


| Basic Information | |
|---|---|
| Family ID | F070448 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ISEIQTYLELAPHAKDADQVREQLAKLEKLNGSASTSEKPDQR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.06 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.301 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.642 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13525 | YfiO | 6.50 |
| PF13432 | TPR_16 | 2.44 |
| PF03328 | HpcH_HpaI | 2.44 |
| PF02517 | Rce1-like | 2.44 |
| PF14542 | Acetyltransf_CG | 1.63 |
| PF12705 | PDDEXK_1 | 1.63 |
| PF01565 | FAD_binding_4 | 1.63 |
| PF01850 | PIN | 1.63 |
| PF01497 | Peripla_BP_2 | 1.63 |
| PF13371 | TPR_9 | 1.63 |
| PF03938 | OmpH | 1.63 |
| PF02585 | PIG-L | 0.81 |
| PF08238 | Sel1 | 0.81 |
| PF14321 | DUF4382 | 0.81 |
| PF02635 | DrsE | 0.81 |
| PF01979 | Amidohydro_1 | 0.81 |
| PF12680 | SnoaL_2 | 0.81 |
| PF01041 | DegT_DnrJ_EryC1 | 0.81 |
| PF00892 | EamA | 0.81 |
| PF17189 | Glyco_hydro_30C | 0.81 |
| PF13646 | HEAT_2 | 0.81 |
| PF00174 | Oxidored_molyb | 0.81 |
| PF10978 | DUF2785 | 0.81 |
| PF13174 | TPR_6 | 0.81 |
| PF02142 | MGS | 0.81 |
| PF03069 | FmdA_AmdA | 0.81 |
| PF13361 | UvrD_C | 0.81 |
| PF00248 | Aldo_ket_red | 0.81 |
| PF13204 | DUF4038 | 0.81 |
| PF13175 | AAA_15 | 0.81 |
| PF03713 | DUF305 | 0.81 |
| PF14499 | DUF4437 | 0.81 |
| PF00691 | OmpA | 0.81 |
| PF13649 | Methyltransf_25 | 0.81 |
| PF01872 | RibD_C | 0.81 |
| PF02687 | FtsX | 0.81 |
| PF02894 | GFO_IDH_MocA_C | 0.81 |
| PF06803 | DUF1232 | 0.81 |
| PF07366 | SnoaL | 0.81 |
| PF13407 | Peripla_BP_4 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 2.44 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 2.44 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 2.44 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 2.44 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 2.44 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.63 |
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.63 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.63 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.63 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.63 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.81 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.81 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.81 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.81 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.81 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.81 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.81 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.81 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.81 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.81 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.81 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.81 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.81 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.30 % |
| Unclassified | root | N/A | 18.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_102548163 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005552|Ga0066701_10033673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2691 | Open in IMG/M |
| 3300005568|Ga0066703_10504006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300005569|Ga0066705_10195012 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300006032|Ga0066696_10934751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis | 552 | Open in IMG/M |
| 3300006173|Ga0070716_101802668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300006176|Ga0070765_100268251 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300006797|Ga0066659_11401823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300006893|Ga0073928_10974172 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300007788|Ga0099795_10004218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3683 | Open in IMG/M |
| 3300009143|Ga0099792_11011199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300009792|Ga0126374_10792785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300010303|Ga0134082_10389296 | Not Available | 595 | Open in IMG/M |
| 3300010339|Ga0074046_10926254 | Not Available | 505 | Open in IMG/M |
| 3300010361|Ga0126378_12179604 | Not Available | 632 | Open in IMG/M |
| 3300010376|Ga0126381_100357782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2020 | Open in IMG/M |
| 3300010376|Ga0126381_102236536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300010880|Ga0126350_12080034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300011269|Ga0137392_10532551 | Not Available | 976 | Open in IMG/M |
| 3300011271|Ga0137393_10010529 | All Organisms → cellular organisms → Bacteria | 6365 | Open in IMG/M |
| 3300012189|Ga0137388_11944995 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012198|Ga0137364_10807493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300012203|Ga0137399_10207378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1593 | Open in IMG/M |
| 3300012203|Ga0137399_10803275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300012205|Ga0137362_10897849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300012361|Ga0137360_10691297 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300012361|Ga0137360_11035080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300012362|Ga0137361_11614866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300012582|Ga0137358_10018286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4481 | Open in IMG/M |
| 3300012685|Ga0137397_11241245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012918|Ga0137396_10589403 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300012923|Ga0137359_10161723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1998 | Open in IMG/M |
| 3300012925|Ga0137419_10789302 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012927|Ga0137416_11846666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300012944|Ga0137410_10548682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300015054|Ga0137420_1169898 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300015241|Ga0137418_10301120 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300016294|Ga0182041_12263449 | Not Available | 508 | Open in IMG/M |
| 3300016445|Ga0182038_11864338 | Not Available | 543 | Open in IMG/M |
| 3300016702|Ga0181511_1047296 | Not Available | 514 | Open in IMG/M |
| 3300018006|Ga0187804_10273225 | Not Available | 732 | Open in IMG/M |
| 3300018040|Ga0187862_10325190 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300018468|Ga0066662_10973339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300019883|Ga0193725_1077324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 814 | Open in IMG/M |
| 3300020140|Ga0179590_1026038 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300020170|Ga0179594_10056940 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300020170|Ga0179594_10179188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300020170|Ga0179594_10299904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300020170|Ga0179594_10390083 | Not Available | 528 | Open in IMG/M |
| 3300020199|Ga0179592_10510045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300020579|Ga0210407_10221892 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1470 | Open in IMG/M |
| 3300020579|Ga0210407_11058980 | Not Available | 616 | Open in IMG/M |
| 3300020579|Ga0210407_11393379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300020580|Ga0210403_10251728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1449 | Open in IMG/M |
| 3300020580|Ga0210403_10603872 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300020580|Ga0210403_11037079 | Not Available | 640 | Open in IMG/M |
| 3300020580|Ga0210403_11406150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300020583|Ga0210401_10630419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300021088|Ga0210404_10370934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300021170|Ga0210400_10429060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300021178|Ga0210408_10891645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300021180|Ga0210396_10753233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300021405|Ga0210387_10122388 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300021405|Ga0210387_10913489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 772 | Open in IMG/M |
| 3300021433|Ga0210391_10370959 | Not Available | 1123 | Open in IMG/M |
| 3300021475|Ga0210392_11158322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300021479|Ga0210410_11089107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300022531|Ga0242660_1103314 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300025922|Ga0207646_10111356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2457 | Open in IMG/M |
| 3300026325|Ga0209152_10283852 | Not Available | 617 | Open in IMG/M |
| 3300026326|Ga0209801_1279627 | Not Available | 606 | Open in IMG/M |
| 3300026334|Ga0209377_1221270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300026361|Ga0257176_1035627 | Not Available | 760 | Open in IMG/M |
| 3300026551|Ga0209648_10316862 | Not Available | 1102 | Open in IMG/M |
| 3300026551|Ga0209648_10671668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300026823|Ga0207759_109756 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300026859|Ga0207859_1011319 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300027011|Ga0207740_1021922 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300027546|Ga0208984_1020906 | Not Available | 1326 | Open in IMG/M |
| 3300027587|Ga0209220_1048300 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300027643|Ga0209076_1083656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300027671|Ga0209588_1111565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300027674|Ga0209118_1001272 | All Organisms → cellular organisms → Bacteria | 11949 | Open in IMG/M |
| 3300027674|Ga0209118_1090100 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300027846|Ga0209180_10217027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300027875|Ga0209283_10678682 | Not Available | 646 | Open in IMG/M |
| 3300027903|Ga0209488_10789509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300028536|Ga0137415_10105390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2669 | Open in IMG/M |
| 3300028536|Ga0137415_11018551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300028906|Ga0308309_10215148 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300029636|Ga0222749_10320904 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300030759|Ga0265745_1015951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300030991|Ga0073994_12180115 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300031122|Ga0170822_10434304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 523 | Open in IMG/M |
| 3300031680|Ga0318574_10885726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 523 | Open in IMG/M |
| 3300031720|Ga0307469_10379864 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1198 | Open in IMG/M |
| 3300031753|Ga0307477_10707275 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium F42-01 | 673 | Open in IMG/M |
| 3300031754|Ga0307475_10147097 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300031754|Ga0307475_10738822 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031754|Ga0307475_10951683 | Not Available | 676 | Open in IMG/M |
| 3300031779|Ga0318566_10114781 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300031797|Ga0318550_10118165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
| 3300031799|Ga0318565_10234858 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300031820|Ga0307473_10208709 | Not Available | 1166 | Open in IMG/M |
| 3300031835|Ga0318517_10366751 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031845|Ga0318511_10514046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300031879|Ga0306919_10783876 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300031941|Ga0310912_10167229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1668 | Open in IMG/M |
| 3300031962|Ga0307479_10486338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1218 | Open in IMG/M |
| 3300031962|Ga0307479_10780192 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300031962|Ga0307479_11148947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300031962|Ga0307479_12056115 | Not Available | 519 | Open in IMG/M |
| 3300032001|Ga0306922_11923966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300032055|Ga0318575_10091542 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300032063|Ga0318504_10129940 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300032076|Ga0306924_11998790 | Not Available | 598 | Open in IMG/M |
| 3300032094|Ga0318540_10177568 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300032180|Ga0307471_100177267 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300032180|Ga0307471_100195225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2017 | Open in IMG/M |
| 3300032180|Ga0307471_100484837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1382 | Open in IMG/M |
| 3300032180|Ga0307471_100589565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300032205|Ga0307472_102435345 | Not Available | 531 | Open in IMG/M |
| 3300032261|Ga0306920_103385252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 12.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.44% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300026859 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062389_1025481631 | 3300004092 | Bog Forest Soil | LLAELFARKNDYAAAISEVQTYLQLAPHANDADHVREQLAKLEKLNGSVAADEKSDPK* |
| Ga0066701_100336735 | 3300005552 | Soil | LDLAPHAKDAGQVRERLAELERLNRSAPTGEKPVQN* |
| Ga0066703_105040062 | 3300005568 | Soil | LELAPHAKNADQVREWLAKLEKLNGPVSSSEKTDQK* |
| Ga0066705_101950121 | 3300005569 | Soil | MAILEMQTYLELAPHATDADQVREQLAKLQKLNGSVST |
| Ga0066696_109347511 | 3300006032 | Soil | RKNNYALAIAEMQTYLAVAPHAKDADQAREQLAKLEKLNGSVSTSEKPDQR* |
| Ga0070716_1018026681 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | IYLELVPHAKNADRVRERLAKLEKLNGPVSSGEKPDRN* |
| Ga0070765_1002682511 | 3300006176 | Soil | AVLELRTYLELAPQAKDADQVRERLAKLEKLSSAASAN* |
| Ga0066659_114018231 | 3300006797 | Soil | NNYATAISETKIYLELAPHAKNADQVRERLAQLEKLNDPVSNGERTDQN* |
| Ga0073928_109741722 | 3300006893 | Iron-Sulfur Acid Spring | MAELVNYLELVPNAKDADQVRERLAKLEKLNASALASEKPNLK* |
| Ga0099795_100042181 | 3300007788 | Vadose Zone Soil | IFAQKNNYASAISEAKTYLELAPHAKDADQVRERLAKLERLNGPVPGGEN* |
| Ga0099792_110111991 | 3300009143 | Vadose Zone Soil | LAEIFARKNNYALAIAETQTYLALAPHAKNADQAREQLAKLEKLNGSVSTGEKPDQR* |
| Ga0126374_107927851 | 3300009792 | Tropical Forest Soil | AGKKNYAVAISELQAYLELAPHAKDADQVREQLAKLEKLNHSAPSGEKPVQN* |
| Ga0134082_103892961 | 3300010303 | Grasslands Soil | NYAMAILEMQTYLELAPHAQDADQVREQLAKLQKLNGSVSTSQKSDKN* |
| Ga0074046_109262541 | 3300010339 | Bog Forest Soil | YAAAISEIQTYLDLAPHAKNADEVREQLAKLEKLNGSVSTGEKPDHN* |
| Ga0126378_121796042 | 3300010361 | Tropical Forest Soil | AISGNKICLELPLPAKDADQVRERLAKLEKLNGPVSSSEKTDQK* |
| Ga0126381_1003577821 | 3300010376 | Tropical Forest Soil | NAISEVQAYLQLAPHAKNADHVREQLAKLEKLNRSAPTSEKTEQK* |
| Ga0126381_1022365361 | 3300010376 | Tropical Forest Soil | ARKNNYGNAITELQAYLQLVPQAKNASQVRERLAKLEKLNGATPTSEKPDQK* |
| Ga0126350_120800342 | 3300010880 | Boreal Forest Soil | KNNYARAIEEIQTYLALAPHAKDADQEREQLAKLEKLNSPASTSGKPE* |
| Ga0137392_105325513 | 3300011269 | Vadose Zone Soil | NDYALAIAEIQTYLALTPHAQDADQVREQLAKLEKLNGAVPTGEKPDPR* |
| Ga0137393_100105291 | 3300011271 | Vadose Zone Soil | MQTYLALAPNAKDADHVRAQLAKLEVLNASPSTTEKPNQR* |
| Ga0137388_119449952 | 3300012189 | Vadose Zone Soil | IQTYLALAPHAKDAGQAREQLAKLEKLSGSVSTSEKPDQR* |
| Ga0137364_108074931 | 3300012198 | Vadose Zone Soil | KIYLDLAPHAKDADQVLERLAKLEKLNGSVSSGEKTDQN* |
| Ga0137399_102073781 | 3300012203 | Vadose Zone Soil | QMQTYLALAPHAKDADHVREQLAKLEKLNASPSTTEKPNQK* |
| Ga0137399_108032752 | 3300012203 | Vadose Zone Soil | AEIFARKNNYALAIEEIQIYLALAPHAKNAEQVREQLARLEKLSGSVSTSEKPDQR* |
| Ga0137362_108978492 | 3300012205 | Vadose Zone Soil | ISETKIYLELMPHAKNADQVRQQLAELEKLNGPAS* |
| Ga0137360_106912972 | 3300012361 | Vadose Zone Soil | AIAEIQTYLALAPHAKDAGQAREQLAKLEKLNGSASTSEKPDQR* |
| Ga0137360_110350802 | 3300012361 | Vadose Zone Soil | QTYLELAPHAKDADQVREQLAKLEKLSGSVATSEKPEKE* |
| Ga0137361_116148661 | 3300012362 | Vadose Zone Soil | YLELAPHAKNADYAREQLAILENLNRPASASEKPDQQ* |
| Ga0137358_100182865 | 3300012582 | Vadose Zone Soil | ETKIYLELAPHAKNADQVREQLAQLEKLNGPLPNAEKTDQK* |
| Ga0137397_112412452 | 3300012685 | Vadose Zone Soil | KYALAISEIKIYLELAPHAKNGDQVREQLAKLEKLNGSN* |
| Ga0137396_105894031 | 3300012918 | Vadose Zone Soil | TYLELAPHAKDADQVREQLAKLEKLNGSASTSEKPDQR* |
| Ga0137359_101617234 | 3300012923 | Vadose Zone Soil | KIYLELAPHAKDADQVRDRLAELQKLNCAGPSSEKTDHK* |
| Ga0137419_107893021 | 3300012925 | Vadose Zone Soil | AISETKIYLELAPHAKDADQVRERLAKLEKLNVPVSSSEKTDQK* |
| Ga0137416_118466661 | 3300012927 | Vadose Zone Soil | TAISEIQTYLELAPHAKDADQMREQLARLEALNGSMSTSERLDKK* |
| Ga0137410_105486821 | 3300012944 | Vadose Zone Soil | HLLLAEIFARKNKYPPAISEIKTYLELAPQAKNGDQVREQLAKLEKLNGSN* |
| Ga0137420_11698982 | 3300015054 | Vadose Zone Soil | QTYLELAPHAKNADQLREQLAKLEKLNSAVSTSEKPDKE* |
| Ga0137418_103011201 | 3300015241 | Vadose Zone Soil | SAAISETKIYLELAPHAKDADQVRERLAKLEKLNVPVSSSEKTDQK* |
| Ga0182041_122634492 | 3300016294 | Soil | LLAEIYARKNNYGNAITEIQAYLQLVPHAKNASQVREQLARLAKLNGSTPASEKPDQK |
| Ga0182038_118643381 | 3300016445 | Soil | ITEIQAYLQLVPHAKNASQVREQLARLEKLNGSTPTSEKPDQK |
| Ga0181511_10472961 | 3300016702 | Peatland | KNDYASAISQIQTYLELAPHADDAVQVRLQLAKLEKLNSPVSPSQQPDPK |
| Ga0187804_102732251 | 3300018006 | Freshwater Sediment | TYLELAPHAKNADEVREQLAELEKLNGSVSTGEKLDHN |
| Ga0187862_103251901 | 3300018040 | Peatland | YSGAISELQTYLELAPHAPDADRVRQQLAQLQKLNGSVSANEKPDSK |
| Ga0066662_109733391 | 3300018468 | Grasslands Soil | NNYALAIAEMQTYLAVAPHAKDADQAREQLAKLEKLNGSVSTSEKPDQR |
| Ga0193725_10773241 | 3300019883 | Soil | AKTYLELAPHGKDADQVRERLAKLEKLNGPVPSGEKTDQN |
| Ga0179590_10260383 | 3300020140 | Vadose Zone Soil | YAIAIAQIQTYLELAPHAKDADHVREQLAKLEKLNASPSTTEKPNQK |
| Ga0179594_100569401 | 3300020170 | Vadose Zone Soil | ATAISEMQTYLKLAPNAKNVDQVRERLTKFEKLNAAASTSEKPDPE |
| Ga0179594_101791881 | 3300020170 | Vadose Zone Soil | NYAKAISETKIYLELAPHAKDADRVRERLAKLEKLNAPVSSSEKPDQK |
| Ga0179594_102999041 | 3300020170 | Vadose Zone Soil | AEIFTRKKFYATAISETKLYLELAPHAKNADQAREWLAKLEKLNGSVSSSEKTDQK |
| Ga0179594_103900832 | 3300020170 | Vadose Zone Soil | NYAIAIAQIQTYLELAPHAKDADHVREQLAKLEKLNASPSTTEKPNQK |
| Ga0179592_105100451 | 3300020199 | Vadose Zone Soil | IQIYLTLAPHAKNAEQVREQLARLEKLSGSVSTSEKPDQR |
| Ga0210407_102218921 | 3300020579 | Soil | LALVPHAKAAAQAREQLAKWEKLNGSASSTEKPDQR |
| Ga0210407_110589801 | 3300020579 | Soil | TYLALTPHAKDAAQVREQLAKLEKLNGSVSTIEKPDQR |
| Ga0210407_113933791 | 3300020579 | Soil | LAEIFARKNDFATAISEMQTYLELDPHAKNADQVREQLAKLEKLNGSVSISEKPDHN |
| Ga0210403_102517282 | 3300020580 | Soil | KNDYALAISEIQTYLALVPHAKAAAQAREQLAKWEKLNGSASSTEKPDQR |
| Ga0210403_106038721 | 3300020580 | Soil | LLAELFARKGNYAMAIAQVQTYLELVPHAEDADRVREQLAKLEKLNGSASTSEKPDPK |
| Ga0210403_110370791 | 3300020580 | Soil | EIFARKNNYALAITEIQTYLALTPHAKDADQVREQLAKLEKLNGSVSAIEKPDQR |
| Ga0210403_114061501 | 3300020580 | Soil | QTYLALVPDAKDADQQREQLAKLEKLNSPTPTVEKPDQR |
| Ga0210401_106304191 | 3300020583 | Soil | ALVPHAKDADQKREQLAKLEKLNAPVSTSEKPDQR |
| Ga0210404_103709342 | 3300021088 | Soil | AISEMQTYLRLAPNAKNADQVRERVAKLEKLNTAAPTSEKSDPK |
| Ga0210400_104290602 | 3300021170 | Soil | QVQTYLELVPHAEDADRVREQLAKLEKLNSSASTTEKPDPR |
| Ga0210408_108916451 | 3300021178 | Soil | AGAILEMQTYLELAPHAKDADQVREQLTKLEKLNGSVSASEKPDKK |
| Ga0210396_107532331 | 3300021180 | Soil | IFARKNNYSRAIEEIRAYLTLVPHAKDADQKREQLAKLEKLNAPVSTNEKPDQR |
| Ga0210387_101223881 | 3300021405 | Soil | VAIGQMQTYLALAPHAKDADRVREQLAKLEKLNGSVSNSEKTDQN |
| Ga0210387_109134893 | 3300021405 | Soil | YAAAVLELRTYLELAPQAKDADQVRERLAKLEKLSSAASAN |
| Ga0210391_103709591 | 3300021433 | Soil | LALAPHAKDADRAREQLAKLEKLNGPGSNSEKTDQK |
| Ga0210392_111583221 | 3300021475 | Soil | ICARKGNYAVAIGQMQTYLALAPHAKDADRVREQLAKLEKLNGSNGEKPDPN |
| Ga0210410_110891072 | 3300021479 | Soil | PTAISEMQTYLELDPHAKNADQVREQLAKFEKLNGSVSISEKPDHN |
| Ga0242660_11033141 | 3300022531 | Soil | NNYAAAILEMQTYLELVPNAKDADQARGQLTKLEKLNGSVSTSETDKK |
| Ga0207646_101113563 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | QTYLQLAPHAKNTDQVRAQLANLEKLNDSVSTSEKPDHM |
| Ga0209152_102838521 | 3300026325 | Soil | SARKNNYAMAILEMQTYLELAPHAQDADQVREQLAKLQKLNGSVSTSQKSDKN |
| Ga0209801_12796271 | 3300026326 | Soil | MAILEMQTYLELAPHAQDADQVREQLAKLQKLNGSVSTSQKSDKN |
| Ga0209377_12212701 | 3300026334 | Soil | RKNNYILAIEEIQTYLALAPHAKDADQAREQLAKLEKLNGSVSTSEKPDQM |
| Ga0257176_10356271 | 3300026361 | Soil | EIFARKHNYATAISEIQTYLELAPHAKDADQVREQLAKLEKLNGSASTSEKPDQR |
| Ga0209648_103168621 | 3300026551 | Grasslands Soil | IAEIQTYLALTPHAQDADQVREQLAKLEKLSGAVPTGEKPDPR |
| Ga0209648_106716682 | 3300026551 | Grasslands Soil | KNNYVMAITEAQSFLELAPQAKDADQVREQLAKWEKLNASVPASEKPDPM |
| Ga0207759_1097561 | 3300026823 | Tropical Forest Soil | NYGNAISEVEAYLQLAPHAKNADHVREQLAKLEKLNRSAPAREKN |
| Ga0207859_10113192 | 3300026859 | Tropical Forest Soil | EVEAYLQLAPHAKNADHVREQLAKLEKLNRSAPAREKN |
| Ga0207740_10219222 | 3300027011 | Tropical Forest Soil | IYTQKSNYGNAISEVEAYLQLAPHAKNADHVREQLAKLEKLNRSAPAREKN |
| Ga0208984_10209062 | 3300027546 | Forest Soil | RKNDYPIAIAEIQTYLELTPNSKDTDQVRERLAKLEKLNGAVSPTEKPAQK |
| Ga0209220_10483001 | 3300027587 | Forest Soil | KHNYATAISEIQTYLELAPHAKNADQLREQLAKLEKLNGSVSTSEKPDNE |
| Ga0209076_10836561 | 3300027643 | Vadose Zone Soil | NNYATAILETKIYLELAPHAKNADQVREWLAKLEKLNGPVSSSEKTDQK |
| Ga0209588_11115651 | 3300027671 | Vadose Zone Soil | TRIYLELAPHAKNADQVREWLAKLEKLNGPVSSSEKTDQK |
| Ga0209118_10012721 | 3300027674 | Forest Soil | TKIYLELAPHAKDADQVRERLAKLQKLNGPVASSEKPDQK |
| Ga0209118_10901002 | 3300027674 | Forest Soil | TYLALVPQAKDADQVREQLAKLEKLNGSVSTSEKPDQR |
| Ga0209180_102170272 | 3300027846 | Vadose Zone Soil | TQTYLALAPHAKNADQVREQLAKLEKLNGSVSTGEKPDQK |
| Ga0209283_106786823 | 3300027875 | Vadose Zone Soil | TYLALTPHAQDADQVREQLAKLEKLSGAVPTGEKPDPR |
| Ga0209488_107895091 | 3300027903 | Vadose Zone Soil | AILETKIYLELAPHAKNADQVREWLAKLEKLNGPVSSSEKTDQK |
| Ga0137415_101053903 | 3300028536 | Vadose Zone Soil | ISEIQTYLELAPHAKDADQVREQLAKLEKLNGSASTSEKPDQR |
| Ga0137415_110185512 | 3300028536 | Vadose Zone Soil | ILEIRTYLELAPHAKDADQMREQLARLEELNGSVSTSEKLDKK |
| Ga0308309_102151481 | 3300028906 | Soil | KENYAAAVLELRTYLELAPQAKDADQVRERLAKLEKLSSAASAN |
| Ga0222749_103209041 | 3300029636 | Soil | QTYLALAPHAKDAVRVREQLAELEKLNGPGSNSEKTDQK |
| Ga0265745_10159511 | 3300030759 | Soil | TYLALAPQAKDASQQREQLAKLEQLNNPVPTAEKPEQR |
| Ga0073994_121801151 | 3300030991 | Soil | ARKNDYVIAISEMQTYLELVPHAKDAEQVRERLAKLEKLNGSVSASEKSEQK |
| Ga0170822_104343042 | 3300031122 | Forest Soil | QKNNYATAISEAKIYLELVPHAKDADQVRERLAKLERLNGPVPGGEN |
| Ga0318574_108857261 | 3300031680 | Soil | SYGAAIAEMQAYLELAPHAKDAGQVREQLAKLEKLNRAASSGEKPD |
| Ga0307469_103798642 | 3300031720 | Hardwood Forest Soil | YALAISEIQTYLALVPHAKAAAQAREQLAKWEKLNGSASSTEKPDQR |
| Ga0307477_107072752 | 3300031753 | Hardwood Forest Soil | AIEEIQTYLALAPHAKGADQAREQLGKLEKLNGSVSNQ |
| Ga0307475_101470971 | 3300031754 | Hardwood Forest Soil | YSRSISETKIYLELMPHAKNADQVRQQLAELEKLNGPAS |
| Ga0307475_107388221 | 3300031754 | Hardwood Forest Soil | AISEIQTYLELVPHAKDADQIRERLAKLQQLNGSVSSSEKPQQQ |
| Ga0307475_109516831 | 3300031754 | Hardwood Forest Soil | LALVPHAKAAAQAREQLAKWEKLNGSASTAEKPDQR |
| Ga0318566_101147811 | 3300031779 | Soil | NYGNAITEIQAYLQLVPQAKNASQVRERLAKLEKLNGSNPASEKPDQK |
| Ga0318550_101181651 | 3300031797 | Soil | YLDLAPHAKDTDQVRERLAELERLNHSAPTNEKPVQN |
| Ga0318565_102348582 | 3300031799 | Soil | AYLQLVPQAKNASQVRERLAKLEKLNGSTPTSEKPDQK |
| Ga0307473_102087091 | 3300031820 | Hardwood Forest Soil | LKAYLDLAPHAKDAGQVRERLAELQRLNRSAPTGEKPVQN |
| Ga0318517_103667512 | 3300031835 | Soil | NNYGNAITEIQAYLQLVPQAKNASQVRERLAKLEKLNGSTPTSEKPDQK |
| Ga0318511_105140461 | 3300031845 | Soil | ISEVESYLQLAPHAKNADQVREQLAKLEKLNRPAPTSEKTEQK |
| Ga0306919_107838762 | 3300031879 | Soil | YARKRSYGAAIAEMQAYLELAPHAKDAGQVREQLAKLEKLNRAASSGEKPD |
| Ga0310912_101672293 | 3300031941 | Soil | NYATAISEIQTYLELAPHAKDANQIRQWLTELEKLNGSVSATEKSDPK |
| Ga0307479_104863381 | 3300031962 | Hardwood Forest Soil | TYLELAPHAKNADQVREQLAELEKLNGSVSTSEKPDKK |
| Ga0307479_107801922 | 3300031962 | Hardwood Forest Soil | LLAKIFAQKNNYALAIAETQTYLALVPHGKDNDQVREQLAKLEKLNGSVSTSDKPDQM |
| Ga0307479_111489471 | 3300031962 | Hardwood Forest Soil | NNYAMAVTETQIFLELAPHSKDADRVREQLAKWEKLSGSVSASEKPDQM |
| Ga0307479_120561151 | 3300031962 | Hardwood Forest Soil | TQIFLELAPHSKDADRVREQLAKWEKLSGSVSATEKPDPK |
| Ga0306922_119239661 | 3300032001 | Soil | AEIYARKNSYGNAITEIEAYLQLVPHAKNASQVREQLAKLEKLNGSTPASEKPDQK |
| Ga0318575_100915422 | 3300032055 | Soil | LQAYLQLVPQAKNASQVRERLAKLEKLNGSNPASEKPDQK |
| Ga0318504_101299402 | 3300032063 | Soil | SYGNAITEIEAYLQLVPHAKNASQVREQLAKLEKLNGSTPASEKPDQK |
| Ga0306924_119987901 | 3300032076 | Soil | ELQAYLELAPHAKDTDQVREQLAKLAKLEKLNHSAPSGEKPVPN |
| Ga0318540_101775682 | 3300032094 | Soil | SYLQLAPHAKNADQVREQLAKLEKLNRPAPTSEKTEQK |
| Ga0307471_1001772671 | 3300032180 | Hardwood Forest Soil | SNYVMAISEIQTYLELAPFAKDADQAREQLAKLEKLNGSVSNH |
| Ga0307471_1001952253 | 3300032180 | Hardwood Forest Soil | KNDYATAISELQTYLELAPHAKDADQVREQLAKWEKLNGSVSTSESPVKK |
| Ga0307471_1004848373 | 3300032180 | Hardwood Forest Soil | IYLELAPHAKDADQVRERLAQMEKLNGPAPTVEKADPN |
| Ga0307471_1005895651 | 3300032180 | Hardwood Forest Soil | DFTSAILETKIYLDTVPHAKDADQVREQLAKLEKLNDSTPSGEKTDQN |
| Ga0307472_1024353451 | 3300032205 | Hardwood Forest Soil | LMAEIFARKNDLAMAIGEIQTYLDLAPQAKAADQAREQLAKLQKLNASASSSEKPDPR |
| Ga0306920_1033852521 | 3300032261 | Soil | GNAISEVEAYLQLAPHAKNADHVREQLAKLEKLNRSAPASEKN |
| ⦗Top⦘ |