


| Basic Information | |
|---|---|
| Family ID | F070312 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ELEFTDIHIGCPRQYKCVLNPNGKEPSIDKVMESLRSIAK |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.37 % |
| % of genes from short scaffolds (< 2000 bps) | 87.80 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.358 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (28.455 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.301 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.114 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.65% β-sheet: 0.00% Coil/Unstructured: 82.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF06945 | DUF1289 | 6.50 |
| PF11351 | GTA_holin_3TM | 5.69 |
| PF00271 | Helicase_C | 2.44 |
| PF08291 | Peptidase_M15_3 | 1.63 |
| PF00959 | Phage_lysozyme | 1.63 |
| PF01476 | LysM | 1.63 |
| PF11753 | DUF3310 | 0.81 |
| PF00166 | Cpn10 | 0.81 |
| PF06067 | DUF932 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 6.50 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.36 % |
| All Organisms | root | All Organisms | 27.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10244613 | Not Available | 569 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10075723 | Not Available | 1191 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10101943 | Not Available | 1079 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10218823 | Not Available | 598 | Open in IMG/M |
| 3300001355|JGI20158J14315_10202389 | Not Available | 566 | Open in IMG/M |
| 3300001450|JGI24006J15134_10007344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 5584 | Open in IMG/M |
| 3300001450|JGI24006J15134_10140601 | Not Available | 805 | Open in IMG/M |
| 3300001460|JGI24003J15210_10154196 | Not Available | 584 | Open in IMG/M |
| 3300001460|JGI24003J15210_10157552 | Not Available | 573 | Open in IMG/M |
| 3300001472|JGI24004J15324_10116854 | Not Available | 660 | Open in IMG/M |
| 3300001589|JGI24005J15628_10035263 | All Organisms → Viruses → Predicted Viral | 2049 | Open in IMG/M |
| 3300001718|JGI24523J20078_1020664 | Not Available | 805 | Open in IMG/M |
| 3300001718|JGI24523J20078_1027369 | Not Available | 664 | Open in IMG/M |
| 3300004448|Ga0065861_1169379 | Not Available | 896 | Open in IMG/M |
| 3300004457|Ga0066224_1060180 | Not Available | 622 | Open in IMG/M |
| 3300004461|Ga0066223_1035313 | Not Available | 554 | Open in IMG/M |
| 3300005086|Ga0072334_11317849 | Not Available | 500 | Open in IMG/M |
| 3300005837|Ga0078893_11699256 | Not Available | 579 | Open in IMG/M |
| 3300006025|Ga0075474_10125165 | All Organisms → Viruses | 818 | Open in IMG/M |
| 3300006190|Ga0075446_10116177 | Not Available | 776 | Open in IMG/M |
| 3300006193|Ga0075445_10220927 | Not Available | 656 | Open in IMG/M |
| 3300006352|Ga0075448_10105879 | Not Available | 880 | Open in IMG/M |
| 3300006735|Ga0098038_1219809 | Not Available | 608 | Open in IMG/M |
| 3300006867|Ga0075476_10254918 | Not Available | 625 | Open in IMG/M |
| 3300006868|Ga0075481_10130247 | Not Available | 923 | Open in IMG/M |
| 3300006916|Ga0070750_10349582 | Not Available | 624 | Open in IMG/M |
| 3300006916|Ga0070750_10458806 | Not Available | 526 | Open in IMG/M |
| 3300006919|Ga0070746_10116248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum → Methylocaldum szegediense | 1324 | Open in IMG/M |
| 3300006920|Ga0070748_1026937 | All Organisms → Viruses | 2377 | Open in IMG/M |
| 3300006920|Ga0070748_1217168 | Not Available | 695 | Open in IMG/M |
| 3300006929|Ga0098036_1188780 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 627 | Open in IMG/M |
| 3300007236|Ga0075463_10071710 | Not Available | 1118 | Open in IMG/M |
| 3300007345|Ga0070752_1365806 | Not Available | 539 | Open in IMG/M |
| 3300007538|Ga0099851_1020853 | Not Available | 2649 | Open in IMG/M |
| 3300007778|Ga0102954_1232441 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 548 | Open in IMG/M |
| 3300009172|Ga0114995_10132413 | Not Available | 1394 | Open in IMG/M |
| 3300009172|Ga0114995_10467431 | Not Available | 690 | Open in IMG/M |
| 3300009193|Ga0115551_1170245 | Not Available | 990 | Open in IMG/M |
| 3300009426|Ga0115547_1185720 | Not Available | 657 | Open in IMG/M |
| 3300009428|Ga0114915_1131645 | Not Available | 721 | Open in IMG/M |
| 3300009435|Ga0115546_1108034 | Not Available | 1006 | Open in IMG/M |
| 3300009472|Ga0115554_1176702 | Not Available | 874 | Open in IMG/M |
| 3300009495|Ga0115571_1265840 | Not Available | 687 | Open in IMG/M |
| 3300009512|Ga0115003_10182516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → Idiomarina abyssalis | 1265 | Open in IMG/M |
| 3300009512|Ga0115003_10459800 | Not Available | 746 | Open in IMG/M |
| 3300009526|Ga0115004_10042040 | Not Available | 2973 | Open in IMG/M |
| 3300009603|Ga0114911_1186216 | Not Available | 570 | Open in IMG/M |
| 3300009790|Ga0115012_11403816 | Not Available | 596 | Open in IMG/M |
| 3300010368|Ga0129324_10025133 | Not Available | 2902 | Open in IMG/M |
| 3300011118|Ga0114922_11564660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 530 | Open in IMG/M |
| 3300011128|Ga0151669_156143 | Not Available | 510 | Open in IMG/M |
| 3300012953|Ga0163179_10089401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 2204 | Open in IMG/M |
| 3300017706|Ga0181377_1031102 | Not Available | 1103 | Open in IMG/M |
| 3300017708|Ga0181369_1078165 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300017727|Ga0181401_1094536 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 765 | Open in IMG/M |
| 3300017730|Ga0181417_1164617 | Not Available | 534 | Open in IMG/M |
| 3300017737|Ga0187218_1035081 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1277 | Open in IMG/M |
| 3300017738|Ga0181428_1171870 | Not Available | 506 | Open in IMG/M |
| 3300017739|Ga0181433_1148162 | Not Available | 553 | Open in IMG/M |
| 3300017740|Ga0181418_1107887 | Not Available | 674 | Open in IMG/M |
| 3300017748|Ga0181393_1139474 | Not Available | 608 | Open in IMG/M |
| 3300017748|Ga0181393_1142477 | Not Available | 601 | Open in IMG/M |
| 3300017748|Ga0181393_1166036 | Not Available | 545 | Open in IMG/M |
| 3300017759|Ga0181414_1145787 | Not Available | 619 | Open in IMG/M |
| 3300017763|Ga0181410_1185117 | Not Available | 575 | Open in IMG/M |
| 3300017765|Ga0181413_1266322 | Not Available | 503 | Open in IMG/M |
| 3300017969|Ga0181585_11061017 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 514 | Open in IMG/M |
| 3300018036|Ga0181600_10341322 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300019751|Ga0194029_1092845 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 526 | Open in IMG/M |
| 3300020388|Ga0211678_10263102 | Not Available | 709 | Open in IMG/M |
| 3300020419|Ga0211512_10083361 | Not Available | 1506 | Open in IMG/M |
| 3300020438|Ga0211576_10275163 | Not Available | 880 | Open in IMG/M |
| 3300021961|Ga0222714_10545158 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300022053|Ga0212030_1020463 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 890 | Open in IMG/M |
| 3300022074|Ga0224906_1200554 | Not Available | 544 | Open in IMG/M |
| 3300022187|Ga0196899_1158944 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300022907|Ga0255775_1236562 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 673 | Open in IMG/M |
| 3300022923|Ga0255783_10074848 | Not Available | 1901 | Open in IMG/M |
| 3300025048|Ga0207905_1042091 | All Organisms → Viruses | 718 | Open in IMG/M |
| 3300025071|Ga0207896_1049702 | Not Available | 687 | Open in IMG/M |
| 3300025079|Ga0207890_1038080 | Not Available | 856 | Open in IMG/M |
| 3300025120|Ga0209535_1030075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 2579 | Open in IMG/M |
| 3300025120|Ga0209535_1141506 | Not Available | 776 | Open in IMG/M |
| 3300025127|Ga0209348_1101162 | Not Available | 895 | Open in IMG/M |
| 3300025132|Ga0209232_1021573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED275 | 2525 | Open in IMG/M |
| 3300025138|Ga0209634_1055226 | Not Available | 1937 | Open in IMG/M |
| 3300025138|Ga0209634_1059347 | Not Available | 1848 | Open in IMG/M |
| 3300025138|Ga0209634_1132212 | Not Available | 1046 | Open in IMG/M |
| 3300025543|Ga0208303_1025019 | Not Available | 1648 | Open in IMG/M |
| 3300025645|Ga0208643_1028525 | Not Available | 1868 | Open in IMG/M |
| 3300025645|Ga0208643_1144692 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 608 | Open in IMG/M |
| 3300025652|Ga0208134_1019119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2603 | Open in IMG/M |
| 3300025674|Ga0208162_1084815 | Not Available | 972 | Open in IMG/M |
| 3300025759|Ga0208899_1205134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 623 | Open in IMG/M |
| 3300025769|Ga0208767_1070598 | Not Available | 1514 | Open in IMG/M |
| 3300025806|Ga0208545_1116863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 676 | Open in IMG/M |
| 3300025870|Ga0209666_1141303 | Not Available | 1107 | Open in IMG/M |
| 3300025886|Ga0209632_10369853 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 691 | Open in IMG/M |
| 3300027522|Ga0209384_1019927 | Not Available | 2148 | Open in IMG/M |
| 3300027704|Ga0209816_1041352 | Not Available | 2166 | Open in IMG/M |
| 3300027791|Ga0209830_10241999 | Not Available | 823 | Open in IMG/M |
| 3300028194|Ga0257106_1118938 | Not Available | 944 | Open in IMG/M |
| 3300028197|Ga0257110_1186071 | Not Available | 813 | Open in IMG/M |
| 3300031519|Ga0307488_10301753 | Not Available | 1031 | Open in IMG/M |
| 3300031519|Ga0307488_10372193 | Not Available | 893 | Open in IMG/M |
| 3300031519|Ga0307488_10776305 | Not Available | 533 | Open in IMG/M |
| 3300031596|Ga0302134_10337086 | Not Available | 565 | Open in IMG/M |
| 3300031599|Ga0308007_10151568 | Not Available | 828 | Open in IMG/M |
| 3300031605|Ga0302132_10271771 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031622|Ga0302126_10202274 | Not Available | 708 | Open in IMG/M |
| 3300031626|Ga0302121_10008965 | Not Available | 3713 | Open in IMG/M |
| 3300031638|Ga0302125_10113523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300031638|Ga0302125_10258912 | Not Available | 527 | Open in IMG/M |
| 3300031696|Ga0307995_1136872 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031848|Ga0308000_10316995 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300032277|Ga0316202_10637361 | Not Available | 503 | Open in IMG/M |
| 3300032373|Ga0316204_11089720 | Not Available | 561 | Open in IMG/M |
| 3300033742|Ga0314858_111794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 696 | Open in IMG/M |
| 3300033742|Ga0314858_146994 | Not Available | 605 | Open in IMG/M |
| 3300034374|Ga0348335_097537 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 936 | Open in IMG/M |
| 3300034375|Ga0348336_028795 | Not Available | 2663 | Open in IMG/M |
| 3300034375|Ga0348336_165923 | Not Available | 635 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 28.46% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.51% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.38% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.50% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.06% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.25% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.25% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.44% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.44% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.44% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.63% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.63% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.63% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.63% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.81% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.81% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.81% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.81% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.81% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031596 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCM | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031848 | Marine microbial communities from water near the shore, Antarctic Ocean - #3 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102446133 | 3300000101 | Marine | IEFTDKSIGCPRQYQCVYNPGGSEPNIDDVMKSLRDIAK* |
| DelMOSum2011_100757234 | 3300000115 | Marine | IRVGCPKQYKCVLNPNGSEPSIDKVMESLRSIAK* |
| DelMOSpr2010_101019433 | 3300000116 | Marine | ELEFTDIHIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAK* |
| DelMOSpr2010_102188231 | 3300000116 | Marine | ELEFTDIHIGCPRKYKCKLNPNGKEPSIDQVMESLRSISK*VSV* |
| JGI20158J14315_102023892 | 3300001355 | Pelagic Marine | KTYELEFTDIQIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAK*VSV* |
| JGI24006J15134_100073441 | 3300001450 | Marine | FTDISIGCPRSYKCKLNPNGKEPNIDQVMESLRSITK* |
| JGI24006J15134_101406014 | 3300001450 | Marine | FTDLANGCPRKYQCVLDPNGKEPSIDSVMESLRSIAK* |
| JGI24003J15210_101541963 | 3300001460 | Marine | LSFQDVRIGCVKNFRCKLNPNGKEPSIDQVMESLRSIAK* |
| JGI24003J15210_101575521 | 3300001460 | Marine | YVANSGTNRKTYELEYTDIRVGCPKSYRCVYNPGDEPSIDKVMESLRGIAK* |
| JGI24004J15324_101168541 | 3300001472 | Marine | KTFTLDFTDLANGCPRKYKCVLDPNGSEPSIDSVMESLRSIAK* |
| JGI24005J15628_100352633 | 3300001589 | Marine | LSFQDMSIGCVRKFRCILNPNGKEPSIDSVMESLRSIAK* |
| JGI24523J20078_10206645 | 3300001718 | Marine | EFTDKIIGCPRQYQCIYNPGGSEPNIDDVMKSLRDIAK* |
| JGI24523J20078_10273694 | 3300001718 | Marine | TDKRIGCPRQYQCIYNPNSKEPNIDDVMKSLQDAVK* |
| Ga0065861_11693794 | 3300004448 | Marine | EIEFTDKSIGCPRKYKCVYNPNSKEPNINDVMKSLKDAVK* |
| Ga0066224_10601804 | 3300004457 | Marine | EMEFTDIRIGCPKQYRCVVNRNSKIPNIDDVMKSLRDIAK* |
| Ga0066223_10353131 | 3300004461 | Marine | EIEFTDIHIGCPRSYRCVYNPGGSEPSIDDVMKSLRDIAK* |
| Ga0072334_113178491 | 3300005086 | Water | ANNGTNRKTYELEYNDIRVGCPRSYRCKFNPGDEPSIDKVMESLRGIAK* |
| Ga0078893_116992561 | 3300005837 | Marine Surface Water | VRVGCPRQYKCVHNPNSKEPNINDVMESLRSITK* |
| Ga0075474_101251655 | 3300006025 | Aqueous | VGAQKTYELEFTDIHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK* |
| Ga0075446_101161771 | 3300006190 | Marine | TDIANGCPRKYQCVLDPNGKEPSIDSVMDSLRSIAK* |
| Ga0075445_102209273 | 3300006193 | Marine | FTDLANGCPRKYKCVLDPNGKEPSIDSVMESLRSIAQ* |
| Ga0075448_101058794 | 3300006352 | Marine | DFTDLANGCPRKYKCVLDPNGKEPSIDSVMESLRSIAK* |
| Ga0098038_12198091 | 3300006735 | Marine | QKTYELEFTDIAVGCPRKYKCKLNPNGKEPNIDQVMESLRSIAK* |
| Ga0075476_102549184 | 3300006867 | Aqueous | NKTYELEFTDIRIGCPKQYKCVFNPNGDEPSIDKVMESLRSIAK* |
| Ga0075481_101302471 | 3300006868 | Aqueous | KTYELEFTDIHIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAK* |
| Ga0070750_103495823 | 3300006916 | Aqueous | IRVGCPKQYKCALNPNGSEPSIDKVMESLRSIAK* |
| Ga0070750_104588063 | 3300006916 | Aqueous | NSGTNRKTYELEYTDIRVGCPKSYRCVYNPGDEPSIDKVMESLRGIAK* |
| Ga0070746_101162483 | 3300006919 | Aqueous | EMEFTDISIGCPRKYKCKLNPNGMEPSIDSVMESLRSIAE* |
| Ga0070748_10269371 | 3300006920 | Aqueous | TDIHVGCPRSYRCVFNPNGQEPSIDKVMESLRSIAK* |
| Ga0070748_12171684 | 3300006920 | Aqueous | GAQKTYELEFTDIHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK* |
| Ga0098036_11887801 | 3300006929 | Marine | IHIGCPRQYKCVLNPNGKEPSIDKVMESLRSIAK* |
| Ga0075463_100717105 | 3300007236 | Aqueous | IYVGAQKTYELEFTDIHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK* |
| Ga0070752_13658063 | 3300007345 | Aqueous | KTFELEFADIRVGCPKQYKCVLNPNGSEPSIDKVMESLRSIAK* |
| Ga0099851_10208539 | 3300007538 | Aqueous | YVGAQKTYELEFTDIHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK* |
| Ga0102954_12324411 | 3300007778 | Water | IYVGAQKTYELEFTDVHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK* |
| Ga0114995_101324134 | 3300009172 | Marine | FTDIHIGCPRSYRCVYNPGGSEPSIDDVMKSLRDIAK* |
| Ga0114995_104674314 | 3300009172 | Marine | FTLDFTDIANGCPRQYKCILNPNGKEPSIDSVMESLRSIAK* |
| Ga0115551_11702454 | 3300009193 | Pelagic Marine | QKTYELEFTDIHIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAK* |
| Ga0115547_11857203 | 3300009426 | Pelagic Marine | IEFTDKSIGCPRQYQCVYNPGGSEPNIDDVMESLRDIAK* |
| Ga0114915_11316451 | 3300009428 | Deep Ocean | GAQKTFTLDFTDIANGCPRKYQCVLDPNGKEPSIDSVMESLRSIAK* |
| Ga0115546_11080343 | 3300009435 | Pelagic Marine | FTDVRVGCPKQYKCLHNPNSKEPSIDKVMESLRSIAK* |
| Ga0115554_11767023 | 3300009472 | Pelagic Marine | AQKTYELEFTDIHIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAK* |
| Ga0115571_12658402 | 3300009495 | Pelagic Marine | GAQKTYELEFTDIQIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAK* |
| Ga0115003_101825161 | 3300009512 | Marine | GAQKTFTLDFTDLANGCPRKYKCVLDPNGKMPSIDSVMESLRSIAK* |
| Ga0115003_104598001 | 3300009512 | Marine | QGAQKTFTLDFTDLANGCPRKYQCVLDPNGKEPSIDSVMESLRSIAK* |
| Ga0115004_100420401 | 3300009526 | Marine | TFEIEFTDVQISCPRKYKCVYNPNGTEPNIDDVMKSLRDIAK* |
| Ga0114911_11862163 | 3300009603 | Deep Ocean | NRTFELSFQDVRIGCVKNFRCVLNPNGKEPSIDQVMESLRSIAK* |
| Ga0115012_114038161 | 3300009790 | Marine | ELEFTDIHIGCPRQYKCVLNPNGKEPSIDKVMESLRSIAK* |
| Ga0129324_100251336 | 3300010368 | Freshwater To Marine Saline Gradient | TDIHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK* |
| Ga0114922_115646601 | 3300011118 | Deep Subsurface | LEFTDIHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK* |
| Ga0151669_1561431 | 3300011128 | Marine | TDIHIGCPRKYKCVLNPNGKEPSIDKVMESLRSIAK* |
| Ga0163179_100894011 | 3300012953 | Seawater | ANKTYELEFTDVRVGCPKQYKCLHNPNSKEPSIDKVMESLRSIAK* |
| Ga0181377_10311021 | 3300017706 | Marine | VGAQRTYELEFTDIHIGCPRSYKCKLNPNGKEPSIDQVMESLRSIAK |
| Ga0181369_10781652 | 3300017708 | Marine | AQKTYELEFTDISIGCPRKYKCKLNPNGKEPNIDQVMESLRSIAD |
| Ga0181401_10945364 | 3300017727 | Seawater | DIRVGCPKQFRCQYRRLNDKEPSIDSVMESLRSIAK |
| Ga0181417_11646173 | 3300017730 | Seawater | FTDIHIGCPRKYKCKLNPNGKEPNIDQVMESLRSIAK |
| Ga0187218_10350811 | 3300017737 | Seawater | TFELSFQDVRIGCVKNFRCVLNPNGKEPSIDQVMESLRSIAK |
| Ga0181428_11718701 | 3300017738 | Seawater | TYEMEFTDISIGCPRKYKCKLNPNGKEPSIDQVMESLRSISK |
| Ga0181433_11481622 | 3300017739 | Seawater | YIGAQKTYELEFTDIAVGCPRKYKCKLNPNGKEPNIDQVMESLRGIAK |
| Ga0181418_11078874 | 3300017740 | Seawater | ANKTYEMEFTDVRVGCPKQYKCVLNPNGKEPSIDKVMESLRSIAK |
| Ga0181393_11394741 | 3300017748 | Seawater | YQGANKTFEMEFTDIRIGCPKQYKCVLNPNGKEPSIDKVMESLRSIAK |
| Ga0181393_11424771 | 3300017748 | Seawater | KTFELSFQDMSIGCVRQFRCLLNPNGKEPSIDSVMESLRSIAK |
| Ga0181393_11660361 | 3300017748 | Seawater | TNRKTYELEYTDIRVGCPKSYFCEYNPGDEPSIDKVMESLRGIAK |
| Ga0181414_11457874 | 3300017759 | Seawater | ANKTFEMEFTDIRIGCPKQYKCVLNPNGKEPSIDKVMESLRSIAK |
| Ga0181410_11837221 | 3300017763 | Seawater | CVYVANNGTNRKTYELEYNDIRVGCPRSYRCKFNPGDEPSIDKVMESLRGIAK |
| Ga0181410_11851171 | 3300017763 | Seawater | EGAGKTFEIEFTDKIIGCPRQYQCVYNPGGTEPSIDQVMESLRSIAK |
| Ga0181413_12663221 | 3300017765 | Seawater | AQKTYELEFTDIHIGCPRKYKCKLNPNGKEPSIDQVMESLRSISK |
| Ga0181585_110610171 | 3300017969 | Salt Marsh | FTDVHVGCPRNYQCVFNPNGQEPSINKVMESLRSIAK |
| Ga0181600_103413222 | 3300018036 | Salt Marsh | FTDIRVGCPKSYRCVLNPNGKEPSISDVMDSLRSIKGE |
| Ga0194029_10928451 | 3300019751 | Freshwater | AQRTYELEFTDIHVGCPRSYRCVFNPNGQEPSIDKVMESLRSIAK |
| Ga0211678_102631021 | 3300020388 | Marine | RTYELEFTDIHIGCPRSYKCKLNPNGKEPSIDQVMESLRSIAK |
| Ga0211512_100833616 | 3300020419 | Marine | NRTFELSFQDIRVGCVKNFQCVLNPNGKEPNIDDVMESLRSIAK |
| Ga0211576_102751633 | 3300020438 | Marine | EIEFTDKSIGCPRQYQCVYNPGGSEPNIDDVMESLRDIAK |
| Ga0222714_105451581 | 3300021961 | Estuarine Water | TDIRVGCPKSYRCVLNPNGKEPSISDVMDSLRSIKGD |
| Ga0212030_10204635 | 3300022053 | Aqueous | AQKTYELEFTDIHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK |
| Ga0224906_12005542 | 3300022074 | Seawater | IYIGAQKTYELEFTDISIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAK |
| Ga0196899_11589441 | 3300022187 | Aqueous | VYRGANKTYEMEFTDIRVGCPKSYRCVLNPNGKEPSIDDIMDSLRSIKGD |
| Ga0255775_12365624 | 3300022907 | Salt Marsh | GANKTYEMEFADIRVGCPKQYQCVFNPNGNEPSIDKVMESLRSIAK |
| Ga0255783_100748488 | 3300022923 | Salt Marsh | ADIRVGCPKQYQCVFNPNGNEPSIDKVMESLRSIAK |
| Ga0207905_10420913 | 3300025048 | Marine | AGRTFEIEFTDKRIGCPRQYQCIYNPNGKEPNIDDVMKSLQDAVK |
| Ga0207896_10497021 | 3300025071 | Marine | EFTDKIIGCPRQYQCIYNPGGSEPNIDDVMKSLRDIAK |
| Ga0207890_10380801 | 3300025079 | Marine | FTDKRIGCPRQYQCIYNPNSKEPNIDDVMKSLQDAVK |
| Ga0209535_10300757 | 3300025120 | Marine | GANKTFELSFQDMSIGCVRKFRCVLNPNGSEPSIDSVMESLRSIAK |
| Ga0209535_11415061 | 3300025120 | Marine | RTFEIEFTDKRIGCPRQYQCIYNPNSKEPNIDDVMKSLQDAVK |
| Ga0209348_11011623 | 3300025127 | Marine | ELEFADVRVGCPRQYKCIHNPNSKEPNINDVMESLRSITK |
| Ga0209232_10215734 | 3300025132 | Marine | KTFEIEFTDKITGCPRQYQCVYNPGGTEPSIDQVMESLRSIAK |
| Ga0209634_10552261 | 3300025138 | Marine | ADIRVGCPKQFRCEYSKLNSKEPSIDQVMESLRSIAK |
| Ga0209634_10593477 | 3300025138 | Marine | DMSIGCVRKFRCVLNPNGKEPSIENVMESLRSIAK |
| Ga0209634_11322121 | 3300025138 | Marine | YVANSGTNRKTYELEYTDIRVGCPRSYLCRYNPGDPPSIDKVMESLRGIAK |
| Ga0208303_10250191 | 3300025543 | Aqueous | QKTYELEFTDIHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK |
| Ga0208643_10285251 | 3300025645 | Aqueous | KTYELEFTDIHIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAK |
| Ga0208643_11446921 | 3300025645 | Aqueous | TDIHVGCPRSYRCVFNPNGQEPSIDKVMESLRSIAK |
| Ga0208134_10191191 | 3300025652 | Aqueous | ELEFTDIHVGCPRSYRCVFNPNGQEPSIDKVMESLRSIAK |
| Ga0208162_10848154 | 3300025674 | Aqueous | IYVGAQKTYELEFTDIHIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAK |
| Ga0208899_12051344 | 3300025759 | Aqueous | VGAQKTYELEFTDIHVGCPRNYQCVFNPNGQEPSIDKVMESLRSIAK |
| Ga0208767_10705981 | 3300025769 | Aqueous | KTYELEFTDIAIGCPRKYKCKLNPNGKEPNIDQVMESLRGIAK |
| Ga0208545_11168631 | 3300025806 | Aqueous | GANKTYEMEFTDIRIGCPKSYKCVSNPNSSEPSIDDVLKSLRDIAK |
| Ga0209666_11413034 | 3300025870 | Marine | ELEFTDIHIGCPRKYKCKLNPNGSEPSIDSVMESLRSIAK |
| Ga0209632_103698531 | 3300025886 | Pelagic Marine | RKTYELEYNDIRVGCPRSYRCKFNPGDEPSIDKVMESLRGIAK |
| Ga0209384_10199271 | 3300027522 | Marine | AQKTFTLDFTDLANGCPRKYKCVLDPNGKEPSIDSVMESLRSIAK |
| Ga0209816_10413526 | 3300027704 | Marine | LDFTDLANGCPRKYKCVLDPNGKEPSIDSVMESLRSIAQ |
| Ga0209830_102419994 | 3300027791 | Marine | EFTDVQIGCPRKYKCVYNPNSKEPNINDVMKSLKDAVK |
| Ga0257106_11189383 | 3300028194 | Marine | GRTFEIEFTDKIIGCPRQYQCIYNPGGSEPNIDDVMKSLRDIAK |
| Ga0257110_11860714 | 3300028197 | Marine | TFEIEFTDKIIGCPRQYQCIYNPGGSEPNIDDVMKSLRDIAK |
| Ga0307488_103017535 | 3300031519 | Sackhole Brine | DIANGCPRKYKCVLDPNGKEPSIDSVMESLRSIAK |
| Ga0307488_103721931 | 3300031519 | Sackhole Brine | QKTFTLDFTDIANGCPRQYKCILNPNGKEPSIDSVMESLRSIAK |
| Ga0307488_107763052 | 3300031519 | Sackhole Brine | YQGAQKTFTLDFTDLANGCPRKYKCVLDPNGSEPSIDSVMESLRSIAK |
| Ga0302134_103370861 | 3300031596 | Marine | EVQTSCPRKYKCVYNPNGTEPNIDDVMKSLRDIAK |
| Ga0308007_101515684 | 3300031599 | Marine | QKTYELEFADIRVGCPKQYRCVVNKNSKIPSIDSVMESLRSIAK |
| Ga0302132_102717713 | 3300031605 | Marine | QGANKTYEMEFTDIRLGCPKQYKCLHNPNSKEPSIDDVMDSLRSIAK |
| Ga0302126_102022741 | 3300031622 | Marine | QGAQKTFTLDFTDIANGCPRQYKCVLNPNGKEPSIDSVMESLRSIAK |
| Ga0302121_100089651 | 3300031626 | Marine | IGCPRKYKCVYNPNSKEPSIDDVMKSLRDIAKXVAV |
| Ga0302125_101135231 | 3300031638 | Marine | DVQIGCPRKYKCIYNPNSKEPSIDDVMKSLREIAK |
| Ga0302125_102589122 | 3300031638 | Marine | KTFEMEFTDVQIGCPRKYKCVYNPNSKEPSIDDVMKSLRDIAKXVLV |
| Ga0307995_11368723 | 3300031696 | Marine | GANKTYEMEFTDIRIGCPKQYKCIHNPNSKEPSIDDVMDSLRSIAK |
| Ga0308000_103169951 | 3300031848 | Marine | EMEFTDIRIGCPKQYKCIHNPNSKEPSIDDVMDSLRSIAK |
| Ga0316202_106373611 | 3300032277 | Microbial Mat | YIGAQKTYEMEFTDISIGCPRKYKCKLNPNGKEPSIDQVMESLRSIAE |
| Ga0316204_110897203 | 3300032373 | Microbial Mat | KTFELEFADIRVGCPKQYKCVLNPNGFEPSIDKVMESLRSIAK |
| Ga0314858_111794_555_695 | 3300033742 | Sea-Ice Brine | GANKTFELSFQDMSIGCVRKFRCILNPNGKEPSIDSVMESLRSIAK |
| Ga0314858_146994_3_116 | 3300033742 | Sea-Ice Brine | FTDLANGCPRKYQCVLDPNGKEPSIDSVMDSLRSIAK |
| Ga0348335_097537_810_935 | 3300034374 | Aqueous | FELSFQDVRIGCVKNFKCELNPNGSEPSIDKVMESLRSIAK |
| Ga0348336_028795_2535_2654 | 3300034375 | Aqueous | MESTDISIGCPRKYKCKLNPNGKEPNIDQVMESLRSIAK |
| Ga0348336_165923_518_634 | 3300034375 | Aqueous | SFQDVRIGCVKNFKCELNPNGSEPSIDKVMESLRSIAK |
| ⦗Top⦘ |