


| Basic Information | |
|---|---|
| Family ID | F070358 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FYLDHRARIEDIEINPLMVRPNGAVAVDVRVIWRTGVD |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 92.68 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.984 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.073 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.016 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.463 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.06% β-sheet: 34.85% Coil/Unstructured: 59.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF02771 | Acyl-CoA_dh_N | 72.36 |
| PF05378 | Hydant_A_N | 11.38 |
| PF00903 | Glyoxalase | 3.25 |
| PF02538 | Hydantoinase_B | 1.63 |
| PF07731 | Cu-oxidase_2 | 0.81 |
| PF13505 | OMP_b-brl | 0.81 |
| PF12697 | Abhydrolase_6 | 0.81 |
| PF01977 | UbiD | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF00873 | ACR_tran | 0.81 |
| PF13384 | HTH_23 | 0.81 |
| PF04480 | DUF559 | 0.81 |
| PF12681 | Glyoxalase_2 | 0.81 |
| PF00331 | Glyco_hydro_10 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 72.36 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 22.76 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 3.25 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.81 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.81 |
| COG3693 | Endo-1,4-beta-xylanase, GH35 family | Carbohydrate transport and metabolism [G] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.98 % |
| Unclassified | root | N/A | 26.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000580|AF_2010_repII_A01DRAFT_1004785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2192 | Open in IMG/M |
| 3300000858|JGI10213J12805_10154239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus pinatubonensis | 747 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1049307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus pinatubonensis | 658 | Open in IMG/M |
| 3300001593|JGI12635J15846_10637929 | Not Available | 617 | Open in IMG/M |
| 3300001661|JGI12053J15887_10361292 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300003995|Ga0055438_10288643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300004081|Ga0063454_100643204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
| 3300004156|Ga0062589_100876670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 823 | Open in IMG/M |
| 3300004633|Ga0066395_10532656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 681 | Open in IMG/M |
| 3300005332|Ga0066388_101761459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 1099 | Open in IMG/M |
| 3300005332|Ga0066388_104736726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300005764|Ga0066903_100608357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1896 | Open in IMG/M |
| 3300005764|Ga0066903_104776021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300005764|Ga0066903_104852421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 715 | Open in IMG/M |
| 3300005764|Ga0066903_106691700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300005843|Ga0068860_100023101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6013 | Open in IMG/M |
| 3300005921|Ga0070766_10536182 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300006038|Ga0075365_10838257 | Not Available | 649 | Open in IMG/M |
| 3300006050|Ga0075028_100928030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300006059|Ga0075017_100909528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300006176|Ga0070765_100229448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1696 | Open in IMG/M |
| 3300006178|Ga0075367_10471161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300006178|Ga0075367_10520771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300006800|Ga0066660_10589565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300006847|Ga0075431_100368156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1443 | Open in IMG/M |
| 3300006847|Ga0075431_100440781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1299 | Open in IMG/M |
| 3300006854|Ga0075425_102912270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300006904|Ga0075424_102832675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300006914|Ga0075436_100133462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1742 | Open in IMG/M |
| 3300007788|Ga0099795_10065605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1358 | Open in IMG/M |
| 3300009012|Ga0066710_102207156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300009089|Ga0099828_10377005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1279 | Open in IMG/M |
| 3300009094|Ga0111539_11805825 | Not Available | 709 | Open in IMG/M |
| 3300009143|Ga0099792_10545856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300009808|Ga0105071_1109984 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010042|Ga0126314_10386998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
| 3300010045|Ga0126311_11094019 | Not Available | 655 | Open in IMG/M |
| 3300010046|Ga0126384_11712410 | Not Available | 595 | Open in IMG/M |
| 3300010359|Ga0126376_10917902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300010359|Ga0126376_13011504 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010362|Ga0126377_11202082 | Not Available | 829 | Open in IMG/M |
| 3300010366|Ga0126379_11215344 | Not Available | 860 | Open in IMG/M |
| 3300010398|Ga0126383_11061238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300010398|Ga0126383_12895639 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012209|Ga0137379_11047984 | Not Available | 721 | Open in IMG/M |
| 3300012360|Ga0137375_10993241 | Not Available | 661 | Open in IMG/M |
| 3300012469|Ga0150984_112164125 | Not Available | 563 | Open in IMG/M |
| 3300012685|Ga0137397_10543467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| 3300012908|Ga0157286_10056960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1024 | Open in IMG/M |
| 3300012918|Ga0137396_10661955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300012927|Ga0137416_10912337 | Not Available | 782 | Open in IMG/M |
| 3300012929|Ga0137404_11679891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300012971|Ga0126369_11191705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 851 | Open in IMG/M |
| 3300012987|Ga0164307_11551559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300014254|Ga0075312_1085105 | Not Available | 642 | Open in IMG/M |
| 3300014326|Ga0157380_11927400 | Not Available | 652 | Open in IMG/M |
| 3300015372|Ga0132256_100136167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2444 | Open in IMG/M |
| 3300016270|Ga0182036_11867087 | Not Available | 509 | Open in IMG/M |
| 3300017658|Ga0182738_1296030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 641 | Open in IMG/M |
| 3300018086|Ga0187769_11466922 | Not Available | 516 | Open in IMG/M |
| 3300018088|Ga0187771_11649822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 544 | Open in IMG/M |
| 3300018422|Ga0190265_12441822 | Not Available | 622 | Open in IMG/M |
| 3300018422|Ga0190265_12622743 | Not Available | 601 | Open in IMG/M |
| 3300018469|Ga0190270_12292937 | Not Available | 601 | Open in IMG/M |
| 3300020018|Ga0193721_1079717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300021340|Ga0194041_10275225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 511 | Open in IMG/M |
| 3300021363|Ga0193699_10047620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 1650 | Open in IMG/M |
| 3300021474|Ga0210390_11548248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300021478|Ga0210402_10113448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2444 | Open in IMG/M |
| 3300021560|Ga0126371_13158226 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300022557|Ga0212123_10286057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1161 | Open in IMG/M |
| 3300025939|Ga0207665_11352758 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027326|Ga0209731_1034146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300027334|Ga0209529_1041043 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300027641|Ga0208827_1004029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5898 | Open in IMG/M |
| 3300027648|Ga0209420_1053556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300027875|Ga0209283_10082351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2086 | Open in IMG/M |
| 3300027875|Ga0209283_10258180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1154 | Open in IMG/M |
| 3300027880|Ga0209481_10710796 | Not Available | 522 | Open in IMG/M |
| 3300027884|Ga0209275_10047394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2051 | Open in IMG/M |
| 3300028047|Ga0209526_10366902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
| 3300028708|Ga0307295_10233646 | Not Available | 526 | Open in IMG/M |
| 3300028771|Ga0307320_10238532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300028819|Ga0307296_10780502 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300028906|Ga0308309_10826081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
| 3300028906|Ga0308309_11013697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300031421|Ga0308194_10354630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300031421|Ga0308194_10361517 | Not Available | 519 | Open in IMG/M |
| 3300031546|Ga0318538_10340020 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300031561|Ga0318528_10004440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5959 | Open in IMG/M |
| 3300031564|Ga0318573_10128021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1321 | Open in IMG/M |
| 3300031679|Ga0318561_10212700 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300031679|Ga0318561_10737162 | Not Available | 541 | Open in IMG/M |
| 3300031715|Ga0307476_11290981 | Not Available | 533 | Open in IMG/M |
| 3300031718|Ga0307474_10734082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300031718|Ga0307474_11639471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300031726|Ga0302321_101422257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300031747|Ga0318502_10514908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300031771|Ga0318546_10398020 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300031780|Ga0318508_1203749 | Not Available | 567 | Open in IMG/M |
| 3300031792|Ga0318529_10143065 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300031794|Ga0318503_10201534 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031795|Ga0318557_10438717 | Not Available | 600 | Open in IMG/M |
| 3300031820|Ga0307473_10680328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300031854|Ga0310904_10896478 | Not Available | 626 | Open in IMG/M |
| 3300031880|Ga0318544_10155223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300031890|Ga0306925_10634648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
| 3300031941|Ga0310912_11105768 | Not Available | 605 | Open in IMG/M |
| 3300031947|Ga0310909_10681642 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300031954|Ga0306926_12046805 | Not Available | 642 | Open in IMG/M |
| 3300031959|Ga0318530_10397800 | Not Available | 571 | Open in IMG/M |
| 3300031981|Ga0318531_10103157 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300032001|Ga0306922_10651167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1112 | Open in IMG/M |
| 3300032054|Ga0318570_10433714 | Not Available | 600 | Open in IMG/M |
| 3300032091|Ga0318577_10399947 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300032174|Ga0307470_10460512 | Not Available | 917 | Open in IMG/M |
| 3300032180|Ga0307471_103805940 | Not Available | 534 | Open in IMG/M |
| 3300032783|Ga0335079_11870348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 582 | Open in IMG/M |
| 3300032896|Ga0335075_10215049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2272 | Open in IMG/M |
| 3300032898|Ga0335072_10985862 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300032955|Ga0335076_10592982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300033134|Ga0335073_10684741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
| 3300033289|Ga0310914_10721710 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.63% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.81% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017658 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig MG (version 2) | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021340 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9m | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A01DRAFT_10047853 | 3300000580 | Forest Soil | ALEAAALALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA* |
| JGI10213J12805_101542392 | 3300000858 | Soil | EAAALAVGQFFLDHRTKIKDIEINPLMVRATGAVAVDVRVIWREDVQGA* |
| AP72_2010_repI_A001DRAFT_10493072 | 3300000893 | Forest Soil | ALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA* |
| JGI12635J15846_106379291 | 3300001593 | Forest Soil | GRFYLDHRARIEEIEINPLIIRPHGAIAVDVRVAWRSAKESV* |
| JGI12053J15887_103612921 | 3300001661 | Forest Soil | RARIAEIEINPLIIKPAGAIAVDVRVLWRDESKQH* |
| Ga0055438_102886431 | 3300003995 | Natural And Restored Wetlands | ALGRFFLDHRARIADIEINPLMVRANGAVAVDVRVLWRDGVEGA* |
| Ga0063454_1006432042 | 3300004081 | Soil | QFYLDHRARIEDIEINPLMIRASGAVAVDVRVIWRTGYA* |
| Ga0062589_1008766702 | 3300004156 | Soil | EAAALALARFFLDHRARIADIEINPLIVRGSGAVAVDVRVLWREGEPP* |
| Ga0066395_105326561 | 3300004633 | Tropical Forest Soil | ALSRFYLDHRARIADIEINPLMIGEKGAVAVDVRVLWREGG* |
| Ga0066388_1017614592 | 3300005332 | Tropical Forest Soil | ALALGRFFLDHRARIKDIEINPLMVRPRRSAEQAGAVAVDVRVVWREDAQGV* |
| Ga0066388_1047367262 | 3300005332 | Tropical Forest Soil | ALGRFFLDHRARIKDIEINPVMERPTDAVAVDVRVIWREGA* |
| Ga0066903_1006083571 | 3300005764 | Tropical Forest Soil | RARISDVEINPLMVRPKGGAVAVDVRVVWREDAEGV* |
| Ga0066903_1047760211 | 3300005764 | Tropical Forest Soil | FYLDHRARIEDIEINPLMVRPNGAVAVDVRVIWRTGVD* |
| Ga0066903_1048524212 | 3300005764 | Tropical Forest Soil | FYLDHRAAIEDIEINPLIVRDSGAVAVDVRVIWRNRSTGDR* |
| Ga0066903_1066917002 | 3300005764 | Tropical Forest Soil | TVLALGRFYLDHRAKISDIEINPLVVRSSGCVAVDVRVLWR* |
| Ga0068860_1000231011 | 3300005843 | Switchgrass Rhizosphere | HRARIKDIEINPLMVRPAGQGTVAVDVRVLWREDSQGA* |
| Ga0070766_105361821 | 3300005921 | Soil | RFYLDHRSRIADIEINPLMVGPAGAIAVDVRVLWRAAS* |
| Ga0075365_108382571 | 3300006038 | Populus Endosphere | RIKDIEINPLMVRPRHGAKRAGAVAVDVRVVWREDAQGV* |
| Ga0075028_1009280301 | 3300006050 | Watersheds | FYLDHRARIEEIEINPLIVRRHGAVAVDVRVAWRGAKESV* |
| Ga0075017_1009095282 | 3300006059 | Watersheds | YLDHRARIAEIEINPLIVRASGAVAVDVRVAWHDSKENA* |
| Ga0070765_1002294481 | 3300006176 | Soil | FLDHRARIAEIEINPLMVRGSGAVAVDVRVAWRERPGSVAASG* |
| Ga0075367_104711613 | 3300006178 | Populus Endosphere | IQALAQFYLDHRACIEDIEINPLMVRPSGAVAVDVRVIWKS* |
| Ga0075367_105207712 | 3300006178 | Populus Endosphere | LDHRARIKDIEINPLLVRPQGKGAVAVDVRVIWHDK* |
| Ga0066660_105895651 | 3300006800 | Soil | DHRARIADIEVNPLIVRSNGAVAVDIRVLWRNDSAGET* |
| Ga0075431_1003681561 | 3300006847 | Populus Rhizosphere | RIRDIEINPLMVRPAGEGAVAVDVRVLWREDAEGA* |
| Ga0075431_1004407811 | 3300006847 | Populus Rhizosphere | ARIKDIEINPLMVRPRRSGPDSAQASHAERAGAVAVDVRVVWREGAQGV* |
| Ga0075425_1029122702 | 3300006854 | Populus Rhizosphere | VLALAKFYLDHRSKIDDIEINPLMVRQSGAVAVDVRVIWRE* |
| Ga0075424_1028326752 | 3300006904 | Populus Rhizosphere | LDHRARIEDIEINPLMVRPHGKGAVAVDVRVIWRDTK* |
| Ga0075436_1001334623 | 3300006914 | Populus Rhizosphere | ALGLARFYRDHRTRIAEIEINPLTISAQGAVAVDVRVAWREENT* |
| Ga0099795_100656051 | 3300007788 | Vadose Zone Soil | HRARIEDIEINPLMVHPSGAIAVDMRVIWRTGEA* |
| Ga0066710_1022071562 | 3300009012 | Grasslands Soil | LDHRARVAEIEINPLMVCTRGAVAVDVRVLWRRDGGDA |
| Ga0099828_103770051 | 3300009089 | Vadose Zone Soil | ALALGQFFLDHRARISDIEINPLMVRQTGCVAVDVRVLWREDV* |
| Ga0111539_118058251 | 3300009094 | Populus Rhizosphere | SIKDIEINPLRVRPRRGGPDSAQARQGERAGAVAVDVRVVWREDAQGA* |
| Ga0099792_105458561 | 3300009143 | Vadose Zone Soil | TASGLAQFFLDHRARIRDVEINPLMVRPSGAVAVDVRVLWREDV* |
| Ga0105071_11099842 | 3300009808 | Groundwater Sand | LAQFYLDHRARIDDIEINPLMVRGNGAVAVDVRVIWRA* |
| Ga0126314_103869981 | 3300010042 | Serpentine Soil | AQFYLDHRARIEDVEINPLTVRPNGRGAVAVDVRVIWRNDNEGNA* |
| Ga0126311_110940191 | 3300010045 | Serpentine Soil | FFLDHRERIADIEINPLMVRPFGRGAVAVDVRVLWRDESGSMA* |
| Ga0126384_117124102 | 3300010046 | Tropical Forest Soil | ALAQFYLDHRARIRDVEINPLIVRAAGRGAVAVDVRVLWREGS* |
| Ga0126376_109179022 | 3300010359 | Tropical Forest Soil | ALARFYLDHRSKIDDIEINPLMVRSSGAVAVDVRVIWRR* |
| Ga0126376_130115041 | 3300010359 | Tropical Forest Soil | KIVLALAKFYLDHRARIDDIEINPLMVRPNGAVAVDVRVIWRTGVD* |
| Ga0126377_112020821 | 3300010362 | Tropical Forest Soil | YLDHRARIEDIEINPLMVRPNGAVAVDVRVIWKS* |
| Ga0126379_112153441 | 3300010366 | Tropical Forest Soil | HRAHIEDIEINPLMVRPSGAIAVDVRVIWRERNP* |
| Ga0126383_110612382 | 3300010398 | Tropical Forest Soil | ALSRFYLDHRARIADIEINPLMIGEKGAVAVDVRVLWREGS* |
| Ga0126383_128956391 | 3300010398 | Tropical Forest Soil | LDHRARIEDIEINPLMVRSSGAVAVDVRVIWREGKA* |
| Ga0137379_110479842 | 3300012209 | Vadose Zone Soil | DHRSKIEDVEINPLMVRQQGAVAVDVRVIWRTGDA* |
| Ga0137375_109932411 | 3300012360 | Vadose Zone Soil | VRALAQFYLDHRARIEDIEINPLMVRPSSAVAVDVRVIWRTGEA* |
| Ga0150984_1121641251 | 3300012469 | Avena Fatua Rhizosphere | EDVEINPLMVRPDGRGAVAVDVRVIWRNDNGGNA* |
| Ga0137397_105434672 | 3300012685 | Vadose Zone Soil | LALAQFYLDHRARIEDIEINPLMVRQKGAVAVDVRVIWRSHSGGDA* |
| Ga0157286_100569601 | 3300012908 | Soil | HRARIRDIEINPLMVRPAGEGAVAVDVRVLWREDAEGA* |
| Ga0137396_106619552 | 3300012918 | Vadose Zone Soil | FFLDHRARIADIEINPLIVRQSGAVAVDVRVLWREGEPA* |
| Ga0137416_109123372 | 3300012927 | Vadose Zone Soil | ERADPGALALAQFHLDHRARIEEIEINPLMVRALGRGAVAVDVRVLWRDDTKLHKS* |
| Ga0137404_116798912 | 3300012929 | Vadose Zone Soil | AAVRALAQFYLDHRARIEDIEINPLMVRSSGAVAVDVRVIWRTGDA* |
| Ga0126369_111917051 | 3300012971 | Tropical Forest Soil | ALEAAALALGRFFLDHRARIKEIEINPVMVRTGSADIGAIAVDVRVLWQDGAEDA* |
| Ga0164307_115515591 | 3300012987 | Soil | LAHFYADHRARVEDVEINPLMVRTNGAVAVDVRVIWKT* |
| Ga0075312_10851052 | 3300014254 | Natural And Restored Wetlands | QFFLDHRANIDDIEINPLMVRPNGAVAVDVRVIWRNNDREGA* |
| Ga0157380_119274002 | 3300014326 | Switchgrass Rhizosphere | ARIDDIEINPLMVRPNGAVAVDVRVIWKDAKGDH* |
| Ga0132256_1001361676 | 3300015372 | Arabidopsis Rhizosphere | IKDIEINPLIVRPSGDGAVAVDVRVLWREEGVQPT* |
| Ga0182036_118670872 | 3300016270 | Soil | ALAIGRLFLDHRARIRDIEINPLIVRPDACGAVAVDVRVLWRDDD |
| Ga0182738_12960302 | 3300017658 | Compost | YLDHRARIADIEINPLVLRPDGEGACAVDVRVIWR |
| Ga0187769_114669221 | 3300018086 | Tropical Peatland | AALALARFYLNHRARIAEIELNPLMVRQQGAVAVDVRVVWREEN |
| Ga0187771_116498222 | 3300018088 | Tropical Peatland | QFYLDHRARVAEIEINPLMVGASGATAVDLRVVWRE |
| Ga0190265_124418221 | 3300018422 | Soil | AQFYLDHRARIEDIEINPLMVRPQGNGAVAVDVRVIWRDAK |
| Ga0190265_126227432 | 3300018422 | Soil | LDHRTRIEDIEINPLMVRPQGKGAVAVDVRVIWRDAK |
| Ga0190270_122929372 | 3300018469 | Soil | LGRFFLDHRARMDDIEINPLMVRENGAVAVDVRVLWRDSAQGA |
| Ga0193721_10797171 | 3300020018 | Soil | LAQFYLDHRARVAEIEINPLMVCTRGAIAVDVRVLWCRDGGDP |
| Ga0194041_102752251 | 3300021340 | Anoxic Zone Freshwater | FYLDHRAAVADIEINPLIVRPAGQGVCAVDVRVIWK |
| Ga0193699_100476201 | 3300021363 | Soil | RIRDIEINPLMVRPAGEGTVAVDVRVLWREDAQGA |
| Ga0210390_115482482 | 3300021474 | Soil | LETATLGLARFYLDHRARIAEIEFNPLMVRNNGAVAVDVRVVWREEKK |
| Ga0210402_101134481 | 3300021478 | Soil | HRGAIKDIEINPLIVRRSGSGAVAVDVRVVWHTEQGG |
| Ga0126371_131582262 | 3300021560 | Tropical Forest Soil | LDHRARISDIEINPLMVRSTGAVAVDVRVIWREGAAEP |
| Ga0212123_102860571 | 3300022557 | Iron-Sulfur Acid Spring | FYLDHRARVAEIEVNPLIVRGNGAVAVDVRVVWHRENPREENSREEKM |
| Ga0207665_113527582 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DHRARIAEIEINPLMVSAQGAIAVDVRVAWREENA |
| Ga0209731_10341463 | 3300027326 | Forest Soil | LLARAALALGRFYLDHRANIEEIEINPLIVRPQGAVAVDVRVAWRRG |
| Ga0209529_10410431 | 3300027334 | Forest Soil | NHRAKIDEIEINPLIVRPQGAIAVDVRVAWRKENV |
| Ga0208827_10040291 | 3300027641 | Peatlands Soil | ALALGRFYLDHRARIEEIEINPLIVRPQGAVAVDVRVAWRKENR |
| Ga0209420_10535561 | 3300027648 | Forest Soil | RLRIAEIEINPLIVRSNGAVAVDVRVVWREGEAPPCT |
| Ga0209283_100823511 | 3300027875 | Vadose Zone Soil | ALGRFFLDHRARIQDIEINPLMVRCSGTVAIDVRVLWRADIQGAD |
| Ga0209283_102581801 | 3300027875 | Vadose Zone Soil | ALALGQFFLDHRARISDIEINPLMVRQTGCVAVDVRVLWREGV |
| Ga0209481_107107961 | 3300027880 | Populus Rhizosphere | HRARIEDIEINPLMVRPQGKGAVAVDVRVIWRDAK |
| Ga0209275_100473944 | 3300027884 | Soil | YLDHRAKIDEIEINPLIVRPRGAVAVDVRVAWRES |
| Ga0209526_103669021 | 3300028047 | Forest Soil | LDHRARIKDIEINPLMVRPNGCGTVAVDVRVLWREDGEGA |
| Ga0307295_102336461 | 3300028708 | Soil | LDHRARIKDIEINPLMVRPAGEGTVAVDVRVLWREDAQGA |
| Ga0307320_102385321 | 3300028771 | Soil | LTQFLLDHRARIKDIEINPLMVRPAGQGTVAVDVRVLWREDSQGA |
| Ga0307296_107805021 | 3300028819 | Soil | FLDHRTRIKDIEINPLMVRARGCGAIAVDVRVVWRDDGEGDQTA |
| Ga0308309_108260812 | 3300028906 | Soil | ALSRFFLDHRARIAEIEINPLMVRGSGAVAVDVRVAWRERPGSVAASG |
| Ga0308309_110136972 | 3300028906 | Soil | ALARFYLDHRARIADIEINPLMIRANGAVAVDVRVVWRE |
| Ga0308194_103546302 | 3300031421 | Soil | VRALAQFYLDHRARIEDIEINPLMVRPSGAVAVDVRVIWKS |
| Ga0308194_103615172 | 3300031421 | Soil | RARIKDIEINPLMVRPAGEGTVAVDVRVLWREDAQGA |
| Ga0318538_103400201 | 3300031546 | Soil | ALVATVLTLGRFFLDHRARITDIELNPLVVRSSGCVAVDVRVLWR |
| Ga0318528_100044401 | 3300031561 | Soil | ALALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA |
| Ga0318573_101280211 | 3300031564 | Soil | FYLDHRARIAEIEINPLMIRDCGRGAVAVDVRVLWRDQQ |
| Ga0318561_102127002 | 3300031679 | Soil | DHGARIKDIEINPLVVRAAGRGAVAVDVRVLWRSDGQG |
| Ga0318561_107371621 | 3300031679 | Soil | PPRRARIAEIEINPLMIRDCGRGAVAVDVRVLWRDQQ |
| Ga0307476_112909812 | 3300031715 | Hardwood Forest Soil | YLDHRSRIADIEINPLMVGPASAIAVDVRVLWRAAS |
| Ga0307474_107340821 | 3300031718 | Hardwood Forest Soil | LALGRFYLDHRGKIEEIEINPLIVRPQGAVAVDVRVAWRKEK |
| Ga0307474_116394711 | 3300031718 | Hardwood Forest Soil | EAAAMALGRFYLDHRARIEEIEINPLIVRASGAVAVDVRVAWSKENK |
| Ga0302321_1014222571 | 3300031726 | Fen | DHRAKIADIEINPLMVREKGAVAVDVRVLWRNDTGA |
| Ga0318502_105149082 | 3300031747 | Soil | GRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA |
| Ga0318546_103980202 | 3300031771 | Soil | GRFFLDHRENIKDIEINPLMVRARGRGAMAVDVRVLWRKDGEG |
| Ga0318508_12037491 | 3300031780 | Soil | LDHRARIADIEINPLIVRARAHGAVAVDVRVSWRDA |
| Ga0318529_101430651 | 3300031792 | Soil | HRENIKDIEINPLMVRARGRGAMAVDVRVLWRKDGEG |
| Ga0318503_102015342 | 3300031794 | Soil | DHRESIKDIEINPLMVRAKGRGAVAVDMRVLWRKDGEG |
| Ga0318557_104387171 | 3300031795 | Soil | AAALALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA |
| Ga0307473_106803282 | 3300031820 | Hardwood Forest Soil | ALAQFYLDHRARIAEIEINPLVIRANGAVAVDVRALWREPQ |
| Ga0310904_108964781 | 3300031854 | Soil | HRARIRDIEINPLMVRPAGEGAVAVDVRVLWREDAEGA |
| Ga0318544_101552231 | 3300031880 | Soil | FYLDHRARIADIEINPLIVRARAHGAVAVDVRVSWRDA |
| Ga0306925_106346481 | 3300031890 | Soil | ALEAAALALAKFYLDHRAAVAEIEINPLTVQHNGAVPVDVRVIWRETN |
| Ga0310912_111057681 | 3300031941 | Soil | ALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA |
| Ga0310909_106816421 | 3300031947 | Soil | GRFYLDHRTRIGDIEINPLVVRASGCVAVDVRVLWR |
| Ga0306926_120468052 | 3300031954 | Soil | GHFYLDHRARIADIEINPLIVRPHPHGAVAVDVRVAWRDP |
| Ga0318530_103978001 | 3300031959 | Soil | LALGRFFLDHRARIKEIEINPLMVRTGSAGIGAIAVDVRVLWQDGAEDA |
| Ga0318531_101031571 | 3300031981 | Soil | FFLDHGARIKDIEINPLVVRAAGRGAVAVDVRVLWRSDGQG |
| Ga0306922_106511672 | 3300032001 | Soil | RTAFEAAALALARFFLDHRARIKDIEINPLMVRANNQSPVAVDVRVLWREHGEGT |
| Ga0318570_104337141 | 3300032054 | Soil | ALARFFLDHRARIKDIEINPLMVRANNQSPVAVDVRVLWREHGEGT |
| Ga0318577_103999472 | 3300032091 | Soil | TVLTLGRFFLDHRARITDIELNPLVVRSSGCVAVDVRVLWR |
| Ga0307470_104605121 | 3300032174 | Hardwood Forest Soil | GALAQFYLDHRARIEDIEINPLMVRPSGAVAVDVRVIWKS |
| Ga0307471_1038059402 | 3300032180 | Hardwood Forest Soil | ALGRFFLDHRARIADIEINPLMVRQHGAVAVDVRVLWRNQGA |
| Ga0335079_118703482 | 3300032783 | Soil | EAAALALGRFYLDHRVRNADIEINPLIVRPGPHGAVAVDVRVAWRDA |
| Ga0335075_102150493 | 3300032896 | Soil | LALGRFYLDHRANIAEIEINPLMVRSDGAMAVDLRVVWREEKM |
| Ga0335072_109858621 | 3300032898 | Soil | YLDHRARIGEIEINPLMVRATDAVAVDVRVAWRGESK |
| Ga0335076_105929822 | 3300032955 | Soil | ATALALARFYLDHRARISEIEFNPLIVRNSGAVAVDVRVNWRGENV |
| Ga0335073_106847412 | 3300033134 | Soil | ALSRFFLDHRARIAEIEINPLIVRDAGAVAIDVRVVWRQEQV |
| Ga0310914_107217102 | 3300033289 | Soil | VLTLGRFFLDHRARITDIELNPLVVRSSGCVAVDVRVLWR |
| ⦗Top⦘ |