


| Basic Information | |
|---|---|
| Family ID | F070305 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 45 residues |
| Representative Sequence | FLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.64 % |
| % of genes near scaffold ends (potentially truncated) | 97.56 % |
| % of genes from short scaffolds (< 2000 bps) | 90.24 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (39.024 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (26.829 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.488 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.870 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.06% β-sheet: 0.00% Coil/Unstructured: 81.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00085 | Thioredoxin | 34.96 |
| PF00574 | CLP_protease | 14.63 |
| PF00011 | HSP20 | 8.94 |
| PF07432 | Hc1 | 2.44 |
| PF04055 | Radical_SAM | 0.81 |
| PF02086 | MethyltransfD12 | 0.81 |
| PF01467 | CTP_transf_like | 0.81 |
| PF03332 | PMM | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 29.27 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 29.27 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 14.63 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 8.94 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.81 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.81 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.67 % |
| Unclassified | root | N/A | 20.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10054195 | All Organisms → Viruses → Predicted Viral | 1741 | Open in IMG/M |
| 3300000973|BBAY93_10037706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 1273 | Open in IMG/M |
| 3300003478|JGI26238J51125_1068449 | Not Available | 698 | Open in IMG/M |
| 3300005430|Ga0066849_10413884 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 507 | Open in IMG/M |
| 3300006025|Ga0075474_10147337 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 740 | Open in IMG/M |
| 3300006027|Ga0075462_10026565 | All Organisms → Viruses → Predicted Viral | 1869 | Open in IMG/M |
| 3300006027|Ga0075462_10048088 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| 3300006191|Ga0075447_10310422 | Not Available | 507 | Open in IMG/M |
| 3300006403|Ga0075514_1176108 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300006404|Ga0075515_10119388 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 715 | Open in IMG/M |
| 3300006425|Ga0075486_1017380 | Not Available | 656 | Open in IMG/M |
| 3300006637|Ga0075461_10032088 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
| 3300006637|Ga0075461_10161313 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 683 | Open in IMG/M |
| 3300006735|Ga0098038_1168728 | Not Available | 721 | Open in IMG/M |
| 3300006749|Ga0098042_1158235 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 553 | Open in IMG/M |
| 3300006751|Ga0098040_1031790 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
| 3300006793|Ga0098055_1349932 | Not Available | 549 | Open in IMG/M |
| 3300006802|Ga0070749_10404184 | Not Available | 753 | Open in IMG/M |
| 3300006810|Ga0070754_10097618 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
| 3300006810|Ga0070754_10361231 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 641 | Open in IMG/M |
| 3300006868|Ga0075481_10167575 | Not Available | 794 | Open in IMG/M |
| 3300006868|Ga0075481_10291086 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 570 | Open in IMG/M |
| 3300006916|Ga0070750_10037408 | All Organisms → Viruses → Predicted Viral | 2393 | Open in IMG/M |
| 3300006916|Ga0070750_10278826 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 719 | Open in IMG/M |
| 3300006919|Ga0070746_10213281 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300006919|Ga0070746_10318794 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300006919|Ga0070746_10356856 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 662 | Open in IMG/M |
| 3300006921|Ga0098060_1032936 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
| 3300006924|Ga0098051_1112869 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 726 | Open in IMG/M |
| 3300006925|Ga0098050_1049187 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
| 3300006929|Ga0098036_1101533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 884 | Open in IMG/M |
| 3300007234|Ga0075460_10092062 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300007234|Ga0075460_10271326 | Not Available | 561 | Open in IMG/M |
| 3300007236|Ga0075463_10016381 | All Organisms → Viruses → Predicted Viral | 2437 | Open in IMG/M |
| 3300007345|Ga0070752_1046549 | All Organisms → Viruses → Predicted Viral | 2014 | Open in IMG/M |
| 3300007512|Ga0105016_1038371 | Not Available | 3719 | Open in IMG/M |
| 3300009001|Ga0102963_1392785 | Not Available | 544 | Open in IMG/M |
| 3300009173|Ga0114996_10969737 | Not Available | 605 | Open in IMG/M |
| 3300009409|Ga0114993_11019756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 588 | Open in IMG/M |
| 3300009420|Ga0114994_10120210 | Not Available | 1785 | Open in IMG/M |
| 3300009420|Ga0114994_10520574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 783 | Open in IMG/M |
| 3300009423|Ga0115548_1151045 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 732 | Open in IMG/M |
| 3300009425|Ga0114997_10339022 | All Organisms → cellular organisms → Archaea | 823 | Open in IMG/M |
| 3300009433|Ga0115545_1030598 | All Organisms → Viruses → Predicted Viral | 2166 | Open in IMG/M |
| 3300009508|Ga0115567_10500338 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300009508|Ga0115567_10852582 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 542 | Open in IMG/M |
| 3300009537|Ga0129283_10481705 | Not Available | 537 | Open in IMG/M |
| 3300009706|Ga0115002_10944255 | Not Available | 594 | Open in IMG/M |
| 3300010149|Ga0098049_1018205 | All Organisms → Viruses → Predicted Viral | 2328 | Open in IMG/M |
| 3300010149|Ga0098049_1243505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 547 | Open in IMG/M |
| 3300010149|Ga0098049_1268925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 517 | Open in IMG/M |
| 3300010151|Ga0098061_1308299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 544 | Open in IMG/M |
| 3300012928|Ga0163110_10554013 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 883 | Open in IMG/M |
| 3300012928|Ga0163110_10730788 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 774 | Open in IMG/M |
| 3300014959|Ga0134299_1051592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 591 | Open in IMG/M |
| 3300016735|Ga0182074_1133912 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 538 | Open in IMG/M |
| 3300016741|Ga0182079_1288152 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 503 | Open in IMG/M |
| 3300017733|Ga0181426_1042999 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 891 | Open in IMG/M |
| 3300017738|Ga0181428_1162633 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 521 | Open in IMG/M |
| 3300017755|Ga0181411_1151828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 666 | Open in IMG/M |
| 3300017757|Ga0181420_1122124 | Not Available | 791 | Open in IMG/M |
| 3300017765|Ga0181413_1047604 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
| 3300017772|Ga0181430_1173853 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300017779|Ga0181395_1044606 | All Organisms → Viruses → Predicted Viral | 1475 | Open in IMG/M |
| 3300017956|Ga0181580_10673135 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 660 | Open in IMG/M |
| 3300017967|Ga0181590_10327551 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
| 3300017986|Ga0181569_10759193 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 638 | Open in IMG/M |
| 3300018421|Ga0181592_11102555 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 506 | Open in IMG/M |
| 3300018424|Ga0181591_11194439 | Not Available | 507 | Open in IMG/M |
| 3300018426|Ga0181566_10653285 | Not Available | 727 | Open in IMG/M |
| 3300018428|Ga0181568_10837996 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 709 | Open in IMG/M |
| 3300019765|Ga0194024_1004021 | All Organisms → Viruses → Predicted Viral | 3019 | Open in IMG/M |
| 3300020175|Ga0206124_10236611 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300020352|Ga0211505_1140728 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 569 | Open in IMG/M |
| 3300020401|Ga0211617_10308536 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 657 | Open in IMG/M |
| 3300020401|Ga0211617_10311057 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 654 | Open in IMG/M |
| 3300020403|Ga0211532_10323925 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 590 | Open in IMG/M |
| 3300020411|Ga0211587_10196709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 844 | Open in IMG/M |
| 3300020437|Ga0211539_10091166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 1219 | Open in IMG/M |
| 3300020470|Ga0211543_10131141 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1266 | Open in IMG/M |
| 3300020470|Ga0211543_10398736 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 661 | Open in IMG/M |
| 3300020478|Ga0211503_10306262 | All Organisms → Viruses | 867 | Open in IMG/M |
| 3300021356|Ga0213858_10312043 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 749 | Open in IMG/M |
| 3300021379|Ga0213864_10319639 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 787 | Open in IMG/M |
| 3300021442|Ga0206685_10191229 | Not Available | 688 | Open in IMG/M |
| 3300022065|Ga0212024_1073014 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 609 | Open in IMG/M |
| 3300023108|Ga0255784_10327484 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300023178|Ga0255759_10584984 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300023178|Ga0255759_10702523 | Not Available | 558 | Open in IMG/M |
| (restricted) 3300024327|Ga0233434_1136596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 964 | Open in IMG/M |
| 3300025108|Ga0208793_1049276 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300025118|Ga0208790_1093244 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 884 | Open in IMG/M |
| 3300025132|Ga0209232_1251829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 509 | Open in IMG/M |
| 3300025138|Ga0209634_1328980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 512 | Open in IMG/M |
| 3300025610|Ga0208149_1021260 | All Organisms → Viruses → Predicted Viral | 1850 | Open in IMG/M |
| 3300025662|Ga0209664_1176441 | Not Available | 576 | Open in IMG/M |
| 3300025685|Ga0209095_1057316 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
| 3300025759|Ga0208899_1006244 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 7152 | Open in IMG/M |
| 3300025769|Ga0208767_1010718 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 5662 | Open in IMG/M |
| 3300025815|Ga0208785_1097804 | Not Available | 729 | Open in IMG/M |
| 3300025818|Ga0208542_1008104 | All Organisms → Viruses → Predicted Viral | 3767 | Open in IMG/M |
| 3300025821|Ga0209600_1169944 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300025840|Ga0208917_1043192 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1814 | Open in IMG/M |
| 3300025840|Ga0208917_1167274 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 754 | Open in IMG/M |
| 3300025881|Ga0209309_10284895 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300025889|Ga0208644_1172772 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 967 | Open in IMG/M |
| 3300026130|Ga0209961_1092619 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 523 | Open in IMG/M |
| 3300026138|Ga0209951_1009702 | All Organisms → Viruses → Predicted Viral | 2125 | Open in IMG/M |
| 3300026257|Ga0208407_1063880 | Not Available | 1210 | Open in IMG/M |
| 3300026266|Ga0208410_1085558 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 807 | Open in IMG/M |
| 3300026321|Ga0208764_10587764 | Not Available | 500 | Open in IMG/M |
| 3300027714|Ga0209815_1108244 | Not Available | 919 | Open in IMG/M |
| 3300027813|Ga0209090_10401394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 658 | Open in IMG/M |
| 3300027827|Ga0209035_10075505 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1651 | Open in IMG/M |
| 3300027827|Ga0209035_10642485 | All Organisms → cellular organisms → Archaea | 503 | Open in IMG/M |
| 3300027838|Ga0209089_10622967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 564 | Open in IMG/M |
| 3300027906|Ga0209404_10462420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 835 | Open in IMG/M |
| 3300028195|Ga0257125_1124897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 794 | Open in IMG/M |
| 3300031627|Ga0302118_10500944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 533 | Open in IMG/M |
| 3300031775|Ga0315326_10926946 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 535 | Open in IMG/M |
| 3300032136|Ga0316201_10420879 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300032820|Ga0310342_100398480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 1500 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 26.83% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.20% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.76% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.94% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.69% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.69% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.63% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.63% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.63% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.63% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.81% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.81% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.81% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.81% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006404 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007512 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009537 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2W | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300014959 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubation | Environmental | Open in IMG/M |
| 3300016735 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016741 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300024327 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MG | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025662 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025821 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026130 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026266 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028195 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_200 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100541955 | 3300000117 | Marine | FLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS* |
| BBAY93_100377061 | 3300000973 | Macroalgal Surface | SYLVECDSVSVAEAKVNEFVKDSPFIFETILVKQSKIVDVIE* |
| JGI26238J51125_10684491 | 3300003478 | Marine | TKNGVREKKTRRAFLVECDSVSVAESKVNGLLKDSPYPFEVKVAKESKIVEVIDA* |
| Ga0066849_104138843 | 3300005430 | Marine | VECDSVSVAEAKVNEHLKDSPYSFETKVVKESKIVGVIDA* |
| Ga0075474_101473374 | 3300006025 | Aqueous | KKLRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS* |
| Ga0075462_100265651 | 3300006027 | Aqueous | KKIRKSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS* |
| Ga0075462_100480886 | 3300006027 | Aqueous | RRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDIRDKKWG* |
| Ga0075447_103104221 | 3300006191 | Marine | CDSVTVAEAKINEYLKDSHFPFETKVVKESKIVGVI* |
| Ga0075514_11761081 | 3300006403 | Aqueous | EKKLRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN* |
| Ga0075515_101193881 | 3300006404 | Aqueous | REKKLRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS* |
| Ga0075486_10173803 | 3300006425 | Aqueous | RSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN* |
| Ga0075461_100320885 | 3300006637 | Aqueous | LVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN* |
| Ga0075461_101613133 | 3300006637 | Aqueous | LRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS* |
| Ga0098038_11687284 | 3300006735 | Marine | GFREKKIRKSFLVECMSVSVAEAKVNEFLKDSPSTFEVKLVKESKIVGVIENGS* |
| Ga0098042_11582351 | 3300006749 | Marine | DSVSVAEAKVNETLKDSPYPFEVKVAKESKIVEVI* |
| Ga0098040_10317901 | 3300006751 | Marine | CDSVSVAEAKVNELLKDSPYPFEVKVAKESKIVEVIDA* |
| Ga0098055_13499323 | 3300006793 | Marine | SVAEAKVNEFLKDSPSTFEVKLVKESKIVGVIENGS* |
| Ga0070749_104041841 | 3300006802 | Aqueous | RSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENE* |
| Ga0070754_100976183 | 3300006810 | Aqueous | MSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN* |
| Ga0070754_103612311 | 3300006810 | Aqueous | SFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS* |
| Ga0075481_101675751 | 3300006868 | Aqueous | LVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDIRDKKWG* |
| Ga0075481_102910863 | 3300006868 | Aqueous | ECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS* |
| Ga0070750_100374088 | 3300006916 | Aqueous | FLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDIRDKKWG* |
| Ga0070750_102788261 | 3300006916 | Aqueous | AEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN* |
| Ga0070746_102132814 | 3300006919 | Aqueous | CDSVSVAEAKVNEFLKDSPYAFEVKLAKESKIVGVIENG* |
| Ga0070746_103187944 | 3300006919 | Aqueous | LVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDGN* |
| Ga0070746_103568563 | 3300006919 | Aqueous | VSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN* |
| Ga0098060_10329361 | 3300006921 | Marine | NGFREKKIRKSFLVECMSVSVAEAKVNEFLKDSPSTFEVKLVKESKIVGVIENGKNK* |
| Ga0098051_11128693 | 3300006924 | Marine | SVSVAEAKVNETLKDSPYPFEVKVAKESKIVEVID* |
| Ga0098050_10491871 | 3300006925 | Marine | EKKIRKSFLVECMSVSVAEAKVNEFLKDSPSTFEVKLVKESKIVGVIENGS* |
| Ga0098036_11015331 | 3300006929 | Marine | VAESKVNEWVKDSPFVFETILVKQSKIVDVILDED* |
| Ga0075460_100920621 | 3300007234 | Aqueous | KKLRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDIRDKKWG* |
| Ga0075460_102713261 | 3300007234 | Aqueous | MSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENE* |
| Ga0075463_100163818 | 3300007236 | Aqueous | LRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDIRDKKWG* |
| Ga0070752_10465495 | 3300007345 | Aqueous | FLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN* |
| Ga0105016_103837110 | 3300007512 | Marine | TRRAFLVECDSVSVAEAKVNEVLKDSPYPFEVKVAKESKIVEVIDA* |
| Ga0102963_13927851 | 3300009001 | Pond Water | KSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDGN* |
| Ga0114996_103145274 | 3300009173 | Marine | NGTREKKVRRHYLVECDSVTVAETKVNEHLKDSPYPFEVKVAKASKIVGVV* |
| Ga0114996_109697371 | 3300009173 | Marine | LVMNCDTVSVAEAKIYEHIKDSAYPFEVKLAKESKIVGVVS* |
| Ga0114993_110197561 | 3300009409 | Marine | YLVECDSVSVAEAKVTEFLKDSAFFFEVKVAKESKIVDVVEAS* |
| Ga0114994_101202104 | 3300009420 | Marine | VSVAEARVTEFLKDSAFFFEVKVAKESKIVDVVEAP* |
| Ga0114994_105205741 | 3300009420 | Marine | YLVECDSVSVAEARVTEFLKDSAFFFEVKVAKESKIVDVVEAP* |
| Ga0115548_11510452 | 3300009423 | Pelagic Marine | MSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDGN* |
| Ga0114997_103390221 | 3300009425 | Marine | KNGVKEKKIRKNYLVQCDSVTVAEAKINEYLKDSHFPFETKVVKESKIVGVV* |
| Ga0115545_10305985 | 3300009433 | Pelagic Marine | SVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN* |
| Ga0115567_105003381 | 3300009508 | Pelagic Marine | FLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDGN* |
| Ga0115567_108525823 | 3300009508 | Pelagic Marine | VECVSVSIAETKVNEFLKDSPFEFEVKLAKESKIVGVIENG* |
| Ga0129283_104817053 | 3300009537 | Beach Aquifer Porewater | SVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENE* |
| Ga0115002_109442551 | 3300009706 | Marine | VSVAETKMNEHLKDSPYVFEVKVVKESRILEVVG* |
| Ga0098049_10182057 | 3300010149 | Marine | ECMSVSVAEAKVNEFLKDSPSTFEVKLVKESKIVGVIENGKNK* |
| Ga0098049_12435051 | 3300010149 | Marine | REKKTRRAFLVECDSVSVAEAKVNEDLKDSPYPFEVKVAKESKIVGVI* |
| Ga0098049_12689252 | 3300010149 | Marine | RKTYLVECDSVSVAESKVNEWLKTSPFAFETIIAKQSKIVDVVE* |
| Ga0098061_13082991 | 3300010151 | Marine | SVSVAEAKVNEWLKDSPFVFETIIAKQSKIVDVVE* |
| Ga0163110_105540131 | 3300012928 | Surface Seawater | DSVSVAEAKVNEVLKDSPYSFEVKVVKESKIVEVI* |
| Ga0163110_107307881 | 3300012928 | Surface Seawater | VECDSVSVAEAKVNEVLKDSPYSFEVKVVKESKIVEVI* |
| Ga0134299_10515922 | 3300014959 | Marine | ECDAVSVAEAKVLEYLKDAAFTYNVVVVKESKIVEVIELETKL* |
| Ga0182074_11339123 | 3300016735 | Salt Marsh | KIRKSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Ga0182079_12881523 | 3300016741 | Salt Marsh | VECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Ga0181426_10429991 | 3300017733 | Seawater | TKNGFREKKIRKSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLAKESKIVGVIDNGXSKI |
| Ga0181428_11626334 | 3300017738 | Seawater | FLVECDSVSVGEAKVNEVLKDSPYVFEVKVVKESKIVEVI |
| Ga0181411_11518282 | 3300017755 | Seawater | VSVAEARVTEFLKDSAFFFEVKVAKESKIVDVVEAS |
| Ga0181420_11221241 | 3300017757 | Seawater | DSVTVAEAKVNEYLKDSHYPFETKVVKASKIVGVIN |
| Ga0181413_10476041 | 3300017765 | Seawater | REKKVRRHYLVECDSVTVGEAKVNEHLKDSPYPFETKVVKASKIIEVIN |
| Ga0181430_11738531 | 3300017772 | Seawater | VSVAEAKVNEFLKDSPNTFEVKLVKESKIVGVIEDGN |
| Ga0181395_10446061 | 3300017779 | Seawater | TKNGTREKKVRRHYLVECDSVTVAEAKVNEYLKDSHYPFETKVVKASKIVGVIN |
| Ga0181580_106731354 | 3300017956 | Salt Marsh | TRRSFLVECDSVSVAEAKVNEVLKDSPYAFEVKVVKESKIVEVI |
| Ga0181590_103275515 | 3300017967 | Salt Marsh | FLVECDSVSVAEAKVNEVLKDSPYAFEVKVVKESKIVEVI |
| Ga0181569_107591934 | 3300017986 | Salt Marsh | GVREKRTRRSFLVECDSVSVAEAKVNEVLKDSPYAFEVKVVKESKIVEVIE |
| Ga0181592_111025553 | 3300018421 | Salt Marsh | CDSVSVAEAKVNEVLRDSPYAFEVKVVRESKIVEVI |
| Ga0181591_111944393 | 3300018424 | Salt Marsh | EKKIRKSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN |
| Ga0181566_106532851 | 3300018426 | Salt Marsh | SVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN |
| Ga0181568_108379961 | 3300018428 | Salt Marsh | REKKIRKSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Ga0194024_10040211 | 3300019765 | Freshwater | EKKLRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN |
| Ga0206124_102366113 | 3300020175 | Seawater | KKIRKSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDGN |
| Ga0211505_11407281 | 3300020352 | Marine | AFLVECDSVSVAEAKVNEMLKDSPYSFEVKVVKESKIVEVI |
| Ga0211617_103085361 | 3300020401 | Marine | REKKTRRSFLVECDSVSVAEAKINEMLKDSPYSFEVKVVKESKIVEVI |
| Ga0211617_103110571 | 3300020401 | Marine | REKKTRRSFLVECDSVSVAEAKVNEVLKDSPYTFECKVVKESKIVEVI |
| Ga0211532_103239254 | 3300020403 | Marine | KTRRSFLVECDSVSVAEAKVNEVLKDSPYTFECKVVKESKIVEVI |
| Ga0211587_101967093 | 3300020411 | Marine | ECDSVSVAEAKVNEFLKDSAFFFEVKVAKESKIVDVIGLEHE |
| Ga0211539_100911664 | 3300020437 | Marine | SVTVAEAKVNEFVKDSPFVFETILVKQSKIVDVIE |
| Ga0211543_101311414 | 3300020470 | Marine | FLVECDSVSVAEAKVNEVLKDSPYSFEVKVVKESKIVEVI |
| Ga0211543_103987364 | 3300020470 | Marine | EKKTRRSFLVECDSVSVAEAKVNEVLKDSPYTFECKVVKESKIVEVI |
| Ga0211503_103062623 | 3300020478 | Marine | VECDSVSVAEAKVNEWLKTSPFAFETIIAKQSKIVDVVE |
| Ga0213858_103120434 | 3300021356 | Seawater | CKMFLVECDSVSVAEAKVNDFLKDSPYAFEVKLAKESKIVGVIENGS |
| Ga0213864_103196394 | 3300021379 | Seawater | ECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Ga0206685_101912291 | 3300021442 | Seawater | EKKTRRAFLVECDSVSVAEAKVNELLKDSPYPFEVKVAKESKIVEVIDA |
| Ga0212024_10730141 | 3300022065 | Aqueous | FREKKIRKSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Ga0255784_103274843 | 3300023108 | Salt Marsh | REKKNRKMFLVECDSVSVAEAKVNEFLKDSPYAFEVKLAKESKIVGVIENG |
| Ga0255759_105849841 | 3300023178 | Salt Marsh | RKMFLVECDSVSVAEAKVNEFLKDSPYAFEVKLAKESKIVGVIENG |
| Ga0255759_107025231 | 3300023178 | Salt Marsh | MSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN |
| (restricted) Ga0233434_11365963 | 3300024327 | Seawater | ECDSVSVAEAKVTEFLKDSAFFFEVKVAKESKIVDVVEAS |
| Ga0208793_10492764 | 3300025108 | Marine | TKNGIKEKKTRRQFLVECDSVSVAEAKVNEHLKDSPYSFETKVVKESKIVGVIDA |
| Ga0208790_10932443 | 3300025118 | Marine | PTKNGIKEKKTRRQFLVECDSVSVAEAKVNEHLKDSPYSFETKVVKESKIVGVIDA |
| Ga0209232_12518291 | 3300025132 | Marine | VECDSVSVAEAKVNDWVKSSPFVFETILVKQSKIVDVILDEV |
| Ga0209634_13289801 | 3300025138 | Marine | ECDAVSVAEAKVLEYLKDAAFTYNVVVVKESKIVEVIELETKL |
| Ga0208149_10212601 | 3300025610 | Aqueous | LVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Ga0209664_11764411 | 3300025662 | Marine | ECDSVSVAEAKVNETLKDSPYPFEVKVAKESKIVEVI |
| Ga0209095_10573165 | 3300025685 | Pelagic Marine | EKKSRKTFLVECVSVSIAETKVNEFLKDSPFEFEVKLAKESKIVGVIENG |
| Ga0208899_10062441 | 3300025759 | Aqueous | CMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDIRDKKWG |
| Ga0208767_10107181 | 3300025769 | Aqueous | EKKLRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDIRDKKWG |
| Ga0208785_10978041 | 3300025815 | Aqueous | KKLRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGN |
| Ga0208542_10081049 | 3300025818 | Aqueous | LRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Ga0209600_11699441 | 3300025821 | Pelagic Marine | VSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDGN |
| Ga0208917_10431925 | 3300025840 | Aqueous | KMFLVECDSVSVAEAKVNEFLKDSPYAFEVKLAKESKIVGVIENGS |
| Ga0208917_11672744 | 3300025840 | Aqueous | REKKLRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Ga0209309_102848954 | 3300025881 | Pelagic Marine | IRKSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIEDGN |
| Ga0208644_11727721 | 3300025889 | Aqueous | VACDSVSVAEAKVNEMLKDSPYAFEVKVVRESKIVEVI |
| Ga0209961_10926193 | 3300026130 | Water | TKNGVREKKTRRAFLVECDSVSVAEAKVNEVLKDSPFTFEVKVVKESKIVEVI |
| Ga0209951_10097021 | 3300026138 | Pond Water | VSIAETKVNEFLKDSPFEFEVKLAKESKIVGVIEND |
| Ga0208407_10638801 | 3300026257 | Marine | RSFLVECDSVSVAEAKVNEVLKDSPYPFEVKVAKESKIVEVIDA |
| Ga0208410_10855584 | 3300026266 | Marine | KNGIKEKKTRRNFLVECDSVSVAEAKVNEHLKDSPYSFETKVVKESKIVGVIE |
| Ga0208764_105877641 | 3300026321 | Marine | NGVKEKKIRRNYLVTECDTVSVAEAKIHEYLKDSAYPFEVTIAKESKIVGVV |
| Ga0209815_11082443 | 3300027714 | Marine | LRECDSVTVAETKVNEHLKDSPYPFEVKVAKASKIIGVISQ |
| Ga0209090_104013942 | 3300027813 | Marine | SVAEARVTEFLKDSAFFFEVKVAKESKIVDVVEAP |
| Ga0209035_100755056 | 3300027827 | Marine | TKNGIKEKKIRKNYLVECDSVTVAEAKINEHLKDSHFPFETKVVKESKIVGVI |
| Ga0209035_106424853 | 3300027827 | Marine | QTKNGVKEKKIRKNYLVECDSVTVAEAKINEHLKDSHFPFETKVVKESKIVGVI |
| Ga0209089_106229671 | 3300027838 | Marine | SVAEAKVTEFLKDSAFFFEVKVAKESKIVDVVEAS |
| Ga0209404_104624203 | 3300027906 | Marine | GTREKKIRRHYLVECDSVTVAEAKVNEYLKDSHYPFETKVAKASKIEGVIN |
| Ga0257125_11248972 | 3300028195 | Marine | DTKNGVKEKKVRRNYLIECDSVSVAEAKVTEFLKDSAFFFEVKVAKESKIVDVVEAS |
| Ga0302118_105009441 | 3300031627 | Marine | RNYLVTKCDTVSVAEAKIYEHLKDSAYPFEVKVAKESKIVGVV |
| Ga0315326_109269461 | 3300031775 | Seawater | VSVAEAKVNELLKDSPYPFEVKVAKESKIVEVIDA |
| Ga0316201_104208791 | 3300032136 | Worm Burrow | FREKKLRRSFLVECMSVSVAEAKVNEFLKDSPNEFEVKLVKESKIVGVIENGS |
| Ga0310342_1003984801 | 3300032820 | Seawater | VRKSYLVEFDSVSVAESKVNDWLKDSPFVFETIIAKQSKIVDVVE |
| ⦗Top⦘ |