


| Basic Information | |
|---|---|
| Family ID | F070184 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GLRYVTGMSEVDGLAGTGLETINDKSARWTVPFLVGVRARF |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.50 % |
| % of genes near scaffold ends (potentially truncated) | 91.87 % |
| % of genes from short scaffolds (< 2000 bps) | 89.43 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.553 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.447 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.024 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.033 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.04% β-sheet: 0.00% Coil/Unstructured: 86.96% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF01139 | RtcB | 4.92 |
| PF10009 | DUF2252 | 2.46 |
| PF00072 | Response_reg | 2.46 |
| PF06965 | Na_H_antiport_1 | 2.46 |
| PF12796 | Ank_2 | 2.46 |
| PF07969 | Amidohydro_3 | 1.64 |
| PF07676 | PD40 | 1.64 |
| PF01625 | PMSR | 1.64 |
| PF12006 | DUF3500 | 1.64 |
| PF10116 | Host_attach | 1.64 |
| PF01794 | Ferric_reduct | 0.82 |
| PF01734 | Patatin | 0.82 |
| PF01569 | PAP2 | 0.82 |
| PF05598 | DUF772 | 0.82 |
| PF04457 | MJ1316 | 0.82 |
| PF02771 | Acyl-CoA_dh_N | 0.82 |
| PF02615 | Ldh_2 | 0.82 |
| PF13620 | CarboxypepD_reg | 0.82 |
| PF07715 | Plug | 0.82 |
| PF13360 | PQQ_2 | 0.82 |
| PF00656 | Peptidase_C14 | 0.82 |
| PF04237 | YjbR | 0.82 |
| PF05731 | TROVE | 0.82 |
| PF00248 | Aldo_ket_red | 0.82 |
| PF13460 | NAD_binding_10 | 0.82 |
| PF00076 | RRM_1 | 0.82 |
| PF13486 | Dehalogenase | 0.82 |
| PF01894 | UPF0047 | 0.82 |
| PF02518 | HATPase_c | 0.82 |
| PF00753 | Lactamase_B | 0.82 |
| PF07274 | DUF1440 | 0.82 |
| PF01103 | Omp85 | 0.82 |
| PF13442 | Cytochrome_CBB3 | 0.82 |
| PF13557 | Phenol_MetA_deg | 0.82 |
| PF03465 | eRF1_3 | 0.82 |
| PF04545 | Sigma70_r4 | 0.82 |
| PF00782 | DSPc | 0.82 |
| PF01841 | Transglut_core | 0.82 |
| PF01464 | SLT | 0.82 |
| PF01170 | UPF0020 | 0.82 |
| PF00325 | Crp | 0.82 |
| PF06956 | RtcR | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 4.92 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 2.46 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 1.64 |
| COG4650 | Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain | Transcription [K] | 1.64 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 0.82 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.82 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG1531 | Uncharacterized conserved protein, UPF0248 family | Function unknown [S] | 0.82 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.82 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.82 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.82 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.82 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 0.82 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.82 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG3477 | Uncharacterized membrane protein YagU, involved in acid resistance, DUF1440 family | Function unknown [S] | 0.82 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.82 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.82 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.82 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.55 % |
| Unclassified | root | N/A | 15.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_15497374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300000955|JGI1027J12803_108045436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107684634 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300001431|F14TB_106508328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300004114|Ga0062593_100192288 | Not Available | 1613 | Open in IMG/M |
| 3300004156|Ga0062589_100170654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
| 3300004480|Ga0062592_100506358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300004643|Ga0062591_101683026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300005293|Ga0065715_10758770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 627 | Open in IMG/M |
| 3300005347|Ga0070668_100037481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3702 | Open in IMG/M |
| 3300005354|Ga0070675_100608166 | Not Available | 992 | Open in IMG/M |
| 3300005356|Ga0070674_101304300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300005356|Ga0070674_101460339 | Not Available | 614 | Open in IMG/M |
| 3300005367|Ga0070667_102303809 | Not Available | 507 | Open in IMG/M |
| 3300005455|Ga0070663_100144182 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300005456|Ga0070678_100624324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 964 | Open in IMG/M |
| 3300005543|Ga0070672_100640932 | Not Available | 928 | Open in IMG/M |
| 3300005548|Ga0070665_100386238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1407 | Open in IMG/M |
| 3300005618|Ga0068864_102633423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300005718|Ga0068866_10756457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300005719|Ga0068861_100280422 | Not Available | 1435 | Open in IMG/M |
| 3300005719|Ga0068861_100584555 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300005719|Ga0068861_101062412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300005844|Ga0068862_100087997 | Not Available | 2702 | Open in IMG/M |
| 3300005844|Ga0068862_100128855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2236 | Open in IMG/M |
| 3300006358|Ga0068871_100294371 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300006844|Ga0075428_101347396 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300006847|Ga0075431_100738932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300006853|Ga0075420_100186213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1815 | Open in IMG/M |
| 3300009053|Ga0105095_10521526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300009094|Ga0111539_10073398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4034 | Open in IMG/M |
| 3300009094|Ga0111539_12943700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300009147|Ga0114129_12188426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300009147|Ga0114129_13433128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 508 | Open in IMG/M |
| 3300009148|Ga0105243_10021231 | All Organisms → cellular organisms → Bacteria | 4928 | Open in IMG/M |
| 3300009148|Ga0105243_10615162 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 1048 | Open in IMG/M |
| 3300009156|Ga0111538_11319202 | Not Available | 911 | Open in IMG/M |
| 3300009162|Ga0075423_11603894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300009179|Ga0115028_11788233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300009553|Ga0105249_12026857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 648 | Open in IMG/M |
| 3300010166|Ga0126306_10495912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300010375|Ga0105239_12948111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300010403|Ga0134123_11385960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300011429|Ga0137455_1094836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300011441|Ga0137452_1065565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300011442|Ga0137437_1347753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300012212|Ga0150985_119295265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012212|Ga0150985_122634881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300012232|Ga0137435_1007175 | All Organisms → cellular organisms → Bacteria | 3149 | Open in IMG/M |
| 3300012469|Ga0150984_103529099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300012469|Ga0150984_105966053 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300012469|Ga0150984_108252478 | Not Available | 530 | Open in IMG/M |
| 3300012469|Ga0150984_121226290 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300012897|Ga0157285_10361275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 512 | Open in IMG/M |
| 3300012903|Ga0157289_10353789 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012903|Ga0157289_10385202 | Not Available | 522 | Open in IMG/M |
| 3300012911|Ga0157301_10468805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012912|Ga0157306_10225141 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300013306|Ga0163162_10639782 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300013306|Ga0163162_12597849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300014325|Ga0163163_13070445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 521 | Open in IMG/M |
| 3300014326|Ga0157380_13168715 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300014745|Ga0157377_10030158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2935 | Open in IMG/M |
| 3300014861|Ga0180061_1087380 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300015077|Ga0173483_10861211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300015077|Ga0173483_10992616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300015200|Ga0173480_10164200 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300015201|Ga0173478_10130423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300015371|Ga0132258_10774112 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
| 3300015372|Ga0132256_100765435 | Not Available | 1082 | Open in IMG/M |
| 3300015372|Ga0132256_101563210 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300015374|Ga0132255_101959192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 891 | Open in IMG/M |
| 3300017965|Ga0190266_10099631 | Not Available | 1190 | Open in IMG/M |
| 3300018466|Ga0190268_11652535 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300018469|Ga0190270_10611956 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300018469|Ga0190270_13141282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300018469|Ga0190270_13141282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300018469|Ga0190270_13151688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300018481|Ga0190271_11133670 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300019362|Ga0173479_10539381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300021081|Ga0210379_10285924 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300025893|Ga0207682_10309845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300025901|Ga0207688_10479686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300025908|Ga0207643_10884381 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300025932|Ga0207690_11870550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 501 | Open in IMG/M |
| 3300025937|Ga0207669_11069102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300025937|Ga0207669_11308907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales | 616 | Open in IMG/M |
| 3300025938|Ga0207704_11898559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300025945|Ga0207679_10277603 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300025960|Ga0207651_10690829 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300025986|Ga0207658_11789427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
| 3300026121|Ga0207683_10901434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 821 | Open in IMG/M |
| 3300026829|Ga0207580_1008022 | Not Available | 502 | Open in IMG/M |
| 3300028768|Ga0307280_10021673 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300028809|Ga0247824_10791644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300030336|Ga0247826_11272145 | Not Available | 592 | Open in IMG/M |
| 3300031538|Ga0310888_10000952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7933 | Open in IMG/M |
| 3300031547|Ga0310887_10464669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300031740|Ga0307468_100866201 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031834|Ga0315290_10957543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300031854|Ga0310904_10632403 | Not Available | 734 | Open in IMG/M |
| 3300031908|Ga0310900_10909702 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300031913|Ga0310891_10112721 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300032005|Ga0307411_10940419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300032012|Ga0310902_10839802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300032075|Ga0310890_10466221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 953 | Open in IMG/M |
| 3300032075|Ga0310890_10773305 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300032075|Ga0310890_11062976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300032157|Ga0315912_10470672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 998 | Open in IMG/M |
| 3300032163|Ga0315281_10239407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2006 | Open in IMG/M |
| 3300032179|Ga0310889_10591746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300032211|Ga0310896_10903635 | Not Available | 511 | Open in IMG/M |
| 3300032275|Ga0315270_11066673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300032401|Ga0315275_10695566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300032516|Ga0315273_12315258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300033521|Ga0316616_101484075 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300033550|Ga0247829_11253986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 614 | Open in IMG/M |
| 3300033551|Ga0247830_10396246 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300033811|Ga0364924_118513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300034659|Ga0314780_206316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 13.01% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.06% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.63% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026829 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_154973742 | 3300000550 | Soil | RVSGLAEVDDLVGTGLDTINDKSQRWTLPFIGGVQFRF* |
| JGI1027J12803_1080454362 | 3300000955 | Soil | LQMSRNVDMFGQLGLRWVSGMSAIDNLEGTGLETINDKSGR |
| JGIcombinedJ13530_1076846341 | 3300001213 | Wetland | RWLSGMSPVDGLAGTGLEKINDNSSRWTMPLVVGLRAHF* |
| F14TB_1065083282 | 3300001431 | Soil | YVTGMSEVDGLAGTGLETINDKSGRWTIPFLFGVRARF* |
| Ga0062593_1001922884 | 3300004114 | Soil | VADQVEVFGQLGLRWVSGMSAVDGLAGTGLETINDNSARWTVPFVVGVRARF* |
| Ga0062589_1001706543 | 3300004156 | Soil | AGKVGVYGQIGLRYVTGMSSVDGLAGTGLETINDKSSRWTMPFIAGVHLKF* |
| Ga0062592_1005063581 | 3300004480 | Soil | FDVFGQVGLRWVSGMSSVDRLEGTGLDTINDNSARWTMPFLTGVRVRF* |
| Ga0062591_1016830261 | 3300004643 | Soil | ARAGSRFDVFGQLGLRWMSGMSAIDNLEDTSLDTINDKSSRWTMPFLAGVRLRF* |
| Ga0065715_107587702 | 3300005293 | Miscanthus Rhizosphere | DFYDQTAAFTLGGNAGVVLQMSRSVDVFGQLGVRWVSGMSAIDNLEGTGLDTINDKSGRWTMPFLTGVRVRF* |
| Ga0070668_1000374811 | 3300005347 | Switchgrass Rhizosphere | RRVSGLAEVDDLVGTGLDTINDKSQRWTLPFIGGVQFRF* |
| Ga0070675_1006081662 | 3300005354 | Miscanthus Rhizosphere | AAFTLGGNAGVVLQMSRNIDMFGQLGLRWVSGMSAVDNLEGTGLETINDKSGRWTMPFLTGVRVRF* |
| Ga0070674_1013043002 | 3300005356 | Miscanthus Rhizosphere | FAQVGLRWTSGMAEIDDLEGTGLETINDKSARWTFPFIAGVRVGF* |
| Ga0070674_1014603392 | 3300005356 | Miscanthus Rhizosphere | GGNGGVVLEMSSNVDMFGQAGIRWVSGMSAIDNLEGTGLETINDKSGRWTVPFLTGIRVRF* |
| Ga0070667_1023038092 | 3300005367 | Switchgrass Rhizosphere | AGVMFQTGPRFDVFAQLGLRWMSGMAEIDQFEATGLNDINNKSSRWTLPLLIGVRYRF* |
| Ga0070663_1001441821 | 3300005455 | Corn Rhizosphere | DMFGQVGIRWVSGMSAIDNLEGTGLETINDKSGRWTMPFLTGVRVRF* |
| Ga0070678_1006243241 | 3300005456 | Miscanthus Rhizosphere | QLGVRWVSGMSAIDNLEGTGLDTINDKSGRWTMPFLTGVRVRF* |
| Ga0070672_1006409321 | 3300005543 | Miscanthus Rhizosphere | AFTLGGNAGVVLQMSRNIDMFGQLGLRWVSGMSAVDNLEGTGLETINDKSGRWTMPFLTGVRVRF* |
| Ga0070665_1003862381 | 3300005548 | Switchgrass Rhizosphere | TLGGNAGVVLQMSRSVDVFGQLGVRWVSGMSAIDNLEGTGLDTINDKSGRWTMPFLTGVRVRF* |
| Ga0068864_1026334231 | 3300005618 | Switchgrass Rhizosphere | GGNVGVLFETSPRVGVFGQLGVRWVSGMSAVDDLQGTGLETINDKSARWTVPFLVGVRVGF* |
| Ga0068866_107564571 | 3300005718 | Miscanthus Rhizosphere | GMSEVDDLVGTGLETINDSSARWTMPFLVGVRVGF* |
| Ga0068861_1002804222 | 3300005719 | Switchgrass Rhizosphere | QLGLRWVSGMAEIDDLAPTGLGNINDKSSRWTLPFIGGVRVQF* |
| Ga0068861_1005845552 | 3300005719 | Switchgrass Rhizosphere | VLQMSRNIDMFGQLGLRWVSGMSAVDNLEGTGLETINDKSGRWTMPFLTGVRVRF* |
| Ga0068861_1010624121 | 3300005719 | Switchgrass Rhizosphere | IGFYGQLGMRYVSGMAEVDDLIGTGLDNINDKSARWTLPFIVGIRYRF* |
| Ga0068862_1000879971 | 3300005844 | Switchgrass Rhizosphere | LRWVSGMAQIDDLATTGLGNINDKSSRWTMPIIAGIRFAF* |
| Ga0068862_1001288551 | 3300005844 | Switchgrass Rhizosphere | KLDFFGQVGFRYVTGMAEVDALTGTGLETINDKSARWTFPFVVGIRMRF* |
| Ga0068871_1002943713 | 3300006358 | Miscanthus Rhizosphere | LAEVDDLVGTGLDTINDKSSRWTIPFLAGVRYRF* |
| Ga0075428_1013473963 | 3300006844 | Populus Rhizosphere | SGLSEVDDLVGTGLDNINDKSSRWTLPFIGGVRVQF* |
| Ga0075431_1007389322 | 3300006847 | Populus Rhizosphere | QLGLRYLSGMAEVDDLVGTGLETINDKSSRWTMPFVAGARMRF* |
| Ga0075420_1001862134 | 3300006853 | Populus Rhizosphere | ATRKAGVFGQVGVRYVTGMSEVDGLAGTGLETINDKSGRWTIPFLFGVRARF* |
| Ga0105095_105215262 | 3300009053 | Freshwater Sediment | RWMSGMSEIDNLEGTGLETINDNSSRWTMPFIFGVRARF* |
| Ga0111539_100733985 | 3300009094 | Populus Rhizosphere | VLFQVADKVGVYGQIGLRYVTGMSAVDGLAGTGLETINDKSARWTLPFIGGVRIRF* |
| Ga0111539_129437002 | 3300009094 | Populus Rhizosphere | IGVRYVSGMAEVDDLVGTGLDNINDKSARWTLPFIAGIRYRF* |
| Ga0114129_121884262 | 3300009147 | Populus Rhizosphere | GANGGVMFQTGPRFEVFGQLGLRWMSGMAQIDQLIGTGLNDINNKSSRWTLPFVGGVRVRF* |
| Ga0114129_134331282 | 3300009147 | Populus Rhizosphere | QLGFRRVSGLSQVDDLIGTGLDNINDKSTRWTFPFIVGVRYQF* |
| Ga0105243_100212311 | 3300009148 | Miscanthus Rhizosphere | FGQLGLRYVSGMTEIDDLVGTGLDNINDKSARWTLPFIVGIRYRF* |
| Ga0105243_106151621 | 3300009148 | Miscanthus Rhizosphere | LRWVSGMSAVDGLEGTGLETINDKSSRWTFPFIAGVRVQF* |
| Ga0111538_113192022 | 3300009156 | Populus Rhizosphere | VSGLAEVDDLVGTGLDTMNDKSSRWTVPFLAGVKFGF* |
| Ga0075423_116038942 | 3300009162 | Populus Rhizosphere | GLSEVDDLVGTGLDTINDKSQRWTLPIIGGIQFRF* |
| Ga0115028_117882332 | 3300009179 | Wetland | WERVGLFTQLGVRYVTGMSEVDGLAGTGLETINDKSARWTLPFQVGLRARF* |
| Ga0105249_120268572 | 3300009553 | Switchgrass Rhizosphere | VFGQLGVRWVSGMSAIDNLEGTGLDTINDKSGRWTMPFLTGVRVRF* |
| Ga0126306_104959121 | 3300010166 | Serpentine Soil | VTGMSEVDGLVGTGLEEINDSSARWTVPILLGIQARF* |
| Ga0105239_129481112 | 3300010375 | Corn Rhizosphere | GYFGQLGLRYVSGMTEVDDLVGTGLDNINDKSARWTMPFIVGIHYRF* |
| Ga0134123_113859602 | 3300010403 | Terrestrial Soil | RWVSGMAPIDSLEGTSLDTINDKSARWTIPFITGVRVQF* |
| Ga0137455_10948362 | 3300011429 | Soil | DFFAQIGFRYVTGMSDVDNLTGTGLENINDNSARWTFPLVFGIRKRF* |
| Ga0137452_10655652 | 3300011441 | Soil | YVTGMSDVDNLAGTGLENINDKSARWTFPLVFGIRKRF* |
| Ga0137437_13477532 | 3300011442 | Soil | VTGMSAVDGLAGTGLETINDKSARWTVPFIGGVRVRF* |
| Ga0150985_1192952652 | 3300012212 | Avena Fatua Rhizosphere | VGIRWVSGMSAVDDLVGTGLESINDKSARWTLPFLVGVRVRF* |
| Ga0150985_1226348811 | 3300012212 | Avena Fatua Rhizosphere | TSVFAQMGLRWVSGMAEVDDLVGTGLDNINDKSGRWTVPFLAGIRVGF* |
| Ga0137435_10071754 | 3300012232 | Soil | TGMSDVDNLTGTGLENINDKSARWTFPLVFGVRKRF* |
| Ga0150984_1035290991 | 3300012469 | Avena Fatua Rhizosphere | MQLNDRYGAFVQVGLRRMSGMSDVDDLLGTGLETINDNSARWTFPFSLGVRARF* |
| Ga0150984_1059660533 | 3300012469 | Avena Fatua Rhizosphere | DRVGLFVQMGLRWMTGLAEVDDLVGTGLDTINDKSSRWTVPFLVGVRYRF* |
| Ga0150984_1082524782 | 3300012469 | Avena Fatua Rhizosphere | MAEVDDLIGTGLEPINDNSSRWTVPFLAGVRVGF* |
| Ga0150984_1212262901 | 3300012469 | Avena Fatua Rhizosphere | SGLAEVDDLVGTGLDSINDKSSRWTIPFLVGVRYSF* |
| Ga0157285_103612751 | 3300012897 | Soil | FGVFGQMGLRYVTGMSDVDGLAGTGLEEINDSSARWTLPFLVGVRARF* |
| Ga0157289_103537892 | 3300012903 | Soil | VLVETSPRVGLFGQIGLRWVSGMTAVDDLEGTGLETINDKSARWTFPFLVGVRVGF* |
| Ga0157289_103852022 | 3300012903 | Soil | WNAHGRVGIFTQLGLRYVTGLKEVDQTLGTGLEEINDNSARWTIPFVMGVRYGF* |
| Ga0157301_104688052 | 3300012911 | Soil | GLIVQAGKKFDVFGQVGLRWVSGMSSVDRLEGTGLDTINDNSARWTMPFLTGVRVRF* |
| Ga0157306_102251412 | 3300012912 | Soil | VFGQLGLRWVSGMSSVDRLEGTGLDTINDKSARWTLPFLAGARLRF* |
| Ga0163162_106397823 | 3300013306 | Switchgrass Rhizosphere | QLGLRWTSGLAEVDDLVGTGLDTINDKSSRWTIPFLAGVRYRF* |
| Ga0163162_125978491 | 3300013306 | Switchgrass Rhizosphere | MAEIDDLAGTGLDNINDKSARWTMPFIVGIHYRF* |
| Ga0163163_130704452 | 3300014325 | Switchgrass Rhizosphere | WTSGLAEVDDLVGTGLESINDKSSRWTIPFLAGVRYRF* |
| Ga0157380_131687151 | 3300014326 | Switchgrass Rhizosphere | AQIGLRYVTGMTEVDGLVGTGLETINDMSARWSLPILVGARLRF* |
| Ga0157377_100301581 | 3300014745 | Miscanthus Rhizosphere | VVLQMSSNIDMFGQVGIRWVSGMSAIDNLEGTGLETINDKSGRWTMPFLTGVRVRF* |
| Ga0180061_10873802 | 3300014861 | Soil | ILPIAEQFGLFGQLGFRYVTGMSEIDDIVGTGLETINDNSSRWTLPLVIGVRARF* |
| Ga0173483_108612111 | 3300015077 | Soil | QLGLRYVTGMSEVDGLAGTGLEEINDSSARWTLPFLVGVRARF* |
| Ga0173483_109926162 | 3300015077 | Soil | AAFTLGANAGLIVQAGKKFDVFGQVGLRWVSGMSSVDRLEGTGLDTINDNSARWTMPFLTGVRVRF* |
| Ga0173480_101642003 | 3300015200 | Soil | GVFGQVGIRYVTGMSEVDGLAGTGLETINDKSGRWTIPFLFGVRARF* |
| Ga0173478_101304232 | 3300015201 | Soil | QMSSNIDMFGQVGIRWVSGMSAIDNLEGTGLETINDKSGRWTMPFLTGVRVRF* |
| Ga0132258_107741124 | 3300015371 | Arabidopsis Rhizosphere | YTTGLAEVDNFPGTGLETINDHSSRWTLPFLVGVRVGF* |
| Ga0132256_1007654353 | 3300015372 | Arabidopsis Rhizosphere | VTGLSAVDNLAGTGLSSINDSSSRWTVPFVIGFRTRF* |
| Ga0132256_1015632101 | 3300015372 | Arabidopsis Rhizosphere | VFGQLGLRWVSGMSAVDGLAGTGLETINDNSARWTVPFVVGVRARF* |
| Ga0132255_1019591921 | 3300015374 | Arabidopsis Rhizosphere | MGLRWMTGLAEVDNLVGTGLDTINDKSSRWTVPFLVGVRYSF* |
| Ga0190266_100996311 | 3300017965 | Soil | RYVSGMSSVDGLAGTGLETINDKSSRWTMPFIAGVRFRF |
| Ga0190268_116525351 | 3300018466 | Soil | VTGMSEVDDLIGTGLETINDKSSRWTMPFVAGVRFRF |
| Ga0190270_106119561 | 3300018469 | Soil | KHIGYFGQLGLRYVGGMTEIDDLVGTGLDNINDKSARWTLPVIVGVHYRF |
| Ga0190270_131412821 | 3300018469 | Soil | SQVGLRWVSGMSAVDGLEGTGLETINDNSARWTLPFLIGVRARF |
| Ga0190270_131412822 | 3300018469 | Soil | MQLSERVGFFSQVGLRWVSGMSAVDGLEGTGLETINDNSARWTLPFLIGVR |
| Ga0190270_131516881 | 3300018469 | Soil | TGMADVDQLEDTSLETINDKSARTTFPFLLGVRFGFGN |
| Ga0190271_111336702 | 3300018481 | Soil | GLRWVSGMSEVDGLTGTGLETINDSSARWTLPFLVGVRARF |
| Ga0173479_105393811 | 3300019362 | Soil | SGMTEIDDLVGTGLDNINDKSARWTMPFIVGIHYRF |
| Ga0210379_102859242 | 3300021081 | Groundwater Sediment | GLRYVTGMSEVDGLAGTGLETINDKSARWTVPFLVGVRARF |
| Ga0207682_103098452 | 3300025893 | Miscanthus Rhizosphere | MSRSVDVFGQLGVRWVSGMSAIDNLEGTGLDTINDKSGRWTMPFLTGVRVRF |
| Ga0207688_104796861 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVGGMSAVDNLEGTSLDTINDNSARWTFPVLVGVRLSF |
| Ga0207643_108843811 | 3300025908 | Miscanthus Rhizosphere | QTAAFTLGGNAGVVLQMSRSVDVFGQLGVRWVSGMSAIDNLEGTGLDTINDKSGRWTMPFLTGVRVRF |
| Ga0207690_118705501 | 3300025932 | Corn Rhizosphere | GNAGVVLQMSRSVDVFGQLGVRWVSGMSAIDNLEGTGLDTINDKSGRWTMPFLTGVRVRF |
| Ga0207669_110691022 | 3300025937 | Miscanthus Rhizosphere | NTPRFGAFAQVGLRWTSGMAEIDDLEGTGLETINDKSARWTFPFIAGVRVGF |
| Ga0207669_113089072 | 3300025937 | Miscanthus Rhizosphere | GERIGVFGQVGLRWVSGMSAVDGLAGTGLETINDKSSRWTFPFIAGVRVQF |
| Ga0207704_118985591 | 3300025938 | Miscanthus Rhizosphere | SGMSAIDNLEGTGLDTINDKSGRWTVPFLTGVRFRF |
| Ga0207679_102776031 | 3300025945 | Corn Rhizosphere | VQAGKKFDVFGQVGLRWVSGMSSVDRLEGTGLDTINDNSARWTMPFLTGVRVRF |
| Ga0207651_106908291 | 3300025960 | Switchgrass Rhizosphere | GLRYVSGMAQIDDLVGTGLDNINDKSARWTLPFIVGVRYRF |
| Ga0207658_117894271 | 3300025986 | Switchgrass Rhizosphere | FAQVGLRWTSGMAEIDDLEGTGLETINDKSARWTFPFIAGVRVGF |
| Ga0207683_109014343 | 3300026121 | Miscanthus Rhizosphere | QLGVRWVSGMSAIDNLEGTGLDTINDKSGRWTMPFLTGVRVRF |
| Ga0207580_10080221 | 3300026829 | Soil | QVGLRWVSGMSSVDRLEGTGLDTINDNSARWTMPFLTGVRVRF |
| Ga0307280_100216731 | 3300028768 | Soil | IGLRFTSGMSEVDGLAGTGLETINDKSSRWTMPFIAGVRFRF |
| Ga0247824_107916441 | 3300028809 | Soil | FTLGGNGGVVLEMSSNIDMFGQVGLRWVSGMSAIDNLEGTGLETINDKSGRWTVPFLTGVRFRF |
| Ga0247826_112721451 | 3300030336 | Soil | MSSNIDMFGQAGIRWVSGMSAIDNLEGTGLETINDKSGRWTVPFLTGIRFRF |
| Ga0310888_100009526 | 3300031538 | Soil | GVMLEMSSNIDVFGQVGLRWVSGMSAIDNLEGTGLDTINDKSQRWTLPIIGGIQFRF |
| Ga0310887_104646692 | 3300031547 | Soil | RYTSGLAEVDNFPGTGLETINDHSSRWTLPFLVGVRVGF |
| Ga0307468_1008662011 | 3300031740 | Hardwood Forest Soil | GGLMFQTGERWDVFTQLGFRWMSGMADIDDLEATGLETINDKSSRWTMPLIAGVRFRF |
| Ga0315290_109575431 | 3300031834 | Sediment | MSGMSAVDGLAGTGLETINDNSSRWTMPIVFGVRARF |
| Ga0310904_106324032 | 3300031854 | Soil | IFVQAGLRYTTGMSEVDDLVGTGLETINDNSARWTLPILLGGRFRF |
| Ga0310900_109097022 | 3300031908 | Soil | FAQLGFRYVTGMSEVDDLEGTGLETINDSSSRWTFPLVLGIRARF |
| Ga0310891_101127211 | 3300031913 | Soil | MFQTGERWDLFTQVGFRWMSGMADIDDLEATGLDTINDKSSRWTMPFIAGIRYRF |
| Ga0307411_109404191 | 3300032005 | Rhizosphere | FGQMGLRYVTGMSDVDGLAGTGLEEINDSSARWTLPFLVGVRARF |
| Ga0310902_108398021 | 3300032012 | Soil | DVFGQVGLRWVSGMSAIDNLEGTGLDTINDKSGRWTVPFLTGVRFRF |
| Ga0315272_106424582 | 3300032018 | Sediment | IGMRWMSGMSAVDGLAGTGLEAINDTSSRWTLPFIIGVRTRF |
| Ga0310890_104662211 | 3300032075 | Soil | AQIGFRYVTGMSDVDDLTGTGLETINDKSARWTFPFMVGIRKRF |
| Ga0310890_107733051 | 3300032075 | Soil | LFPVLQNMGIFAQLGFRYVTGMSEVDDLEGTGLETINDSSSRWTFPLVLGIRARF |
| Ga0310890_110629761 | 3300032075 | Soil | GVFGQLGLRYVTGMSQVDGLAGTGLEDINDNSARWTLPFLVGVRARF |
| Ga0315912_104706721 | 3300032157 | Soil | GLRYVSGMTEIDDLVGTGLDNINDKSARWTLPVIVGVKYRF |
| Ga0315281_102394071 | 3300032163 | Sediment | LNPRVGVYSQLGLKWVSGMSAVDGLAGTGLESINDNSSRWTVPIVFGVRARF |
| Ga0310889_105917461 | 3300032179 | Soil | WVSGMSAVDGLAGTGLETINDNSARWTVPFVVGVRARF |
| Ga0310896_109036351 | 3300032211 | Soil | SGMADIDDLEATGLETINDKSSRWTMPLIAGVRFRF |
| Ga0315270_110666731 | 3300032275 | Sediment | GQVGLRWVTGLSAVDGLAGTGLEKINDNSSRWTLPIVIGVRARF |
| Ga0315275_106955662 | 3300032401 | Sediment | SGMSAVDGLAGTGLETINDNSSRWTMPIVFGVRARF |
| Ga0315273_123152581 | 3300032516 | Sediment | SGMSAVDGLAGTGLETINDNSSRWTMPIVFGVRTRF |
| Ga0316629_102650311 | 3300033483 | Soil | GLAQIDNLAGTGLETINDNSSRWTLPVMVGMRVRF |
| Ga0316616_1014840751 | 3300033521 | Soil | VFAQMGFRWVSGMSQIDGLAGTGLETINDKSARWTFPFIAGIRVRF |
| Ga0316616_1024360381 | 3300033521 | Soil | AQIGLRWTSGLAAIDDLAGTGLETINDNSSRWTMPIVVGMRVRF |
| Ga0247829_112539861 | 3300033550 | Soil | LRYVTGMSDVDGLAGTGLEEINDSSARWTLPFLVGVRARF |
| Ga0247830_103962463 | 3300033551 | Soil | LEMSSNIDMFGQAGIRWVSGMSAIDNLEGTGLETINDKSGRWTVPFLTGVRFRF |
| Ga0364924_118513_63_209 | 3300033811 | Sediment | MGIFGQVGLRWVSGMSAVDGLAGTGLETINDKSARWTFPFIAGIRARF |
| Ga0314780_206316_323_514 | 3300034659 | Soil | TLGGNGGVVLEMSSNVDMFGQAGIRWVSGMSPVDDLVGTGLESINDKSARWTLPFLVGVRVRF |
| ⦗Top⦘ |