


| Basic Information | |
|---|---|
| Family ID | F070403 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 37 residues |
| Representative Sequence | PIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 96.75 % |
| % of genes from short scaffolds (< 2000 bps) | 93.50 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.138 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.211 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.789 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.95% β-sheet: 16.22% Coil/Unstructured: 37.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 69.92 |
| PF00072 | Response_reg | 4.07 |
| PF03401 | TctC | 2.44 |
| PF02627 | CMD | 1.63 |
| PF02371 | Transposase_20 | 1.63 |
| PF07690 | MFS_1 | 0.81 |
| PF07045 | DUF1330 | 0.81 |
| PF03988 | DUF347 | 0.81 |
| PF02913 | FAD-oxidase_C | 0.81 |
| PF12680 | SnoaL_2 | 0.81 |
| PF02743 | dCache_1 | 0.81 |
| PF00589 | Phage_integrase | 0.81 |
| PF13185 | GAF_2 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 69.92 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.44 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.63 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.63 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.63 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.81 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.81 |
| COG4705 | Uncharacterized membrane-anchored protein | Function unknown [S] | 0.81 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17172157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2653 | Open in IMG/M |
| 3300000955|JGI1027J12803_101207701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 511 | Open in IMG/M |
| 3300005332|Ga0066388_104787523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 688 | Open in IMG/M |
| 3300005332|Ga0066388_108031814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 527 | Open in IMG/M |
| 3300005598|Ga0066706_10379077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1124 | Open in IMG/M |
| 3300005713|Ga0066905_100310797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1242 | Open in IMG/M |
| 3300005713|Ga0066905_100312854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 1238 | Open in IMG/M |
| 3300005713|Ga0066905_101579428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 600 | Open in IMG/M |
| 3300005713|Ga0066905_102117654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300005764|Ga0066903_101049395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1496 | Open in IMG/M |
| 3300005764|Ga0066903_101649352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1218 | Open in IMG/M |
| 3300005764|Ga0066903_101975799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1119 | Open in IMG/M |
| 3300005764|Ga0066903_104768090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 721 | Open in IMG/M |
| 3300005764|Ga0066903_106037107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 634 | Open in IMG/M |
| 3300005764|Ga0066903_106302801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 619 | Open in IMG/M |
| 3300005764|Ga0066903_107274930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 572 | Open in IMG/M |
| 3300006032|Ga0066696_10428265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 865 | Open in IMG/M |
| 3300006175|Ga0070712_100359596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1193 | Open in IMG/M |
| 3300006575|Ga0074053_11932189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 587 | Open in IMG/M |
| 3300006794|Ga0066658_10187497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 1085 | Open in IMG/M |
| 3300006797|Ga0066659_11194242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 635 | Open in IMG/M |
| 3300006847|Ga0075431_100699876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 991 | Open in IMG/M |
| 3300006871|Ga0075434_101188423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 775 | Open in IMG/M |
| 3300007258|Ga0099793_10726766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300007265|Ga0099794_10388679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 728 | Open in IMG/M |
| 3300009100|Ga0075418_11972855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300009522|Ga0116218_1099452 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300009792|Ga0126374_10180562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1314 | Open in IMG/M |
| 3300010046|Ga0126384_10926715 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300010046|Ga0126384_12223908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300010048|Ga0126373_11454514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300010358|Ga0126370_10133545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1781 | Open in IMG/M |
| 3300010358|Ga0126370_10342369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1205 | Open in IMG/M |
| 3300010360|Ga0126372_10881504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 895 | Open in IMG/M |
| 3300010362|Ga0126377_10212517 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300010366|Ga0126379_10031939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4126 | Open in IMG/M |
| 3300010366|Ga0126379_11106977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300010376|Ga0126381_101369543 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300010398|Ga0126383_11295766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300010398|Ga0126383_11660643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300012199|Ga0137383_10603741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300012202|Ga0137363_10570215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans | 954 | Open in IMG/M |
| 3300012202|Ga0137363_11040834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300012205|Ga0137362_10342559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1294 | Open in IMG/M |
| 3300012205|Ga0137362_10487858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1066 | Open in IMG/M |
| 3300012210|Ga0137378_11149945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300012211|Ga0137377_11852570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes | 522 | Open in IMG/M |
| 3300012355|Ga0137369_10231047 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300012357|Ga0137384_10349077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1226 | Open in IMG/M |
| 3300012361|Ga0137360_10216287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1559 | Open in IMG/M |
| 3300012362|Ga0137361_11965250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300012948|Ga0126375_10685109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
| 3300012948|Ga0126375_10850982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300012957|Ga0164303_10424861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 828 | Open in IMG/M |
| 3300012971|Ga0126369_12940723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300012988|Ga0164306_11501120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 577 | Open in IMG/M |
| 3300015356|Ga0134073_10344782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300015372|Ga0132256_100683210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1142 | Open in IMG/M |
| 3300015373|Ga0132257_104349366 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300016270|Ga0182036_11332104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300016270|Ga0182036_11677986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300016294|Ga0182041_10313461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1305 | Open in IMG/M |
| 3300016319|Ga0182033_10774239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300016341|Ga0182035_10167728 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300016357|Ga0182032_10837599 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300016357|Ga0182032_11079873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300016371|Ga0182034_11167384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300016371|Ga0182034_11869061 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300016387|Ga0182040_11178004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
| 3300016387|Ga0182040_11677056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300016404|Ga0182037_10434383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1089 | Open in IMG/M |
| 3300018482|Ga0066669_10232903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1441 | Open in IMG/M |
| 3300021168|Ga0210406_10949785 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300021444|Ga0213878_10116789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1092 | Open in IMG/M |
| 3300021479|Ga0210410_11659718 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025905|Ga0207685_10686099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300025915|Ga0207693_10185750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1636 | Open in IMG/M |
| 3300025928|Ga0207700_11135531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 698 | Open in IMG/M |
| 3300026304|Ga0209240_1146140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300026514|Ga0257168_1144486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 530 | Open in IMG/M |
| 3300026550|Ga0209474_10630074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300026551|Ga0209648_10064718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3092 | Open in IMG/M |
| 3300027616|Ga0209106_1120846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300027874|Ga0209465_10547704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300027905|Ga0209415_10071688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4106 | Open in IMG/M |
| 3300028716|Ga0307311_10057988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1037 | Open in IMG/M |
| 3300028778|Ga0307288_10459738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300031421|Ga0308194_10285750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300031543|Ga0318516_10871825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300031545|Ga0318541_10256720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 971 | Open in IMG/M |
| 3300031546|Ga0318538_10650158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300031546|Ga0318538_10664736 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031549|Ga0318571_10208506 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031719|Ga0306917_10184164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1572 | Open in IMG/M |
| 3300031719|Ga0306917_10184624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1570 | Open in IMG/M |
| 3300031777|Ga0318543_10328590 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300031797|Ga0318550_10598545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300031798|Ga0318523_10176904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1064 | Open in IMG/M |
| 3300031833|Ga0310917_10039717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2835 | Open in IMG/M |
| 3300031833|Ga0310917_10120270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1709 | Open in IMG/M |
| 3300031833|Ga0310917_10445813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
| 3300031860|Ga0318495_10099058 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300031890|Ga0306925_10106228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2991 | Open in IMG/M |
| 3300031890|Ga0306925_10167254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2368 | Open in IMG/M |
| 3300031890|Ga0306925_11104082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 801 | Open in IMG/M |
| 3300031894|Ga0318522_10199937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300031896|Ga0318551_10299842 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300031912|Ga0306921_10022210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6977 | Open in IMG/M |
| 3300031912|Ga0306921_10395922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1612 | Open in IMG/M |
| 3300031941|Ga0310912_11031196 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031942|Ga0310916_10329926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1294 | Open in IMG/M |
| 3300031946|Ga0310910_10212991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1501 | Open in IMG/M |
| 3300031946|Ga0310910_10540810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 924 | Open in IMG/M |
| 3300031947|Ga0310909_10451398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1079 | Open in IMG/M |
| 3300032039|Ga0318559_10599979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300032063|Ga0318504_10355818 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300032064|Ga0318510_10371420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300032067|Ga0318524_10795206 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300032076|Ga0306924_10366684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1650 | Open in IMG/M |
| 3300032076|Ga0306924_10421682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1526 | Open in IMG/M |
| 3300032076|Ga0306924_10555104 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300032076|Ga0306924_10862818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300032261|Ga0306920_100771082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1413 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.44% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03934400 | 2088090014 | Soil | IEQSPRFYMAVNLKTAASLGVFLSDAFIARANGVRE |
| JGI1027J12803_1012077011 | 3300000955 | Soil | EQSPRFYMAVNLKTAASLGVSLSDVFVARANEVIE* |
| Ga0066388_1047875232 | 3300005332 | Tropical Forest Soil | MLNSYLEPTPIEQSPRFYMAVNLKTAASLGVSLSDVFIARAN |
| Ga0066388_1080318141 | 3300005332 | Tropical Forest Soil | DMPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE* |
| Ga0066706_103790771 | 3300005598 | Soil | IEQSPRFYMAVNLKTAASLGVSLTDVFIARANEVIE* |
| Ga0066905_1003107972 | 3300005713 | Tropical Forest Soil | IEQSPRFYMAVNLKAAAALGVSLSDVFVARANEVIE* |
| Ga0066905_1003128542 | 3300005713 | Tropical Forest Soil | SDMPIEQSPRFYMAVNLKTAASLGISLSDVFIARANEVRE* |
| Ga0066905_1015794281 | 3300005713 | Tropical Forest Soil | SDMPIEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE* |
| Ga0066905_1021176542 | 3300005713 | Tropical Forest Soil | MPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE* |
| Ga0066903_1010493951 | 3300005764 | Tropical Forest Soil | QSPRFYMAVNLKAAASLGVSFSDVFVARANEVRE* |
| Ga0066903_1016493524 | 3300005764 | Tropical Forest Soil | IEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE* |
| Ga0066903_1019757992 | 3300005764 | Tropical Forest Soil | DIPIEQSAVNLKTAALLGVSLSDVFIARANEVRE* |
| Ga0066903_1047680901 | 3300005764 | Tropical Forest Soil | MPIEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE* |
| Ga0066903_1060371072 | 3300005764 | Tropical Forest Soil | PIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVIE* |
| Ga0066903_1063028012 | 3300005764 | Tropical Forest Soil | PIEQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE* |
| Ga0066903_1072749302 | 3300005764 | Tropical Forest Soil | DMPIEQSPRFYMGVNLKTAASLGVSLSDVFIARANEVRE* |
| Ga0066696_104282651 | 3300006032 | Soil | EQSPRFYMGVNLKTAALLGVSLSDVFIARANEVRE* |
| Ga0070712_1003595963 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IEQSPRFYMGVNLKTAASLGVSLSDVFIARANEVRE* |
| Ga0074053_119321892 | 3300006575 | Soil | QSLRFHMAVNLKTAASLGISLSDSFVARANEVRE* |
| Ga0066658_101874971 | 3300006794 | Soil | PIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE* |
| Ga0066659_111942421 | 3300006797 | Soil | DMPIEQSPRFYMAVNLKTAALLGVSLSDVFVARANEVRE* |
| Ga0075431_1006998762 | 3300006847 | Populus Rhizosphere | SDMPIEQSPRFYMAVNLKTAASLGVALSDVFVARANEVRE* |
| Ga0075434_1011884231 | 3300006871 | Populus Rhizosphere | EQSPRFYMGVNLKTAASLGVSLSDVFIARANEVRE* |
| Ga0099793_107267661 | 3300007258 | Vadose Zone Soil | QSPRFYMAVNLKAAASLGVSLSDVFIARANEVRE* |
| Ga0099794_103886791 | 3300007265 | Vadose Zone Soil | QSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE* |
| Ga0075418_119728551 | 3300009100 | Populus Rhizosphere | MPIEQSPRFYMAVNLKTAASLGVALPDVFVARANEVRE* |
| Ga0116218_10994523 | 3300009522 | Peatlands Soil | MRPPHFDMAINLKTAASLGIVLPPSFTARTDEVIE* |
| Ga0126374_101805621 | 3300009792 | Tropical Forest Soil | QSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE* |
| Ga0126384_109267151 | 3300010046 | Tropical Forest Soil | PIEQSPRFYMAVNLKAAASLGVSFSDVFVARANEVRE* |
| Ga0126384_122239081 | 3300010046 | Tropical Forest Soil | IEQSPRFYMAVNLKTAALLGVSLSDAFIARANEVRE* |
| Ga0126373_114545141 | 3300010048 | Tropical Forest Soil | EQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE* |
| Ga0126370_101335453 | 3300010358 | Tropical Forest Soil | SDMPIEQSPRFYMAVNLKTAAALGISLSDVFVARANEVRE* |
| Ga0126370_103423693 | 3300010358 | Tropical Forest Soil | IEQSPRFYMAVNLKTAALLGVSLSDVFIARADEVIE* |
| Ga0126372_108815043 | 3300010360 | Tropical Forest Soil | SDMPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE* |
| Ga0126377_102125171 | 3300010362 | Tropical Forest Soil | QSPRFYMAVNLKAAAALGVSLSDVFVARANEVIE* |
| Ga0126379_100319391 | 3300010366 | Tropical Forest Soil | MPIEQSPRFYMAVNLKTAASLGVSLSDAFIARANEVIE* |
| Ga0126379_111069772 | 3300010366 | Tropical Forest Soil | QSPRFYMAVNLKTAAALGVSLSDVFIARANEVRE* |
| Ga0126381_1013695431 | 3300010376 | Tropical Forest Soil | SDMPIEQSPRFYMAVNLKTAASLGISLSDVFVARANEVRE* |
| Ga0126383_112957661 | 3300010398 | Tropical Forest Soil | IEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE* |
| Ga0126383_116606431 | 3300010398 | Tropical Forest Soil | KQSVRVHLAVNLKTAASLGVSLSDAFVARADEVIE* |
| Ga0137383_106037411 | 3300012199 | Vadose Zone Soil | DMPIEQSPRFYMAVNLKTAASLGISLSDVLVARANEVRE* |
| Ga0137363_105702151 | 3300012202 | Vadose Zone Soil | IEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE* |
| Ga0137363_110408342 | 3300012202 | Vadose Zone Soil | PPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVIE* |
| Ga0137362_103425592 | 3300012205 | Vadose Zone Soil | PIEQSPRFYMAVNLKTAASLGVSLSGVFIARANEVRE* |
| Ga0137362_104878582 | 3300012205 | Vadose Zone Soil | EQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE* |
| Ga0137378_111499451 | 3300012210 | Vadose Zone Soil | QSPRFYMAVNLKAAASLGVSLSDVFVARANEVRE* |
| Ga0137377_118525701 | 3300012211 | Vadose Zone Soil | DMPIEQSPRFYMAVNLKTAALLGIPLSDVFIARANEVRE* |
| Ga0137369_102310471 | 3300012355 | Vadose Zone Soil | IEQSPRFYMAVNLKTAGLLGVSLSDVFVARANEVRE* |
| Ga0137384_103490771 | 3300012357 | Vadose Zone Soil | SDMPIEQSPRCYMAVNLKTASLLGVSLSAVFIARANEVCE* |
| Ga0137360_102162871 | 3300012361 | Vadose Zone Soil | MPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE* |
| Ga0137361_119652501 | 3300012362 | Vadose Zone Soil | MPIEQSPRFYMAVNLKTAASIGASLSDVFIARANEVIE* |
| Ga0126375_106851091 | 3300012948 | Tropical Forest Soil | KPSDTPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE* |
| Ga0126375_108509821 | 3300012948 | Tropical Forest Soil | EQSPRFYMAVNLKTAASIGVALPDVFVARANEVRE* |
| Ga0164303_104248611 | 3300012957 | Soil | EQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE* |
| Ga0126369_129407231 | 3300012971 | Tropical Forest Soil | QSVRVHLAVNLKTAASLGVSLSDAFVARADEVIE* |
| Ga0164306_115011201 | 3300012988 | Soil | MPIEQSLRFHMAVNLKTAASLGVSLSDSFVARANEVRE* |
| Ga0134073_103447821 | 3300015356 | Grasslands Soil | QSPRFYMAVNLKTAASLGVSLTDVFIARANEVIE* |
| Ga0132256_1006832102 | 3300015372 | Arabidopsis Rhizosphere | MPIEQSPRFYMAVNLKTAASLGISLSDAFIARANEVIE* |
| Ga0132257_1043493661 | 3300015373 | Arabidopsis Rhizosphere | QSSRFHMAVNLKTAASLGISLSDAFVARADEVRE* |
| Ga0182036_113321041 | 3300016270 | Soil | MPIEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVIE |
| Ga0182036_116779861 | 3300016270 | Soil | EQSPRFYMAVNLKTAASIGVALPDVFVARANEVRE |
| Ga0182041_103134613 | 3300016294 | Soil | SEMPIEQSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE |
| Ga0182033_107742392 | 3300016319 | Soil | EQSPRFYMAVNLKTAAALGVSLSDVFVARANEVRE |
| Ga0182035_101677283 | 3300016341 | Soil | AKPSDMPIEQSPRFYMAVNLKAAASLGVSFSDVFVARANEVRE |
| Ga0182032_108375992 | 3300016357 | Soil | SDMPIEQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE |
| Ga0182032_110798731 | 3300016357 | Soil | KPSDMPIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE |
| Ga0182034_111673841 | 3300016371 | Soil | MPIEQSPRFYMAINLKAAASLGVSLSDVFIARANEVRE |
| Ga0182034_118690612 | 3300016371 | Soil | DLRIAQSSRFHMAVNLKTAAALGITLSDRFVARADEVRE |
| Ga0182040_111780042 | 3300016387 | Soil | PIEQSPRFYMAVNLKAAASLGISLSDVFVAPANEVRE |
| Ga0182040_116770561 | 3300016387 | Soil | DMPIEQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE |
| Ga0182037_104343834 | 3300016404 | Soil | DMPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANGVRE |
| Ga0066669_102329031 | 3300018482 | Grasslands Soil | DMPIEQSPRFYMAVNLKTAASLGVSLTDVFIARANEVIE |
| Ga0210406_109497852 | 3300021168 | Soil | DMPIEQSPRFYMAVNLKTAASLGISLSDAFTARANEVRE |
| Ga0213878_101167892 | 3300021444 | Bulk Soil | EQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE |
| Ga0210410_116597182 | 3300021479 | Soil | MPIEQSPRFYMAVNLKTAASLGISLSDAFIARANEVRE |
| Ga0207685_106860992 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SDMPIEQSPRFYMAVNLKGAASLGISLSDVFVARANEVRE |
| Ga0207693_101857503 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SDMPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE |
| Ga0207700_111355312 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EQSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE |
| Ga0209240_11461402 | 3300026304 | Grasslands Soil | EQSPRFYMAVNLKTATSLGVSLSDVFIARANEVIE |
| Ga0257168_11444861 | 3300026514 | Soil | EMPIEQSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE |
| Ga0209474_106300741 | 3300026550 | Soil | PIEQSPRFYMGVNLKTAALLGVSLSDVFIARANEVRE |
| Ga0209648_100647181 | 3300026551 | Grasslands Soil | IEQSPRFYMGVNLKMAASLGVSLSDVFIARANEVRE |
| Ga0209106_11208462 | 3300027616 | Forest Soil | KPSEMPIEQSLRFHMAVNLNTAASLGVSLSDSFVARANEVRE |
| Ga0209465_105477042 | 3300027874 | Tropical Forest Soil | IEQSPRFYMAVNLKTAASIGVSLSDVFVARANEVRE |
| Ga0209415_100716882 | 3300027905 | Peatlands Soil | MRPPHFDMAINLKTAASLGIVLPPSFTARTDEVIE |
| Ga0307311_100579882 | 3300028716 | Soil | EMPIEQSLRFHMAVNLKTAASLGVSLSDSFVARANEVRE |
| Ga0307288_104597381 | 3300028778 | Soil | PIEQSLRFHMAVNLKTAASLGVSLSDSFVARANEVRE |
| Ga0308194_102857502 | 3300031421 | Soil | IEQSLRFHMAVNLKTAASLGVSLSDSFVARANEVRE |
| Ga0318516_108718251 | 3300031543 | Soil | DMPIEQSPRFYMGVNLKTAASLGVSLTDVFIARANEVIE |
| Ga0318541_102567201 | 3300031545 | Soil | IEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE |
| Ga0318538_106501581 | 3300031546 | Soil | SHMPIEQSPRFYMAVNLKTAASLGVSLSDVFIARANEVRE |
| Ga0318538_106647362 | 3300031546 | Soil | MPIEQSPRFYMAVNLKTAASLGISLSDVFIARANEVRE |
| Ga0318571_102085062 | 3300031549 | Soil | EQSPRFYMAVNLKTAASLGVSLSDVFIARANEVIE |
| Ga0306917_101841643 | 3300031719 | Soil | EQSPRFYMAVNLKTAALLGVSLSDVFVARANEVRE |
| Ga0306917_101846241 | 3300031719 | Soil | PSEMPIEQSPRFHMAVNLKAAALLGVSLSDVFVARANEVIE |
| Ga0318543_103285901 | 3300031777 | Soil | MPIEQSPRFYMAVNLKTAALLGISLSDVFVARANEVRE |
| Ga0318550_105985452 | 3300031797 | Soil | PIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE |
| Ga0318523_101769041 | 3300031798 | Soil | MPIEQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE |
| Ga0310917_100397177 | 3300031833 | Soil | DMPIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE |
| Ga0310917_101202703 | 3300031833 | Soil | EQSPRFYMAVNLKTAASLGISLSDVFVARANEVRE |
| Ga0310917_104458132 | 3300031833 | Soil | PIEQSPRFYMAVNLKTAASLGISLSDVFVARANEVRE |
| Ga0318495_100990581 | 3300031860 | Soil | SDMPIEQSPRFYMAVNLKAAASLGVSFSDVFVARANEVRE |
| Ga0306925_101062281 | 3300031890 | Soil | IEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE |
| Ga0306925_101672541 | 3300031890 | Soil | IEQSPRFYMSVNLKTAASLGVSLSDVFVARANEVIE |
| Ga0306925_111040821 | 3300031890 | Soil | EQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE |
| Ga0318522_101999371 | 3300031894 | Soil | DMPIEQSPRFYMAVNLKTAASLGISLSDVFVARANEVRE |
| Ga0318551_102998422 | 3300031896 | Soil | SDMPIEQSPRFYMAINLKTAASLGVSLSDVFIARANEVRE |
| Ga0306921_100222101 | 3300031912 | Soil | PSDMPIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE |
| Ga0306921_103959221 | 3300031912 | Soil | MPIEQSPRFHMAVNLKAAALLGVSLSDVFVARANEVIE |
| Ga0310912_110311961 | 3300031941 | Soil | DMPIEQSPRFYMAVNLKTAAALGVSLSDVFVARANEVRE |
| Ga0310916_103299263 | 3300031942 | Soil | EQSPRFYMGVNLKTAASLGISLSDVFIARANEVRE |
| Ga0310910_102129911 | 3300031946 | Soil | MPIEQSPRFYMAVNLKTAASLGVALPDVFVARANEVRE |
| Ga0310910_105408104 | 3300031946 | Soil | IEQSPRFYMAINLKTAAFLGVSLSDVFIARANEVRE |
| Ga0310909_104513981 | 3300031947 | Soil | KPSDMPIEQSPRFYMGVNLKTAALLGVSLSDVFIARANEVRE |
| Ga0318559_105999791 | 3300032039 | Soil | IEQSPRFYMAVNLKTAASLGISLSDVLVARANEVRE |
| Ga0318504_103558182 | 3300032063 | Soil | EQSPRFYMAVNLKTTASLGVSLSDVFIARANEVIE |
| Ga0318510_103714201 | 3300032064 | Soil | SDMPIEQSPRFYMAVNLKAAASLGISLSDVFVARANEVRE |
| Ga0318524_107952062 | 3300032067 | Soil | EMPIEQSPRFFMAVNLKAAALLGVSLSDVLVARANEVIE |
| Ga0306924_103666843 | 3300032076 | Soil | EQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE |
| Ga0306924_104216822 | 3300032076 | Soil | PSEMPIEQSPRFYMAVNLKAAALLGVSLSDVFVARANEVIE |
| Ga0306924_105551041 | 3300032076 | Soil | EQSLRFHMAVNLKTAALLGVSLSDAFVARADEVIE |
| Ga0306924_108628182 | 3300032076 | Soil | SDMPIQQSPRFYMAVNLKTAALLGVSLSDVFIARANEVRE |
| Ga0306920_1007710824 | 3300032261 | Soil | PPDTPIEQSPRFYMAVNLKTAASLGVSLSDVFVARANEVRE |
| ⦗Top⦘ |