


| Basic Information | |
|---|---|
| Family ID | F070251 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MSAPGRPKRELLPLGGKARSAKGADSSAPGRPKRELLPLGGTARSAKGAP |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.29 % |
| % of genes near scaffold ends (potentially truncated) | 47.97 % |
| % of genes from short scaffolds (< 2000 bps) | 60.16 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.415 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (13.821 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.341 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.089 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF02910 | Succ_DH_flav_C | 3.25 |
| PF00005 | ABC_tran | 2.44 |
| PF01040 | UbiA | 2.44 |
| PF08352 | oligo_HPY | 2.44 |
| PF03167 | UDG | 2.44 |
| PF00528 | BPD_transp_1 | 2.44 |
| PF00873 | ACR_tran | 1.63 |
| PF00850 | Hist_deacetyl | 1.63 |
| PF04909 | Amidohydro_2 | 1.63 |
| PF08241 | Methyltransf_11 | 1.63 |
| PF13193 | AMP-binding_C | 1.63 |
| PF08282 | Hydrolase_3 | 1.63 |
| PF13183 | Fer4_8 | 1.63 |
| PF12399 | BCA_ABC_TP_C | 1.63 |
| PF00253 | Ribosomal_S14 | 1.63 |
| PF02405 | MlaE | 1.63 |
| PF04442 | CtaG_Cox11 | 1.63 |
| PF01568 | Molydop_binding | 1.63 |
| PF02769 | AIRS_C | 1.63 |
| PF00582 | Usp | 0.81 |
| PF01493 | GXGXG | 0.81 |
| PF05683 | Fumerase_C | 0.81 |
| PF00155 | Aminotran_1_2 | 0.81 |
| PF03480 | DctP | 0.81 |
| PF00137 | ATP-synt_C | 0.81 |
| PF02091 | tRNA-synt_2e | 0.81 |
| PF01850 | PIN | 0.81 |
| PF02272 | DHHA1 | 0.81 |
| PF02803 | Thiolase_C | 0.81 |
| PF01202 | SKI | 0.81 |
| PF13416 | SBP_bac_8 | 0.81 |
| PF03740 | PdxJ | 0.81 |
| PF11306 | DUF3108 | 0.81 |
| PF01553 | Acyltransferase | 0.81 |
| PF01266 | DAO | 0.81 |
| PF13437 | HlyD_3 | 0.81 |
| PF11612 | T2SSJ | 0.81 |
| PF03186 | CobD_Cbib | 0.81 |
| PF00561 | Abhydrolase_1 | 0.81 |
| PF00497 | SBP_bac_3 | 0.81 |
| PF08223 | PaaX_C | 0.81 |
| PF13085 | Fer2_3 | 0.81 |
| PF00571 | CBS | 0.81 |
| PF01180 | DHO_dh | 0.81 |
| PF11249 | DUF3047 | 0.81 |
| PF00890 | FAD_binding_2 | 0.81 |
| PF05987 | DUF898 | 0.81 |
| PF02600 | DsbB | 0.81 |
| PF01032 | FecCD | 0.81 |
| PF07021 | MetW | 0.81 |
| PF07311 | Dodecin | 0.81 |
| PF03900 | Porphobil_deamC | 0.81 |
| PF14711 | Nitr_red_bet_C | 0.81 |
| PF02653 | BPD_transp_2 | 0.81 |
| PF00206 | Lyase_1 | 0.81 |
| PF01264 | Chorismate_synt | 0.81 |
| PF13614 | AAA_31 | 0.81 |
| PF13692 | Glyco_trans_1_4 | 0.81 |
| PF00672 | HAMP | 0.81 |
| PF08279 | HTH_11 | 0.81 |
| PF17147 | PFOR_II | 0.81 |
| PF12911 | OppC_N | 0.81 |
| PF00639 | Rotamase | 0.81 |
| PF07690 | MFS_1 | 0.81 |
| PF02874 | ATP-synt_ab_N | 0.81 |
| PF00346 | Complex1_49kDa | 0.81 |
| PF01863 | YgjP-like | 0.81 |
| PF01380 | SIS | 0.81 |
| PF06835 | LptC | 0.81 |
| PF01464 | SLT | 0.81 |
| PF00496 | SBP_bac_5 | 0.81 |
| PF05138 | PaaA_PaaC | 0.81 |
| PF13180 | PDZ_2 | 0.81 |
| PF00828 | Ribosomal_L27A | 0.81 |
| PF02237 | BPL_C | 0.81 |
| PF07943 | PBP5_C | 0.81 |
| PF08402 | TOBE_2 | 0.81 |
| PF04362 | Iron_traffic | 0.81 |
| PF01990 | ATP-synt_F | 0.81 |
| PF01791 | DeoC | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.25 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 2.44 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 2.44 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 2.44 |
| COG0199 | Ribosomal protein S14 | Translation, ribosomal structure and biogenesis [J] | 1.63 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 1.63 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 1.63 |
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 1.63 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.63 |
| COG2924 | Fe-S cluster biosynthesis and repair protein YggX | Posttranslational modification, protein turnover, chaperones [O] | 1.63 |
| COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 1.63 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 1.63 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.81 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.81 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.81 |
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 0.81 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.81 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.81 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.81 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.81 |
| COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0760 | Peptidyl-prolyl isomerase, parvulin family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 0.81 |
| COG1270 | Cobalamin biosynthesis protein CobD/CbiB | Coenzyme transport and metabolism [H] | 0.81 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.81 |
| COG1436 | Archaeal/vacuolar-type H+-ATPase subunit F/Vma7 | Energy production and conversion [C] | 0.81 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.81 |
| COG1495 | Disulfide bond formation protein DsbB | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1727 | Ribosomal protein L18E | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 0.81 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.81 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.81 |
| COG3327 | DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation) | Transcription [K] | 0.81 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.81 |
| COG3396 | 1,2-phenylacetyl-CoA epoxidase, catalytic subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG4269 | Uncharacterized membrane protein YjgN, DUF898 family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.41 % |
| Unclassified | root | N/A | 36.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003763|Ga0055529_1000432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → unclassified Bordetella → Bordetella sp. FB-8 | 42394 | Open in IMG/M |
| 3300005218|Ga0068996_10073205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 723 | Open in IMG/M |
| 3300005347|Ga0070668_100564653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 992 | Open in IMG/M |
| 3300005355|Ga0070671_100146443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1993 | Open in IMG/M |
| 3300005355|Ga0070671_100153681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1943 | Open in IMG/M |
| 3300005444|Ga0070694_101958604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 501 | Open in IMG/M |
| 3300005466|Ga0070685_11056569 | Not Available | 612 | Open in IMG/M |
| 3300005548|Ga0070665_100058191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3875 | Open in IMG/M |
| 3300005618|Ga0068864_100242893 | Not Available | 1669 | Open in IMG/M |
| 3300005841|Ga0068863_100080907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3077 | Open in IMG/M |
| 3300006237|Ga0097621_100113172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2295 | Open in IMG/M |
| 3300006237|Ga0097621_100179521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 1829 | Open in IMG/M |
| 3300006854|Ga0075425_100486827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1420 | Open in IMG/M |
| 3300006871|Ga0075434_102012245 | Not Available | 583 | Open in IMG/M |
| 3300007521|Ga0105044_10022761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii | 8297 | Open in IMG/M |
| 3300009091|Ga0102851_10050117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3350 | Open in IMG/M |
| 3300009091|Ga0102851_10183643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1943 | Open in IMG/M |
| 3300009091|Ga0102851_12257349 | Not Available | 620 | Open in IMG/M |
| 3300009131|Ga0115027_10197298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1278 | Open in IMG/M |
| 3300009131|Ga0115027_10256285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1151 | Open in IMG/M |
| 3300009131|Ga0115027_10695947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 762 | Open in IMG/M |
| 3300009131|Ga0115027_11906606 | Not Available | 501 | Open in IMG/M |
| 3300009177|Ga0105248_10440359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia caffeinitolerans | 1468 | Open in IMG/M |
| 3300009506|Ga0118657_12119519 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010360|Ga0126372_11057430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300010403|Ga0134123_12310645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 601 | Open in IMG/M |
| 3300013308|Ga0157375_10181735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2255 | Open in IMG/M |
| 3300014205|Ga0172380_10072831 | Not Available | 2840 | Open in IMG/M |
| 3300014325|Ga0163163_10368494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1493 | Open in IMG/M |
| 3300014326|Ga0157380_12464597 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300014880|Ga0180082_1080725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300014969|Ga0157376_10018080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5394 | Open in IMG/M |
| 3300015371|Ga0132258_10508973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3012 | Open in IMG/M |
| 3300015371|Ga0132258_10901575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2232 | Open in IMG/M |
| 3300015373|Ga0132257_101803073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 786 | Open in IMG/M |
| 3300016270|Ga0182036_10927487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300018476|Ga0190274_10055266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2900 | Open in IMG/M |
| 3300018476|Ga0190274_10142847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2004 | Open in IMG/M |
| 3300018476|Ga0190274_11847802 | Not Available | 699 | Open in IMG/M |
| 3300025272|Ga0209455_1004631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → unclassified Bordetella → Bordetella sp. FB-8 | 4441 | Open in IMG/M |
| 3300025907|Ga0207645_10760315 | Not Available | 659 | Open in IMG/M |
| 3300025907|Ga0207645_11174309 | Not Available | 516 | Open in IMG/M |
| 3300025925|Ga0207650_10247291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1443 | Open in IMG/M |
| 3300025925|Ga0207650_11643891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 545 | Open in IMG/M |
| 3300025926|Ga0207659_10324344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia caffeinitolerans | 1271 | Open in IMG/M |
| 3300025926|Ga0207659_10372857 | Not Available | 1189 | Open in IMG/M |
| 3300025926|Ga0207659_11581497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300025931|Ga0207644_10075961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sutterellaceae | 2470 | Open in IMG/M |
| 3300025940|Ga0207691_11225497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300025941|Ga0207711_10022484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF079 | 5273 | Open in IMG/M |
| 3300025973|Ga0210145_1014068 | Not Available | 873 | Open in IMG/M |
| 3300026067|Ga0207678_11098617 | Not Available | 704 | Open in IMG/M |
| 3300026075|Ga0207708_10793661 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300026088|Ga0207641_10022316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5210 | Open in IMG/M |
| 3300026089|Ga0207648_11658277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300026095|Ga0207676_10029851 | All Organisms → cellular organisms → Bacteria | 4086 | Open in IMG/M |
| 3300027877|Ga0209293_10064022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1559 | Open in IMG/M |
| 3300027877|Ga0209293_10751830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 517 | Open in IMG/M |
| 3300027885|Ga0209450_10017208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 4019 | Open in IMG/M |
| 3300027885|Ga0209450_10137356 | Not Available | 1673 | Open in IMG/M |
| 3300028603|Ga0265293_10372439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 874 | Open in IMG/M |
| 3300030336|Ga0247826_10982625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 670 | Open in IMG/M |
| 3300031772|Ga0315288_11421023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300031820|Ga0307473_10097758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1554 | Open in IMG/M |
| 3300031873|Ga0315297_11656545 | Not Available | 513 | Open in IMG/M |
| 3300031997|Ga0315278_11378750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300031999|Ga0315274_10116140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 3452 | Open in IMG/M |
| 3300032053|Ga0315284_10163938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2911 | Open in IMG/M |
| 3300032156|Ga0315295_10801235 | Not Available | 946 | Open in IMG/M |
| 3300032174|Ga0307470_11299814 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300032177|Ga0315276_10627553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1154 | Open in IMG/M |
| 3300032177|Ga0315276_11301805 | Not Available | 763 | Open in IMG/M |
| 3300032180|Ga0307471_100788285 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300032180|Ga0307471_102732290 | Not Available | 626 | Open in IMG/M |
| 3300032205|Ga0307472_100325402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1249 | Open in IMG/M |
| 3300032256|Ga0315271_11415747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 600 | Open in IMG/M |
| 3300032275|Ga0315270_10156769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1374 | Open in IMG/M |
| 3300032276|Ga0316188_10515940 | Not Available | 639 | Open in IMG/M |
| 3300032397|Ga0315287_10137773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2809 | Open in IMG/M |
| 3300032397|Ga0315287_10141932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2769 | Open in IMG/M |
| 3300032397|Ga0315287_10222127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2211 | Open in IMG/M |
| 3300032516|Ga0315273_10049238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thioflavicoccus → Thioflavicoccus mobilis | 5691 | Open in IMG/M |
| 3300032782|Ga0335082_10062198 | All Organisms → cellular organisms → Bacteria | 3810 | Open in IMG/M |
| 3300033004|Ga0335084_10114298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2806 | Open in IMG/M |
| 3300033004|Ga0335084_10319061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1605 | Open in IMG/M |
| 3300033004|Ga0335084_10330231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1574 | Open in IMG/M |
| 3300033004|Ga0335084_10427992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1362 | Open in IMG/M |
| 3300033408|Ga0316605_10159599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1845 | Open in IMG/M |
| 3300033413|Ga0316603_11432944 | Not Available | 655 | Open in IMG/M |
| 3300033414|Ga0316619_10081711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1989 | Open in IMG/M |
| 3300033418|Ga0316625_100177138 | Not Available | 1362 | Open in IMG/M |
| 3300033418|Ga0316625_100338924 | Not Available | 1097 | Open in IMG/M |
| 3300033418|Ga0316625_101673280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 611 | Open in IMG/M |
| 3300033482|Ga0316627_100375985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1207 | Open in IMG/M |
| 3300033482|Ga0316627_101346752 | Not Available | 714 | Open in IMG/M |
| 3300033483|Ga0316629_10810475 | Not Available | 720 | Open in IMG/M |
| 3300033557|Ga0316617_100601169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1021 | Open in IMG/M |
| 3300034115|Ga0364945_0060878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1067 | Open in IMG/M |
| 3300034149|Ga0364929_0052557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1238 | Open in IMG/M |
| 3300034150|Ga0364933_024078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1468 | Open in IMG/M |
| 3300034151|Ga0364935_0066399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1072 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 13.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 13.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 6.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.69% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.25% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 3.25% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.44% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 2.44% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.63% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.63% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 1.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.81% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.81% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025973 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055529_100043219 | 3300003763 | Arabidopsis Root | MSAPGRPKRSFPPWGEGAQRQGGAMSAPGRPKRSFPLGGKARSAKGAI* |
| Ga0062593_1012378972 | 3300004114 | Soil | VTGQGAGLPPGRPNGGSLPPGGKARSAKGAHQSLPPGRPKEGSLPPGGKA |
| Ga0068996_100732052 | 3300005218 | Natural And Restored Wetlands | MSTPGRPKCELLPLGGTARSAKGIHVCTPGRPKCELLPLGGAARSAKGVHK* |
| Ga0070676_104235202 | 3300005328 | Miscanthus Rhizosphere | MSVPPGRPKERSLPLGGKARSAKGAVISVPPGRPKERSLPLGGKVRSAKGTQ* |
| Ga0070668_1005646532 | 3300005347 | Switchgrass Rhizosphere | MSAPGRPKRESVPLGGKARSDEGAKLAPGRPKRESVPLGGKARSAKGAQ* |
| Ga0070671_1001464433 | 3300005355 | Switchgrass Rhizosphere | MSAPGRPKRELVPLGGQRSGGSRKRGGPSNSAPGRPKREWVALGGKARSAKGAPQ* |
| Ga0070671_1001536813 | 3300005355 | Switchgrass Rhizosphere | MSAPGRPKRELVPLGGKARSAKGAHIGAPGRPKRELVPLGGMARSAKGAV* |
| Ga0070694_1019586042 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | RPKEGSLPPGGKARSAKGAHNSPPPGRPKEGLLPLGGKARSAKGAQNRR* |
| Ga0068867_1023730051 | 3300005459 | Miscanthus Rhizosphere | MSLPPGRPKEGSLPLGGKARSAKGAVICLPPGRPKEGSLPLGGKARSAKGAV |
| Ga0070685_110565691 | 3300005466 | Switchgrass Rhizosphere | AQGRPKRELVPLGGTARSAKGAPIRAQGRPKRELVPLGGTARSAKGAP* |
| Ga0070665_1000581912 | 3300005548 | Switchgrass Rhizosphere | MSAPGRPKRELRPLGGCGGRKVGAPGRPKRELLPLGGKARSAKGAHQ* |
| Ga0070704_1006835291 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPPSGRPKEGSLPPGGKARSAKGAHSSHPRGRPKEGSLPLGGKARSAKGA |
| Ga0068859_1004951531 | 3300005617 | Switchgrass Rhizosphere | MSLPPGRPKEGSLPLGGKARSAKGAHSSLPPGRPKEGSLPLGGKARSAKGAHI |
| Ga0068859_1014636392 | 3300005617 | Switchgrass Rhizosphere | MSVPPGRPKERSLPLGGKARSAKGAHICVPPGRQKERSLPLVGKAPSATGAQ* |
| Ga0068864_1002428931 | 3300005618 | Switchgrass Rhizosphere | MSAPGRPKRELVPLGGQRSGGSRKRGGPSNSAPGRPKREWVPLGGKARSAKG |
| Ga0068861_1008732442 | 3300005719 | Switchgrass Rhizosphere | MSLPPGRPKEGSLPLGGKARSAKGAHIRLPPGRPKEGSLPLGGKARSAKG |
| Ga0068863_1000809074 | 3300005841 | Switchgrass Rhizosphere | MSAPGRPKRELLPLGGKARSAKGAHIRAPGRPKGELLPLGGKARSAKGAV* |
| Ga0068863_1007978981 | 3300005841 | Switchgrass Rhizosphere | MSLPPGRPKEGSLPLGGKARSAKGAHICLPPGRPKEGSLPLGGKARSAKGAVNAPA* |
| Ga0068862_1008182371 | 3300005844 | Switchgrass Rhizosphere | MSPPRGRPKEGSLPLGGKARSAKGAHICPPRGRPKEGSLPLGGKARSAKGA |
| Ga0097621_1001131724 | 3300006237 | Miscanthus Rhizosphere | MSAPGRPKRELVPLGGQRSGGSRKRGGPSNSAPGRPKREWVPLGGKARSAKGAPQ* |
| Ga0097621_1001795211 | 3300006237 | Miscanthus Rhizosphere | RAPGRPKRELLPLGGKARSAKGAHIRAPGRPKRELLPLGGKARSAKGAV* |
| Ga0068871_1020077361 | 3300006358 | Miscanthus Rhizosphere | MSLPPGRPKEGSLPLGGKARSAKGAVICLPPGRPKEGSLPLGGKARSAKGAVICLPPGRPKE |
| Ga0075425_1004868271 | 3300006854 | Populus Rhizosphere | MSAQGRPKRELLPLGGKARSAKGVVMSAQGRPKRELLP |
| Ga0075434_1020122451 | 3300006871 | Populus Rhizosphere | MSAQGRPKRELLPLGGTARSAKGAHIRAQGRPKRELLPLGGT |
| Ga0105044_100227619 | 3300007521 | Freshwater | MSAPGRPKRELLPLWGNGAPRQGGRLNAPGRPNRELLPLGGTARSARGAV* |
| Ga0102851_100501175 | 3300009091 | Freshwater Wetlands | VSAPGRPKRELLPPGGTARSAKGAHRSAPGRPKRELLPPGGTARSAKGAHR* |
| Ga0102851_101836431 | 3300009091 | Freshwater Wetlands | MSAPGRPKRESLPLGGTAPGAKGAHMSAPGRPKRESLPLG |
| Ga0102851_122573491 | 3300009091 | Freshwater Wetlands | MSATGRPERESVPPGGKARSAKGAPSCATGRPERESVPPGG |
| Ga0115027_101972981 | 3300009131 | Wetland | MSATGRPERESVPLGGTARSAKGAHVSATGRPERESVPLGGTARSAKGAHVSATG |
| Ga0115027_102562852 | 3300009131 | Wetland | MSAPGRPKRESLPLGGTAPGAKGAHMSAPGRPKRELLPLGGTARSAKGAP* |
| Ga0115027_106959473 | 3300009131 | Wetland | VSAPGRPKRELLPPGGTARSAKGAHRSAPGRPKRE |
| Ga0115027_119066062 | 3300009131 | Wetland | MSAQGRPKRELLPRGGTARSAEGVVHRAPGRPKRE |
| Ga0105248_104403591 | 3300009177 | Switchgrass Rhizosphere | MSAPGRPKRELVPLGGKARSAKGAHIGAPGRPKREL |
| Ga0118657_121195191 | 3300009506 | Mangrove Sediment | MSAPGRPKRESVPRGGTARSAKGGSSMSAPGRPKRE |
| Ga0126372_110574301 | 3300010360 | Tropical Forest Soil | VMSAQGRPKRELLPLGGKAQSAKGVMSAQGRPKRELLPLGGKAQSAKGVV* |
| Ga0134123_123106451 | 3300010403 | Terrestrial Soil | MSAPGRPKRELLPLGGQRSGGRRKRGGPSNRAPGRPKRELVPLGGKARSAKGAHQ* |
| Ga0157375_101817354 | 3300013308 | Miscanthus Rhizosphere | MSAPGRPKRELRPLGGCGGRKVRAPGRPKRATALCRGGKARSVKGAH |
| Ga0172380_100062959 | 3300014205 | Landfill Leachate | MNHPPGRPKDGSLPLGGKSRSDKGAPNSHPPGRPKDGSLPPGGKSRSDKGALLA* |
| Ga0172380_100728312 | 3300014205 | Landfill Leachate | MRHPPGRPKDGSLPLGGKARSAKGAPLTHPPARPKDGSLPLGGTARSPKGAL* |
| Ga0163163_103684943 | 3300014325 | Switchgrass Rhizosphere | MSAPGRPKRESVPLGGKARSAKGAQRAPGRPKRESVPLGGKARSAKGAQ* |
| Ga0157380_124645972 | 3300014326 | Switchgrass Rhizosphere | SMGPPRGRPKEGPLPLGGKARSAKGAHICPPRGRPKEGPLPPGGKARSAKGAQ* |
| Ga0180082_10807252 | 3300014880 | Soil | MSAPGRPKRELLPLGGKARSAKGADSSAPGRPKRELLPLGGTARSAKGAP* |
| Ga0157376_100180801 | 3300014969 | Miscanthus Rhizosphere | MSAPGRPKRELVPLGGQRSGGSRKRGGPSNSAPGRPKREWVPLGGKARSAKGA |
| Ga0132258_105089732 | 3300015371 | Arabidopsis Rhizosphere | MSARGRPKRELLPLGGTPHSAKGPHPSAPGRPKPETAVRLGGKARSAKDAP* |
| Ga0132258_109015754 | 3300015371 | Arabidopsis Rhizosphere | MSAQGRPNRESLPLGGKARSAKGAPIRAPGRPERESLPLGGKARSAKGAA* |
| Ga0132257_1018030731 | 3300015373 | Arabidopsis Rhizosphere | IRAPGRPKRELLPLGGKARSAKGAPIRAPGRPERESLPLGGKARSAKGAA* |
| Ga0182036_109274872 | 3300016270 | Soil | HERAGPPQARLLPLRGDGAKRQGGLMSAQGRPKRELLPLGGTAQSAKGAP |
| Ga0190274_100552662 | 3300018476 | Soil | MSAPGRPKRELLPLRGEGAQRQGGTMSAPGRPKRELLPLGGKARSAKGAP |
| Ga0190274_101428472 | 3300018476 | Soil | MSAPGRPKRELLPLGGKARSAKGVLIRAPGRPKRGTALCLAGKARSAKGAPMNGAR |
| Ga0190274_118478021 | 3300018476 | Soil | MSAPGRPKRELLPLGGKARSAKGAHISAPGRPKRELVPLGGKARSAK |
| Ga0209455_10046312 | 3300025272 | Arabidopsis Root | MSAPGRPKRSFPPWGEGAQRQGGAMSAPGRPKRSFPLGGKARSAKGAI |
| Ga0207645_107603151 | 3300025907 | Miscanthus Rhizosphere | MSVPPGRPKERSLPLGGKARSAKGAHICVPPGRPKERSLPLGGKARSAKGALI |
| Ga0207645_111743091 | 3300025907 | Miscanthus Rhizosphere | GRPKRELVPLGGTARSAKGAPIRAQGRPKRELVPLGGTARSAKGAP |
| Ga0207650_102472912 | 3300025925 | Switchgrass Rhizosphere | MSAPGRPKRELRPLGGCGGRKVGAPGRPKRELLPLGGKARSAKGAHK |
| Ga0207650_116438912 | 3300025925 | Switchgrass Rhizosphere | VSAQGRPKRELVPLGGTARSAKGAPIRAQGRPKRELVPLG |
| Ga0207659_103243441 | 3300025926 | Miscanthus Rhizosphere | MSAPGRPKRELVPLGGKARSAKGAHIGAPGRPKRELVPLGGKARSAKGAHIGA |
| Ga0207659_103728573 | 3300025926 | Miscanthus Rhizosphere | MSAPGRPKRELRPLGGCGGRKVGAPGRPKRELLPLGGKARSAKGAHQ |
| Ga0207659_113878861 | 3300025926 | Miscanthus Rhizosphere | PRGSPKEGSLPRGGMVRSAEGAHLCPPHGRPKEGSLPRGGMARSAQGAS |
| Ga0207659_115814972 | 3300025926 | Miscanthus Rhizosphere | VSAQGRPKRELVPLGGTARSAKGAPIRAQGRPKRELVPLGGTARSAKG |
| Ga0207701_102450171 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | KEGSLPLGGKARSAKGAHMSPPRGRPKEGSLPLGGKARSAKGAHISPPRGHPNGVRT |
| Ga0207644_100759612 | 3300025931 | Switchgrass Rhizosphere | MSAPGRPKRELVPLGGQRSGGSRKRGGPSNSAPGRPKREWVALGGKARSAKGAPQ |
| Ga0207691_112254972 | 3300025940 | Miscanthus Rhizosphere | MSAPGRPKRESVPLGGKARSDEGAKLAPGRPKRESVPLGGKARSAKGAQ |
| Ga0207711_100224842 | 3300025941 | Switchgrass Rhizosphere | MSAPGRPKRELVPLGGKARSAKGAHIGAPGRPKRELLPLGGMARSAKGAV |
| Ga0210145_10140681 | 3300025973 | Natural And Restored Wetlands | MSAKGRPERELLPHGGTARSAKGAPVSAKGRPERELLPHGGTARSAKGAPV |
| Ga0207678_110986171 | 3300026067 | Corn Rhizosphere | VVSAQGRPKRELVPLGGTARSAKGAPIRAQGRPKRELVPLGGTARSAKGAP |
| Ga0207708_107936611 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | PGPGARGSGMSAPGRPKRELVPLGGKARSAKGAHIGAPGRPKRELVPLGGMARSAKGAV |
| Ga0207641_100223164 | 3300026088 | Switchgrass Rhizosphere | MSAPGRPKRELLPLGGKARSAKGAHIRAPGRPKGELLPLGGKARSAKGAV |
| Ga0207641_108794922 | 3300026088 | Switchgrass Rhizosphere | MSLPPGRPKEGSLPLGGKARSAKGAHHSLPPGRPKEGSLPPGGKARSAKGARVTFNA |
| Ga0207648_110470161 | 3300026089 | Miscanthus Rhizosphere | GRPKEGSLPLGGKARSAKGAHICLPPGRPKEGSLPLGGKARSAKGAHK |
| Ga0207648_116582772 | 3300026089 | Miscanthus Rhizosphere | RELVPLGGKARSAKGAHIGAPGRPKRELVPLGGMARSAKGAV |
| Ga0207676_100298514 | 3300026095 | Switchgrass Rhizosphere | MSAPGRPKRELLPRGGKARSAKGAPIRAPGRPKRELLPRGGKARSANGAHISDAGPMGNSRTC |
| Ga0209293_100640221 | 3300027877 | Wetland | VSAPGRPKRELLPPGGTARSAKGAHRSAPGRLKRELLPPGGT |
| Ga0209293_107518302 | 3300027877 | Wetland | MSAPGRPKRESVPLGGTARSAKGVLVSAPGRPKRECSPSGGG |
| Ga0209450_100172082 | 3300027885 | Freshwater Lake Sediment | VSAPGRPEREPLPLGGNGAQRRGGNVSAPGRPKRELLPLGGTARSAEGAP |
| Ga0209450_101373561 | 3300027885 | Freshwater Lake Sediment | MSAPGRPKREWLPLGGTARSAQGVLMSAPGRPKREWLPLGGTARSAQGVLM |
| Ga0265293_103724392 | 3300028603 | Landfill Leachate | MSAPGRPKRESPHGGAARSALGGAMSAPGRPKRESPHGG |
| Ga0307306_101106402 | 3300028782 | Soil | MSLPPGRPKEGSLPLGGKARSAKGAHICPPPGRPKEDSLPLGGKACSAKGAPP |
| Ga0247826_109826252 | 3300030336 | Soil | VSAPGRPKREIPHGGTARSAKGADMSAPGRPKREIPQ |
| Ga0315288_114210232 | 3300031772 | Sediment | MSALGRPKRELLPLGGKARSAKGALMSAPGRPKRELLPLGGKARSAKGAPAMPSA |
| Ga0307473_100977581 | 3300031820 | Hardwood Forest Soil | MSAQGRPKRESLPLGGKAPSAKGARIRAQGRPKREL |
| Ga0315297_116565452 | 3300031873 | Sediment | MSTPGRPKCELLPLGGTARSAKGVLMATPGRPKCELLPLGGTARSAKGVHK |
| Ga0315278_113787501 | 3300031997 | Sediment | MSAPGRPKRELLPLGGKARSAKGALMSAPSRPKRELLPLG |
| Ga0315274_101161406 | 3300031999 | Sediment | MSAPGRPKRELLPLGGKALCAKGVPMSAPGRPKRELLPLGGKALCAKGVPR |
| Ga0307414_114814991 | 3300032004 | Rhizosphere | MSTPHGRPKEGSLPSGDSAQREGAYMSTPHGRPKEGSLPLGGTARSAKGAPI |
| Ga0315284_101639383 | 3300032053 | Sediment | RQDTVECYMSAPGRPKRELLPLGGKARSAKGALMSAPGRPKRELLPLGGKARSAKGAPAMPSA |
| Ga0315292_108616531 | 3300032143 | Sediment | MSLPPGRPKEGSLPLGGKARSAKGAHSCLPPGRPKEGSLPHGGKAR |
| Ga0315295_108012351 | 3300032156 | Sediment | MMSAPGRPKRELLPLGGTARSAKGAHMSAPGRPKRKLLPLGGTARS |
| Ga0307470_112998141 | 3300032174 | Hardwood Forest Soil | MSAPGRPKRELLPLGGKARSAKGAPIRATGRPNRGTVVRLGGKARSAKGAHQ |
| Ga0315276_106275532 | 3300032177 | Sediment | MSAPGRPKRELLPLGGKARSAKGALMSAPGRPKRELLPLGGKARSAKGAPAMPSA |
| Ga0315276_113018051 | 3300032177 | Sediment | GRPKREWLPLGGKARSAKGAPMSAPGRPKREWLPLGGKARSAKGALTGS |
| Ga0307471_1007882851 | 3300032180 | Hardwood Forest Soil | MSAQGRPKRESLPLRGKARSAKGAHIRAQGRPKRESLPLRG |
| Ga0307471_1027322901 | 3300032180 | Hardwood Forest Soil | MSVQGRPKRELLPLGGTARSAKGAHIRVQGRPKRELLPLGGTARSAKGVHQ |
| Ga0307472_1003254022 | 3300032205 | Hardwood Forest Soil | MSAQGRPKRELLPLGRTARSAKGAHIRAQNRPKRELLPLGRTARSAKGAQ |
| Ga0315271_106690401 | 3300032256 | Sediment | VSPPRGRPKEGSLPLGGTARSAKGALTTPPRGRPKEGSLPLGVTARSAK |
| Ga0315271_114157472 | 3300032256 | Sediment | MSAPGRPKRELLSRGGTARSAKGAHTSAPGRPKREH |
| Ga0315270_101567692 | 3300032275 | Sediment | MSAPGRPKRELLPLGGKARSAKGALMSAPGRPKRELLPLGGKARSAKGAPM |
| Ga0316188_105159402 | 3300032276 | Worm Burrow | MSAPGRPKRELLPRGGTARSAEGAVIRAPGRPKRELLPRGGTARSAEGASMSA |
| Ga0315287_1000886710 | 3300032397 | Sediment | MSLPPGRPKEGDVPLGGTARSAREHISLPPGRPKEGDVPLGGTARSAREHISLPPGRHKDVHARIDPPWSS |
| Ga0315287_101377732 | 3300032397 | Sediment | MSTPGRPKCESLPLGGTARSAKGVHIRTPGRPKCESLPLGGAVRSAKGVHK |
| Ga0315287_101419322 | 3300032397 | Sediment | MSAPGRPKREWLPLGGKARSAKGAPMSAPGRPKREWLPLGGKARSAKGALTGS |
| Ga0315287_102221273 | 3300032397 | Sediment | MSAPGRPKREWLPLGGTARSAKGVHQWSAPGRPKREWLPLGGTARSAKGVHQ |
| Ga0315273_100492387 | 3300032516 | Sediment | MSAPGRPKRELLPLGGKALCAKGVPMSAPGRPKRELLPLGGK |
| Ga0335082_100621983 | 3300032782 | Soil | MSAKGRPERELLPSGETARSAKGAPLSAMGRPERELLPPRGTARSAKGEPLSAMGR |
| Ga0335084_101142985 | 3300033004 | Soil | MSAKGRPERESLPLGGTARSAEGAHIRAKGRPERESLPLGGTARSA |
| Ga0335084_103190614 | 3300033004 | Soil | MSAKGRFERESLPLGGNARSAEGKPSAKGRPERESPPLGATARSAEGAPLGATP |
| Ga0335084_103302311 | 3300033004 | Soil | MSAKGRPERELLPSGETARSAKGAPLSAMGRPERELLPPGGTARSAKGEPLSAMGG |
| Ga0335084_104279923 | 3300033004 | Soil | IRAKGRPERESLPLGGTARSAAGAHIRAKGRPEREGAP |
| Ga0316605_101595992 | 3300033408 | Soil | VSAPGRPKRELLPPGGTARSAKGAHRSAPGRPKRELLPPGGTARSAKGAHR |
| Ga0316603_114329442 | 3300033413 | Soil | MSPPGRPKGELLPLEGTARSAKGAPVSTPGRPKCELLPPRGTARSARGR |
| Ga0316619_100817113 | 3300033414 | Soil | VSAPGRPKRELPPPGGTARSAKGAHRSAPGRPKRELLPPGGTARSAKGAHR |
| Ga0316625_1001771383 | 3300033418 | Soil | KGRPEGEFVPLGGKARSAKGAPQMSPKGRPEGEFVPLGGKARSAKGAHQ |
| Ga0316625_1003389241 | 3300033418 | Soil | MSPPGRPKGEGVPLGGKARSAQGAVSPPGRPKGEGVPLGGKARSA |
| Ga0316625_1016732801 | 3300033418 | Soil | VSAKGRPEREPFPLGGRARSAKGAHECAKGRPEREPFPLGGRARSAKGAHECATG |
| Ga0316627_1003759853 | 3300033482 | Soil | MSAPGRPKRELLPLGGTARSAKGAQSSAPGRPKGEL |
| Ga0316627_1013467522 | 3300033482 | Soil | MSAKGRPERESVPLGGKARSAKGAHSCAKGRPERESVPLGGKAR |
| Ga0316629_108104751 | 3300033483 | Soil | MICIKGSAVSAKGRPERELLPLGGTARSAKGAPVSAKGRPERE |
| Ga0316626_108136291 | 3300033485 | Soil | MSATGRPERESVPLGGKARSAKGAPSCATGRPERESVP |
| Ga0316630_100320894 | 3300033487 | Soil | MSAPGRPKRESVPLGGTARSAKGAPSSAPGRFAGTQP |
| Ga0316617_1006011691 | 3300033557 | Soil | VSAKGRPEREPFPLGGRARSAKGAHECAKGRPEREPFPLG |
| Ga0364945_0060878_221_391 | 3300034115 | Sediment | MSAPGRPKRESLPLGGQRSGGSRKRGGPSNSAPGRPKRGTAVRLAGKARSAKGAHQ |
| Ga0364929_0052557_1045_1197 | 3300034149 | Sediment | MSAPGRPKRELLPLGGKARSAKGADSSAPGRPKRELLPLGGTARSAKGAQ |
| Ga0364933_024078_774_929 | 3300034150 | Sediment | MSAPGRPKRELLPLGGKARSAKGAMSPPGISRRGTAVRLGGTVRSAKVAYS |
| Ga0364935_0066399_2_160 | 3300034151 | Sediment | MSAPGRPKGELLPLGGKARSAKGAHIRAPGRPKGELLPLGGKARSAKGAPVSM |
| ⦗Top⦘ |