |
| Ga0099794_102060691 | 3300007265 | Vadose Zone Soil | TNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0099794_103968672 | 3300007265 | Vadose Zone Soil | LEFDITNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKYHF* |
| Ga0066710_1005263961 | 3300009012 | Grasslands Soil | VTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF |
| Ga0066710_1028407652 | 3300009012 | Grasslands Soil | RSFDLEFDITNVSNSIYKIAKESEEIPIQYAPSRTAGGSLKFHF |
| Ga0099830_113908322 | 3300009088 | Vadose Zone Soil | NVSNNVYKIAKESEEIPIQYAPSRTAGGSLKFHF* |
| Ga0099830_117597382 | 3300009088 | Vadose Zone Soil | DLEIDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF* |
| Ga0105240_121982821 | 3300009093 | Corn Rhizosphere | NLSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0105245_100894106 | 3300009098 | Miscanthus Rhizosphere | DLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF* |
| Ga0066709_1004578331 | 3300009137 | Grasslands Soil | VTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF* |
| Ga0066709_1031569272 | 3300009137 | Grasslands Soil | TNLSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0066709_1037391232 | 3300009137 | Grasslands Soil | LEFDVTNVSNNIYQIAKESEEIPIQYAPSRTVGGALKFHF* |
| Ga0075423_115619131 | 3300009162 | Populus Rhizosphere | FDVTNVSNSIYQIAKESEEIPIQYAPSRTAGGSLKFHF* |
| Ga0105241_108924261 | 3300009174 | Corn Rhizosphere | NVSDSRYQIAKESEEIPIQFAPSRTVGGSMKFHF* |
| Ga0134067_100133111 | 3300010321 | Grasslands Soil | TNASDSRYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0134064_102755891 | 3300010325 | Grasslands Soil | FDVTNVSDNVYQIAKESEEIPIQYSPPRTVGGSLKLHF* |
| Ga0134065_102292011 | 3300010326 | Grasslands Soil | SFDLEFDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0134063_106506802 | 3300010335 | Grasslands Soil | RHLDLEFNVTNVSNSIYQIAKESEEIPIQFAPSRTVGGSLKFHF* |
| Ga0134071_105172971 | 3300010336 | Grasslands Soil | RRLDFEFDVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0126370_125181132 | 3300010358 | Tropical Forest Soil | EFDVTNVSNSIYEIAKESEEIPIQYAPSRTIGGSVMFRF* |
| Ga0126372_100282434 | 3300010360 | Tropical Forest Soil | FDVTNVSNSIYQIAKESEEIPIQYAPARTVGGSLKFHF* |
| Ga0126372_111023551 | 3300010360 | Tropical Forest Soil | RVGVEFNATNVGNSVYKIAKESDEIPIQYAPWRTIGASLRFNF* |
| Ga0126378_118035671 | 3300010361 | Tropical Forest Soil | MTNVSDSRYRIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0134066_102347231 | 3300010364 | Grasslands Soil | RLDFEFDVTNVSDSIYPIAKESEEIPIQYAPSRTIGGSLKFHF* |
| Ga0105239_105788003 | 3300010375 | Corn Rhizosphere | SRRLDLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF* |
| Ga0134126_115919311 | 3300010396 | Terrestrial Soil | RLDFEFDITNVSNSVYQIAKESEEIPIQYAPSRTVGGALKFHF* |
| Ga0137392_107769292 | 3300011269 | Vadose Zone Soil | TNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0137392_114822311 | 3300011269 | Vadose Zone Soil | EPRHLDFEFNITNVSNSIYQIAKESEEIPIQYAPSRTVGGSLRLHF* |
| Ga0137393_101713704 | 3300011271 | Vadose Zone Soil | VTNVSNSIYQIAKESEEIPIQYAPSRTAGGSLKFHF* |
| Ga0137389_114726612 | 3300012096 | Vadose Zone Soil | DLELDATNLTDNRYKVSKESEEIPVQFAPSRTLGGSLKFHF* |
| Ga0137388_103028352 | 3300012189 | Vadose Zone Soil | DFEFNVTNASNSVYKIAKESEEIPIQYAPMRTAGGSLKLHF* |
| Ga0137388_114143912 | 3300012189 | Vadose Zone Soil | EFNITNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0137382_103353781 | 3300012200 | Vadose Zone Soil | RLDFEFDVTNVSNSTYQIAKESEEIPIQYAPARTVGGSLKFHF* |
| Ga0137363_101072964 | 3300012202 | Vadose Zone Soil | DITNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0137363_103773402 | 3300012202 | Vadose Zone Soil | DLEFDITNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0137399_102879572 | 3300012203 | Vadose Zone Soil | FEFNVTNVSNSVYQIAKESEEIPIQYAPSRTVGGSLKLHF* |
| Ga0137377_116417542 | 3300012211 | Vadose Zone Soil | RRLDFEFDVTNVSDSIYPIAKESEEIPIQYAPSRTIGGSLKFHF* |
| Ga0137387_108662182 | 3300012349 | Vadose Zone Soil | TSVSNSIYQIAKESEEIPIQFAPSRTVGGSLKFHF* |
| Ga0137372_103721873 | 3300012350 | Vadose Zone Soil | DVTNISNSIYQIAKESEEIPIQYAASQTAGGSLKFHF* |
| Ga0137372_105424111 | 3300012350 | Vadose Zone Soil | NVSDNVYQIAKESEEIPIQFAPSRTVGGSLKFHF* |
| Ga0137386_103463873 | 3300012351 | Vadose Zone Soil | DVTNVSDNRYKIAKESEEIPIQYAPSRTLGGSLKFHF* |
| Ga0137386_106369012 | 3300012351 | Vadose Zone Soil | DVTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF* |
| Ga0137360_103644392 | 3300012361 | Vadose Zone Soil | DLEFDVTNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF* |
| Ga0137361_119227062 | 3300012362 | Vadose Zone Soil | EFDVTNVSNSVYQIAKESDEIPIQYAPSRTVGGSLKFHF* |
| Ga0137390_100809386 | 3300012363 | Vadose Zone Soil | EFDVTNVSNSIYQIAKESEEIPIQYAPSRTAGGSLKFHF* |
| Ga0137358_104269451 | 3300012582 | Vadose Zone Soil | LEFDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0137398_109321302 | 3300012683 | Vadose Zone Soil | PRYLDFEFNVTNVSDSIYQIAKESEEIPIQYAPSRTVGGSLKLHF* |
| Ga0137396_103220441 | 3300012918 | Vadose Zone Soil | NVSNSVYQIAKESEEIPIQYAPSRTAGGSLKLHF* |
| Ga0137396_112173331 | 3300012918 | Vadose Zone Soil | PRYFDLEFDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0137359_117824901 | 3300012923 | Vadose Zone Soil | VTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKLHF* |
| Ga0137416_113033451 | 3300012927 | Vadose Zone Soil | LEFDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGGLKFHF* |
| Ga0137404_103093853 | 3300012929 | Vadose Zone Soil | RRLDLEIDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF* |
| Ga0137404_109968362 | 3300012929 | Vadose Zone Soil | CEFNVTNVSDNVYKIAKESEEIPIQYAPSPTVGGSFRFHF* |
| Ga0137407_106378652 | 3300012930 | Vadose Zone Soil | VTNVSDSIYQIAKESEEIPIQYAPSRTIGASLKFHF* |
| Ga0137410_115893151 | 3300012944 | Vadose Zone Soil | RYLDLEFDVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0126375_116253321 | 3300012948 | Tropical Forest Soil | NATNLTDNRYQIAKESEEIPIQFAPSRTLGGSLKFHF* |
| Ga0164301_115790382 | 3300012960 | Soil | HLDLEFDVTNVSNNIYQIAKESEEIPIQYSPSRTVGGSLKFHF* |
| Ga0164302_100359345 | 3300012961 | Soil | FDVTNVSKSVYQIAKESEEIPIQYAPSRTIGGSLKFRF* |
| Ga0164304_118858592 | 3300012986 | Soil | RLDLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF* |
| Ga0157374_112056051 | 3300013296 | Miscanthus Rhizosphere | RRLDVELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF* |
| Ga0134079_100967633 | 3300014166 | Grasslands Soil | RLDLELDITNISNSIYQIAKESEEIPIQYAPSRTVGGSLRLHF* |
| Ga0137418_110540462 | 3300015241 | Vadose Zone Soil | LDFEFDVTNVSNSTYQIAKESEEIPIQYAPARTVGGSLKFHF* |
| Ga0137409_107078463 | 3300015245 | Vadose Zone Soil | FDITNVGNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF* |
| Ga0132255_1013395432 | 3300015374 | Arabidopsis Rhizosphere | LEFDVTNVSNSIYQIAKESEEIPIQYAPARTVGGSLKFHF* |
| Ga0066662_102869212 | 3300018468 | Grasslands Soil | EPPRLDLEFDVTNVSNSIYKIAKESEEIPIQYAPARTVGGSLKFHF |
| Ga0193721_10454371 | 3300020018 | Soil | EFDVTNVSNSIYRIAKESEEIPIQYAPSRTVGGSLKFHF |
| Ga0210382_101773452 | 3300021080 | Groundwater Sediment | DLEFDITNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKLHF |
| Ga0207656_101512582 | 3300025321 | Corn Rhizosphere | VTNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF |
| Ga0207692_108783431 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DATNLTDSRYKISKESEEIPIQFAPSRTLGGSLKFHF |
| Ga0207699_106608082 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SRRLDLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF |
| Ga0207671_103380211 | 3300025914 | Corn Rhizosphere | FDVTNLSDSRYQIAKESEEIPIQYAPSRTIGGSLKFHF |
| Ga0207687_119279942 | 3300025927 | Miscanthus Rhizosphere | DLELDATNLTDNRYKISKESEEIPIQFAPSRTLGGSLKFHF |
| Ga0207700_106351861 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LDLELDATNLTDNRYKVSKESEEIPVQFAPSRTLGGSLKFHF |
| Ga0207667_101174841 | 3300025949 | Corn Rhizosphere | ATNLTNNRYKISKESEEIPIQFAPSRTLGGSLKFHF |
| Ga0207702_123831412 | 3300026078 | Corn Rhizosphere | FDVTNVSDSRYQIAKESEEIPIQFAPSRTVGGSMKFHF |
| Ga0209234_10342391 | 3300026295 | Grasslands Soil | TNVFDSIYQIAKESEEIPIQYAPSRTIGGSLKFHF |
| Ga0209236_11756281 | 3300026298 | Grasslands Soil | DFEFDVTNVSNNIYKIAKESEEIPIQYAPSRTAGGSLKFHF |
| Ga0209239_10123621 | 3300026310 | Grasslands Soil | DLEFDVTNVSNSTYQIAKESEEIPLQYAPSRTVGGSLKFHF |
| Ga0209268_10030941 | 3300026314 | Soil | DFELDITNISNSIYQIAKESEEIPIQYAPSRTVGGSLRLHF |
| Ga0209152_100233323 | 3300026325 | Soil | TNVSNSIYQIAKESEEIPLQYAPSRTVGGSLKFHF |
| Ga0209802_10813311 | 3300026328 | Soil | TNVGNSIYQIAKESEDIPIQYAPSRTVGGSLKFHF |
| Ga0209375_10780341 | 3300026329 | Soil | HLDLEFNVTNVSNSIYQIAKESEEIPIQFAPSRTVGGSLKFHF |
| Ga0209375_12415921 | 3300026329 | Soil | LDLELDITNISNSIYQIAKESEEIPIQYAPSRTVGGSLRLHF |
| Ga0209267_10863921 | 3300026331 | Soil | FDVTNVSDSRYKIAKESEEIPIQFAPSRTVGGSLKFHF |
| Ga0209804_12214402 | 3300026335 | Soil | PRSFDLEFDITNVSNSIYKTAKESEEIPIQYAPSRTAGGSLKFHF |
| Ga0209057_10463351 | 3300026342 | Soil | ITNVSNSIYKIAKESEEIPLQYAPSRTVGGSLKLHF |
| Ga0257170_10471892 | 3300026351 | Soil | KRLDLEFDVTNLSNSIYQIAKESEEIPIQYAPPRTVGGSLKLRF |
| Ga0209056_106471641 | 3300026538 | Soil | DVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF |
| Ga0209156_101703851 | 3300026547 | Soil | FDITNVSNSIYKIAKESEEIPIQYAPSRTAGGSLKFHF |
| Ga0209733_11464531 | 3300027591 | Forest Soil | MQVDVTNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF |
| Ga0208988_10223403 | 3300027633 | Forest Soil | LEFDITNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF |
| Ga0208990_10833342 | 3300027663 | Forest Soil | LDLEFDVTNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKFHF |
| Ga0209588_10187374 | 3300027671 | Vadose Zone Soil | ITNVSNSIYKIAKESEEIPIQYAPSRTVGGSLKFHF |
| Ga0257175_11293271 | 3300028673 | Soil | EPRRLDFEFDVTNVFDSIYQIAKESEEIPIQYAPSRTIGGSLKFHF |
| Ga0307504_100088201 | 3300028792 | Soil | FEFNITNVSNSIYQIAKESEEIPIQYAPSRTVGGSLKLHF |
| Ga0307308_100159197 | 3300028884 | Soil | PRYFDLEFDLTNVSNSIYKIAKESEEIPIQYAPSRTVGGGLKFHF |
| Ga0307469_102647161 | 3300031720 | Hardwood Forest Soil | DVTNVSDSIYQIAKESEEIPIQFAPSRTIGGSLKFHF |
| Ga0318546_109405581 | 3300031771 | Soil | VEFNATNVGNSVYKIAKESDEIPIQYAPWRTIGASLRFNF |
| Ga0310916_115038001 | 3300031942 | Soil | TNISDNRYKIAKESEEIPIQYAPSRTIGGSLKFHF |
| Ga0307479_101390745 | 3300031962 | Hardwood Forest Soil | EFDVTNVSNSIYKIAKESEEIPIQYAPSRTIGGSLKFHF |
| Ga0318524_106025242 | 3300032067 | Soil | RRVGVEFNATNVGNSVYKIAKESDEIPIQYAPWRTIGASLRFNF |
| ⦗Top⦘ |