


| Basic Information | |
|---|---|
| Family ID | F070355 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKF |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.93 % |
| % of genes near scaffold ends (potentially truncated) | 78.05 % |
| % of genes from short scaffolds (< 2000 bps) | 71.54 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.480 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.943 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.780 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 8.94 |
| PF02899 | Phage_int_SAM_1 | 2.44 |
| PF13338 | AbiEi_4 | 1.63 |
| PF03135 | CagE_TrbE_VirB | 1.63 |
| PF02371 | Transposase_20 | 1.63 |
| PF01925 | TauE | 0.81 |
| PF08843 | AbiEii | 0.81 |
| PF01555 | N6_N4_Mtase | 0.81 |
| PF00149 | Metallophos | 0.81 |
| PF14464 | Prok-JAB | 0.81 |
| PF02384 | N6_Mtase | 0.81 |
| PF07859 | Abhydrolase_3 | 0.81 |
| PF13020 | NOV_C | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF00899 | ThiF | 0.81 |
| PF13476 | AAA_23 | 0.81 |
| PF13620 | CarboxypepD_reg | 0.81 |
| PF01609 | DDE_Tnp_1 | 0.81 |
| PF04970 | LRAT | 0.81 |
| PF03819 | MazG | 0.81 |
| PF14279 | HNH_5 | 0.81 |
| PF03235 | DUF262 | 0.81 |
| PF01850 | PIN | 0.81 |
| PF16542 | PNKP_ligase | 0.81 |
| PF01381 | HTH_3 | 0.81 |
| PF13655 | RVT_N | 0.81 |
| PF00498 | FHA | 0.81 |
| PF00082 | Peptidase_S8 | 0.81 |
| PF13683 | rve_3 | 0.81 |
| PF01914 | MarC | 0.81 |
| PF04465 | DUF499 | 0.81 |
| PF12950 | TaqI_C | 0.81 |
| PF13531 | SBP_bac_11 | 0.81 |
| PF04326 | AlbA_2 | 0.81 |
| PF07730 | HisKA_3 | 0.81 |
| PF13231 | PMT_2 | 0.81 |
| PF00483 | NTP_transferase | 0.81 |
| PF03747 | ADP_ribosyl_GH | 0.81 |
| PF13538 | UvrD_C_2 | 0.81 |
| PF01935 | DUF87 | 0.81 |
| PF13411 | MerR_1 | 0.81 |
| PF08808 | RES | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 2.44 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 2.44 |
| COG3451 | Type IV secretory pathway, VirB4 component | Intracellular trafficking, secretion, and vesicular transport [U] | 1.63 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.63 |
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.81 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.81 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.81 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.81 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.81 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.81 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.81 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.81 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.81 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.81 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.81 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.81 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.81 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.81 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.29 % |
| Unclassified | root | N/A | 31.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10242986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
| 3300001546|JGI12659J15293_10011079 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
| 3300005181|Ga0066678_10046861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2444 | Open in IMG/M |
| 3300005436|Ga0070713_100600425 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005436|Ga0070713_102365393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 514 | Open in IMG/M |
| 3300005538|Ga0070731_10452864 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 854 | Open in IMG/M |
| 3300005610|Ga0070763_10057672 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300005614|Ga0068856_102273574 | Not Available | 551 | Open in IMG/M |
| 3300005993|Ga0080027_10299172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300006162|Ga0075030_100001262 | All Organisms → cellular organisms → Bacteria | 22752 | Open in IMG/M |
| 3300006176|Ga0070765_100316854 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300006354|Ga0075021_10014111 | All Organisms → cellular organisms → Bacteria | 4391 | Open in IMG/M |
| 3300006893|Ga0073928_10019852 | All Organisms → cellular organisms → Bacteria | 6965 | Open in IMG/M |
| 3300007982|Ga0102924_1003646 | All Organisms → cellular organisms → Bacteria | 16048 | Open in IMG/M |
| 3300009038|Ga0099829_11184563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300009088|Ga0099830_11774557 | Not Available | 515 | Open in IMG/M |
| 3300009137|Ga0066709_100233201 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300009523|Ga0116221_1558780 | Not Available | 503 | Open in IMG/M |
| 3300009524|Ga0116225_1011043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 4900 | Open in IMG/M |
| 3300009623|Ga0116133_1009774 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300009627|Ga0116109_1037152 | Not Available | 891 | Open in IMG/M |
| 3300009645|Ga0116106_1008105 | All Organisms → cellular organisms → Bacteria | 3998 | Open in IMG/M |
| 3300010043|Ga0126380_11881915 | Not Available | 544 | Open in IMG/M |
| 3300010343|Ga0074044_10027581 | Not Available | 4032 | Open in IMG/M |
| 3300010343|Ga0074044_10216926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
| 3300010343|Ga0074044_10375557 | Not Available | 932 | Open in IMG/M |
| 3300010358|Ga0126370_12136787 | Not Available | 550 | Open in IMG/M |
| 3300010376|Ga0126381_103647939 | Not Available | 603 | Open in IMG/M |
| 3300010379|Ga0136449_100044034 | All Organisms → cellular organisms → Bacteria | 10253 | Open in IMG/M |
| 3300010398|Ga0126383_12447037 | Not Available | 607 | Open in IMG/M |
| 3300011269|Ga0137392_10930062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300011271|Ga0137393_10708918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300012210|Ga0137378_10838562 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300012354|Ga0137366_10922143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300012363|Ga0137390_10218241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1894 | Open in IMG/M |
| 3300012517|Ga0157354_1084685 | Not Available | 520 | Open in IMG/M |
| 3300012923|Ga0137359_11376595 | Not Available | 594 | Open in IMG/M |
| 3300014150|Ga0134081_10337294 | Not Available | 550 | Open in IMG/M |
| 3300014167|Ga0181528_10057813 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300014489|Ga0182018_10001891 | All Organisms → cellular organisms → Bacteria | 22456 | Open in IMG/M |
| 3300014838|Ga0182030_10276138 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300014838|Ga0182030_11370503 | Not Available | 592 | Open in IMG/M |
| 3300017925|Ga0187856_1048704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1872 | Open in IMG/M |
| 3300017925|Ga0187856_1168356 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300017935|Ga0187848_10412300 | Not Available | 556 | Open in IMG/M |
| 3300017946|Ga0187879_10261486 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300017970|Ga0187783_10341587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300018008|Ga0187888_1350555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300018014|Ga0187860_1250512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 703 | Open in IMG/M |
| 3300018015|Ga0187866_1316844 | Not Available | 544 | Open in IMG/M |
| 3300018033|Ga0187867_10557012 | Not Available | 629 | Open in IMG/M |
| 3300018034|Ga0187863_10858955 | Not Available | 515 | Open in IMG/M |
| 3300018043|Ga0187887_10427902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300018057|Ga0187858_10275881 | Not Available | 1071 | Open in IMG/M |
| 3300018086|Ga0187769_10110390 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300019787|Ga0182031_1086399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1567 | Open in IMG/M |
| 3300019881|Ga0193707_1166353 | Not Available | 599 | Open in IMG/M |
| 3300020061|Ga0193716_1057577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1789 | Open in IMG/M |
| 3300020583|Ga0210401_11526511 | Not Available | 525 | Open in IMG/M |
| 3300021088|Ga0210404_10150419 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1219 | Open in IMG/M |
| 3300021088|Ga0210404_10429945 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300021168|Ga0210406_10804872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300021170|Ga0210400_11170149 | Not Available | 620 | Open in IMG/M |
| 3300021407|Ga0210383_11205453 | Not Available | 636 | Open in IMG/M |
| 3300021432|Ga0210384_10350931 | Not Available | 1328 | Open in IMG/M |
| 3300021433|Ga0210391_10599282 | Not Available | 865 | Open in IMG/M |
| 3300021478|Ga0210402_10251579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1631 | Open in IMG/M |
| 3300021478|Ga0210402_10474085 | Not Available | 1162 | Open in IMG/M |
| 3300021861|Ga0213853_10461955 | Not Available | 567 | Open in IMG/M |
| 3300022557|Ga0212123_10070925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 3005 | Open in IMG/M |
| 3300023101|Ga0224557_1088593 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300023101|Ga0224557_1164181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300025134|Ga0207416_1017187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3976 | Open in IMG/M |
| 3300025414|Ga0208935_1044495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300025917|Ga0207660_10190219 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300026116|Ga0207674_12140620 | Not Available | 523 | Open in IMG/M |
| 3300026294|Ga0209839_10057373 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300026548|Ga0209161_10377026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300027625|Ga0208044_1177783 | Not Available | 578 | Open in IMG/M |
| 3300027684|Ga0209626_1193610 | Not Available | 539 | Open in IMG/M |
| 3300027698|Ga0209446_1008087 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
| 3300027701|Ga0209447_10073755 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300027729|Ga0209248_10173213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 641 | Open in IMG/M |
| 3300027853|Ga0209274_10424464 | Not Available | 687 | Open in IMG/M |
| 3300027879|Ga0209169_10001147 | All Organisms → cellular organisms → Bacteria | 16070 | Open in IMG/M |
| 3300027905|Ga0209415_10101960 | Not Available | 3143 | Open in IMG/M |
| 3300027908|Ga0209006_10003421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 14429 | Open in IMG/M |
| 3300028047|Ga0209526_10771166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300028806|Ga0302221_10025031 | All Organisms → cellular organisms → Bacteria | 2885 | Open in IMG/M |
| 3300028863|Ga0302218_10003700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 5040 | Open in IMG/M |
| 3300029889|Ga0246001_1007428 | All Organisms → cellular organisms → Bacteria | 4198 | Open in IMG/M |
| 3300029985|Ga0302280_1026617 | All Organisms → cellular organisms → Bacteria | 2693 | Open in IMG/M |
| 3300029999|Ga0311339_11888824 | Not Available | 515 | Open in IMG/M |
| 3300030041|Ga0302274_10005815 | All Organisms → cellular organisms → Bacteria | 10351 | Open in IMG/M |
| 3300030053|Ga0302177_10015167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 5013 | Open in IMG/M |
| 3300030057|Ga0302176_10022206 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300030494|Ga0310037_10185596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 929 | Open in IMG/M |
| 3300030707|Ga0310038_10067631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1953 | Open in IMG/M |
| 3300030743|Ga0265461_12312282 | Not Available | 627 | Open in IMG/M |
| 3300030760|Ga0265762_1003802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 2700 | Open in IMG/M |
| 3300030763|Ga0265763_1048897 | Not Available | 528 | Open in IMG/M |
| 3300031234|Ga0302325_10433442 | All Organisms → cellular organisms → Archaea → TACK group | 2027 | Open in IMG/M |
| 3300031234|Ga0302325_12036372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300031236|Ga0302324_101083177 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300031236|Ga0302324_101595427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300031236|Ga0302324_102652630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300031524|Ga0302320_10831122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300031708|Ga0310686_106167954 | All Organisms → cellular organisms → Bacteria | 3527 | Open in IMG/M |
| 3300031708|Ga0310686_109404009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1669 | Open in IMG/M |
| 3300031708|Ga0310686_111929436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300031708|Ga0310686_115166204 | Not Available | 695 | Open in IMG/M |
| 3300031740|Ga0307468_101057226 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031823|Ga0307478_10752893 | Not Available | 816 | Open in IMG/M |
| 3300031962|Ga0307479_11297335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300032160|Ga0311301_10058237 | All Organisms → cellular organisms → Bacteria | 8542 | Open in IMG/M |
| 3300032160|Ga0311301_10101292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5630 | Open in IMG/M |
| 3300032160|Ga0311301_10419595 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300032180|Ga0307471_100068231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3051 | Open in IMG/M |
| 3300032782|Ga0335082_11721640 | Not Available | 501 | Open in IMG/M |
| 3300032892|Ga0335081_10677121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1256 | Open in IMG/M |
| 3300032955|Ga0335076_10019563 | All Organisms → cellular organisms → Bacteria | 6795 | Open in IMG/M |
| 3300032955|Ga0335076_11798958 | Not Available | 502 | Open in IMG/M |
| 3300033405|Ga0326727_11065625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.25% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.44% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.44% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.63% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.63% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.81% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009627 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102429862 | 3300000567 | Peatlands Soil | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCS* |
| JGI12659J15293_100110795 | 3300001546 | Forest Soil | KLEEVNQRTKEAVDFLMAALESGHSAVLTQYLAATAKFRNYSFLCVQ* |
| Ga0066678_100468612 | 3300005181 | Soil | MKLEEVNKRTKEAVDFLVAELESGHSEVLTAYLGAMAKFHTY |
| Ga0070713_1006004253 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLEEVNQRTKEAVDFLVAALESGHSEVLTAYLSAMAKFHT |
| Ga0070713_1023653931 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLDEIKNKTKEAVDYLVEALESGRSDVLTQYLGAMARFHT |
| Ga0070731_104528641 | 3300005538 | Surface Soil | MKLEEIKNKTKEATDYLVQSLEGGHSEVLTQYLGA |
| Ga0070763_100576721 | 3300005610 | Soil | MKLEEVNKRTKEAVDFLVAALESGHSEVLTAYLGAMAKF |
| Ga0068856_1022735742 | 3300005614 | Corn Rhizosphere | MKLEELKNKTKDAVDYLVQSLESGHSEVLTQYLGAM |
| Ga0080027_102991722 | 3300005993 | Prmafrost Soil | MKLEEINNKTNEAFSFLVAALESGESEVLTQYLNA |
| Ga0075030_1000012621 | 3300006162 | Watersheds | MKLEDIKNKTKDAVDYLVQSLESGHSEVLTQYLGAMARFHT |
| Ga0070765_1003168543 | 3300006176 | Soil | EVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCY* |
| Ga0075021_100141115 | 3300006354 | Watersheds | MKLEEVTLKAKEAVDYLVQSLESGQSAVLTQYLGAMAKFR |
| Ga0073928_100198521 | 3300006893 | Iron-Sulfur Acid Spring | MKLEEVNHKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCY* |
| Ga0102924_100364611 | 3300007982 | Iron-Sulfur Acid Spring | MEGKNMKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAM |
| Ga0099829_111845631 | 3300009038 | Vadose Zone Soil | MKLEEVNQKTKEAVDFLVAALESGHSEVLTAYLGAMAKFR |
| Ga0099830_117745571 | 3300009088 | Vadose Zone Soil | MKLEEIKNRTKDAVEHLIQALEAGRSEALTEYLAV |
| Ga0066709_1002332011 | 3300009137 | Grasslands Soil | MKLEELKNKTKDAVNYLVQSLESGHSEVLTQYLGAMARFHTY |
| Ga0116221_15587801 | 3300009523 | Peatlands Soil | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFH |
| Ga0116225_10110431 | 3300009524 | Peatlands Soil | MKLEEVNTRTKEAVDFLVAALESGHSEVLATYIGAMAKFHTYSFLCVQ* |
| Ga0116133_10097741 | 3300009623 | Peatland | VDFLVAALESGHSEVLTAYLGAMAKFHSYSFLCVQ* |
| Ga0116109_10371521 | 3300009627 | Peatland | MKLDDVNLKTKEALDYLVLSLDSGHSHVLTQYLGAMAKFRNYSF |
| Ga0116106_10081056 | 3300009645 | Peatland | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYRCLCY* |
| Ga0126380_118819151 | 3300010043 | Tropical Forest Soil | MKLEDIKSKTKDAVDYLVHSLESGHSEVLTQYLGTM |
| Ga0074044_100275811 | 3300010343 | Bog Forest Soil | MKLEEVNHKTKEAVDYLVQSLESGQSAVLTQYLGAM |
| Ga0074044_102169261 | 3300010343 | Bog Forest Soil | TRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCY* |
| Ga0074044_103755571 | 3300010343 | Bog Forest Soil | MKLDEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAK |
| Ga0126370_121367871 | 3300010358 | Tropical Forest Soil | MKLEEVNQRTIEAVDFLVAALESGHSEVLTAYLGAMAKF |
| Ga0126381_1036479392 | 3300010376 | Tropical Forest Soil | MKVVDIKSKTKDAVDYLVQSLESGHSEVLTQYLGA |
| Ga0136449_1000440348 | 3300010379 | Peatlands Soil | MKVEEIKQLTTKALDELVSALESGHSETLTAYLEAMAKF* |
| Ga0126383_124470371 | 3300010398 | Tropical Forest Soil | MKLEEVNQRTKEAVDFLVAALESGHSEVLTTYLTAMAK |
| Ga0137392_109300621 | 3300011269 | Vadose Zone Soil | KEAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCC* |
| Ga0137393_107089181 | 3300011271 | Vadose Zone Soil | MKLEEVNLKTKEAVNYLVQPLGGGQSSVLTQYLGAMAK |
| Ga0137378_108385621 | 3300012210 | Vadose Zone Soil | EAFSFLVAALESGESEVLTQYLNAMARFHTYSFLC* |
| Ga0137366_109221431 | 3300012354 | Vadose Zone Soil | MKLEEIKNKTQEATDYLVQSLEAGHSEVLTEYLGAMAK |
| Ga0137390_102182411 | 3300012363 | Vadose Zone Soil | MKLEEIKDKTQEATNYLVHSLEAGHSKVLTQYLGPMAKFHTYSRHARRPREF* |
| Ga0157354_10846851 | 3300012517 | Unplanted Soil | MKQEEINRRTKEAVDYLVESLESGRSEVLVQYLAAMGR |
| Ga0137359_113765951 | 3300012923 | Vadose Zone Soil | MKLEEVNQKTKEAVDFLVAALESGQSEVLTAYLGAMAKFRNY |
| Ga0134081_103372941 | 3300014150 | Grasslands Soil | MKLEDIKTKTKDAVDYLVQSLESGHSEVLTQYLGTMARFRTYSFG |
| Ga0181528_100578132 | 3300014167 | Bog | MEGKTMKLEEVNKRTKDAVDFLVAALESGHSEVLTAYLGAMAKFH |
| Ga0182018_1000189117 | 3300014489 | Palsa | MKLEEVNTRTKEAVDFLVAALESGHSEVLTTYLGAMA |
| Ga0182030_102761382 | 3300014838 | Bog | MKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAM |
| Ga0182030_113705031 | 3300014838 | Bog | MKLEEVNQRTKEAVDFLVAALESGHSEVLTAYLGAMAKFH |
| Ga0187856_10487042 | 3300017925 | Peatland | MRLQEVNLKTKEAVDYLVQSLESGHSEVLTQYLGAMAKFRNYSFLCC |
| Ga0187856_11683561 | 3300017925 | Peatland | MKLEEVNLKTKEAVNYLVQSLEAGQSAVLTQYLGAMAK |
| Ga0187848_104123001 | 3300017935 | Peatland | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAM |
| Ga0187879_102614863 | 3300017946 | Peatland | LEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMSKFHTYSFLCY |
| Ga0187783_103415871 | 3300017970 | Tropical Peatland | MKLEEVNQRTKEAVDFLVAALESGHSEVLTAYLSAM |
| Ga0187888_13505552 | 3300018008 | Peatland | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAM |
| Ga0187860_12505121 | 3300018014 | Peatland | KGKNMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYPGAMAKFRNYSFLCVQ |
| Ga0187866_13168441 | 3300018015 | Peatland | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMA |
| Ga0187867_105570121 | 3300018033 | Peatland | MKLEEVNQRTKEAVDFLVAALESGHSEILTAYLGAMAKL |
| Ga0187863_108589551 | 3300018034 | Peatland | RTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCY |
| Ga0187887_104279022 | 3300018043 | Peatland | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCY |
| Ga0187858_102758811 | 3300018057 | Peatland | MRLEEVNLKTKEAVNYLVQSLEAGQSAVLTQYLGAMAKFRN |
| Ga0187769_101103901 | 3300018086 | Tropical Peatland | MKLEDIQNRTKDAVDYLVQSLESGHSEVLAQYLGAMAR |
| Ga0182031_10863991 | 3300019787 | Bog | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNY |
| Ga0193707_11663531 | 3300019881 | Soil | MKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAKFRNYSFLCY |
| Ga0193716_10575772 | 3300020061 | Soil | MKLEEVNHKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCVQ |
| Ga0210401_115265112 | 3300020583 | Soil | MKLEEVNQRTKEAVHFLVAALESGQSAVLTQYLSAIAK |
| Ga0210404_101504192 | 3300021088 | Soil | MKLEDIKNKTKDAVDYLVQSLESGQSDVLSKYLGAMARFH |
| Ga0210404_104299452 | 3300021088 | Soil | MKLEEVNQRTKEAVDFLVAALESGHSAVLTQYLAAMAKFRNYSFW |
| Ga0210406_108048722 | 3300021168 | Soil | LKTKEAVDYLVQSLESGQSAVLAQYLGAMAKFRNYSFLCY |
| Ga0210400_111701491 | 3300021170 | Soil | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAK |
| Ga0210383_112054532 | 3300021407 | Soil | MKLEEVNKRTKDAVDFLAAALESGHSEALTAYLGAMAKCRNYSFLCVQ |
| Ga0210384_103509311 | 3300021432 | Soil | MKLEEVNTRTKEAVDFLVAALESGNSEVLTAYLGAMAK |
| Ga0210391_105992821 | 3300021433 | Soil | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGA |
| Ga0210402_102515793 | 3300021478 | Soil | MKLEEVNLKTKEAVNYLVQSLEAGQSTLLTQYLGAMAKFRNYSFLCS |
| Ga0210402_104740852 | 3300021478 | Soil | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGA |
| Ga0213853_104619551 | 3300021861 | Watersheds | MKLDEINRRTKEAVAYLVESLESGRSEVLVQYLAA |
| Ga0212123_100709251 | 3300022557 | Iron-Sulfur Acid Spring | MKLEEVNTRTKEAVDFLVAALESGHSEVLTTYLGAM |
| Ga0224557_10885931 | 3300023101 | Soil | MKLEEIKNRTKDAVDYLVQALESGRSEVLTQYLGTMARFHTY |
| Ga0224557_11641811 | 3300023101 | Soil | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLAAMAKFR |
| Ga0207416_10171876 | 3300025134 | Iron-Sulfur Acid Spring | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTY |
| Ga0208935_10444951 | 3300025414 | Peatland | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKF |
| Ga0207660_101902196 | 3300025917 | Corn Rhizosphere | MKLEEVNKRTKEAIDFLIAALESGHSEVYTAYLRAMAKF |
| Ga0207674_121406201 | 3300026116 | Corn Rhizosphere | MKLEEVNQKTKEAVDFLVAALESGHSEVLTQYLAV |
| Ga0209839_100573732 | 3300026294 | Soil | MKLEEVNTRTKVAVDFLVVALESGHSEVLTAYLGAMAKFHTYSFLCY |
| Ga0209161_103770261 | 3300026548 | Soil | MKLEDIKNKTKDAVDYLVQSLESGHSEVLTQYLGTMA |
| Ga0208044_11777831 | 3300027625 | Peatlands Soil | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCS |
| Ga0209626_11936102 | 3300027684 | Forest Soil | MKSEEVNQRTKEAVDFLVAALESGQSAVLTEYLAAMAKFRNYSF |
| Ga0209446_10080874 | 3300027698 | Bog Forest Soil | MKLEEINNRTKDAVSYLVEALESGQSAVLTQYLSAMGRFHNYTSRIG |
| Ga0209447_100737553 | 3300027701 | Bog Forest Soil | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKF |
| Ga0209248_101732131 | 3300027729 | Bog Forest Soil | MKLEEVNNKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSF |
| Ga0209274_104244642 | 3300027853 | Soil | MKLEEVNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKVHTYSVQCC |
| Ga0209169_1000114721 | 3300027879 | Soil | EAVDFLVAALESGHSEVLTAYLGAMAKFHTYSFLCY |
| Ga0209415_101019602 | 3300027905 | Peatlands Soil | MKVEEIKQLTTKALDELVSALESGHSETLTAYLEAMAKF |
| Ga0209006_100034212 | 3300027908 | Forest Soil | MKLEEINLKTKEAVDFLVQSLESGQSVVLTQYLGAMAKFRNYSFLCC |
| Ga0209526_107711661 | 3300028047 | Forest Soil | MKLEEIKNKTKEATDYLVQSLEAGHSEVLTQYLGAMAKFHT |
| Ga0302221_100250314 | 3300028806 | Palsa | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLAAMAKFRNYSFLCVQ |
| Ga0302218_100037001 | 3300028863 | Palsa | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCVQ |
| Ga0246001_10074286 | 3300029889 | Peat | MKLEEVNKRTKEAVDFLVAALESGHSEVLTAYLGAMAK |
| Ga0302280_10266172 | 3300029985 | Fen | MKLDEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFR |
| Ga0311339_118888241 | 3300029999 | Palsa | MKLEEVNTRTKEAVDFLVVALESGHSEVLTTYLGAMAK |
| Ga0302274_100058151 | 3300030041 | Bog | MKLDEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKF |
| Ga0302177_100151677 | 3300030053 | Palsa | VNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAKFRNYSFLCVQ |
| Ga0302176_100222061 | 3300030057 | Palsa | RQKGKNMKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFLCVQ |
| Ga0310037_101855962 | 3300030494 | Peatlands Soil | MKLEEVNLKTKEAVDYLVQSLESGQSAVLAQYLGAMAKFRN |
| Ga0310038_100676312 | 3300030707 | Peatlands Soil | MKLEEVNTRTKEAVDFLVAELGSGHSEVLTAYLGAM |
| Ga0265461_123122822 | 3300030743 | Soil | MKLEEVNQRTKEAVGFLVAAVESGHSEVLTAYLGAMAKFHTYSFLCY |
| Ga0265762_10038021 | 3300030760 | Soil | MKLEEVNQRTKEAVDFLMAALESGHSAVLTQYLAATAKFRNYSFLCVQ |
| Ga0265763_10488972 | 3300030763 | Soil | MKIEEVNTRTKEAVDFLVAALESGRSEVLTAYLGAMAK |
| Ga0302325_104334421 | 3300031234 | Palsa | MKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGA |
| Ga0302325_120363721 | 3300031234 | Palsa | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMAKFRNYSFG |
| Ga0302324_1010831771 | 3300031236 | Palsa | MKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAKFRNYSFLCVQ |
| Ga0302324_1015954272 | 3300031236 | Palsa | MKLEEVNLKTKEAVDYLVQSLESGHSAVLTQYLGAM |
| Ga0302324_1026526301 | 3300031236 | Palsa | MKLEEVNHKTKEAVDYLVQSLESGQSAVLTQYLGA |
| Ga0302320_108311222 | 3300031524 | Bog | MKLEEVNLKTKEAVDYLVQSLESGQSAVLTQYLGAMA |
| Ga0310686_1061679542 | 3300031708 | Soil | MKLEELNTRTKEAVDFLVAALESGHSEVLTAYLGAMAKFHTYMSTG |
| Ga0310686_1094040091 | 3300031708 | Soil | EAVDFLVQSLESGQSAILTQYLGAMAKFRNYSFLCY |
| Ga0310686_1119294361 | 3300031708 | Soil | EVNHKTKEAVDYLVQSLESGQSEVLTQYLGAMAKFSNYSFLCC |
| Ga0310686_1151662041 | 3300031708 | Soil | MKLEEVNKRTKEAVDFLVAALESGHSEVLTEYLGAMAKFRNYSFLC |
| Ga0307468_1010572261 | 3300031740 | Hardwood Forest Soil | MKLEDIKSKTKDAVDYLVQSLESGHSEVLTEYLGTMPDFMPIRSAMSC |
| Ga0307478_107528931 | 3300031823 | Hardwood Forest Soil | MKLEEIKNRTKDAVDHLVQSLESGHSEVLRQYLGIMAR |
| Ga0307479_112973351 | 3300031962 | Hardwood Forest Soil | MKLEEVNTRTKEAVDFLVAALESANSEVLTAYLGAMAKFHT |
| Ga0311301_100582375 | 3300032160 | Peatlands Soil | MKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAK |
| Ga0311301_101012926 | 3300032160 | Peatlands Soil | MKLEEVNHKTKEAVDHLVQSLESGQSEVLTQYLGAM |
| Ga0311301_104195953 | 3300032160 | Peatlands Soil | MKLEEVNLKTKEAVNYLVQSLEAGQSSVLTQYLGAMAKFR |
| Ga0307471_1000682317 | 3300032180 | Hardwood Forest Soil | MKLDEVNRRTKEAVAYLVLALESGRSEVLVHYLAV |
| Ga0335082_117216401 | 3300032782 | Soil | MKLEDIKSRTKDAVDHLVQSLESGHSGVLTEYLGAMARFHT |
| Ga0335081_106771211 | 3300032892 | Soil | MKLEEVNQRTKEAVDFLVAALESGHSEVLTAYLSAMAK |
| Ga0335076_100195635 | 3300032955 | Soil | MKLEEVNQRTKEAVDFLVAALESGRSEVLTAYLSA |
| Ga0335076_117989581 | 3300032955 | Soil | MKLEDIKSKTKDAVDYLVQSLESGHSEVLTEYLGAMARFHTY |
| Ga0326727_110656251 | 3300033405 | Peat Soil | MKLEEVNLKTKEAVNYLVQSLEAGQSMVLTQYLGAMAKFRNYSFLCC |
| ⦗Top⦘ |