


| Basic Information | |
|---|---|
| Family ID | F070176 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 45 residues |
| Representative Sequence | TFALIARVESNAWVAAAFGIIPLCVGLGFFLDSALIRRDLHA |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.44 % |
| % of genes near scaffold ends (potentially truncated) | 95.93 % |
| % of genes from short scaffolds (< 2000 bps) | 89.43 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.927 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.382 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.390 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.341 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF01878 | EVE | 15.45 |
| PF00753 | Lactamase_B | 7.32 |
| PF13155 | Toprim_2 | 1.63 |
| PF08275 | Toprim_N | 1.63 |
| PF01850 | PIN | 1.63 |
| PF00144 | Beta-lactamase | 1.63 |
| PF01202 | SKI | 1.63 |
| PF10543 | ORF6N | 0.81 |
| PF13091 | PLDc_2 | 0.81 |
| PF14690 | zf-ISL3 | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF13349 | DUF4097 | 0.81 |
| PF00440 | TetR_N | 0.81 |
| PF02922 | CBM_48 | 0.81 |
| PF07681 | DoxX | 0.81 |
| PF07321 | YscO | 0.81 |
| PF10647 | Gmad1 | 0.81 |
| PF13490 | zf-HC2 | 0.81 |
| PF07715 | Plug | 0.81 |
| PF13360 | PQQ_2 | 0.81 |
| PF02091 | tRNA-synt_2e | 0.81 |
| PF01431 | Peptidase_M13 | 0.81 |
| PF01361 | Tautomerase | 0.81 |
| PF11453 | DUF2950 | 0.81 |
| PF01807 | zf-CHC2 | 0.81 |
| PF00166 | Cpn10 | 0.81 |
| PF00905 | Transpeptidase | 0.81 |
| PF09594 | GT87 | 0.81 |
| PF04116 | FA_hydroxylase | 0.81 |
| PF07690 | MFS_1 | 0.81 |
| PF02719 | Polysacc_synt_2 | 0.81 |
| PF13442 | Cytochrome_CBB3 | 0.81 |
| PF02894 | GFO_IDH_MocA_C | 0.81 |
| PF01797 | Y1_Tnp | 0.81 |
| PF14224 | DUF4331 | 0.81 |
| PF07366 | SnoaL | 0.81 |
| PF06155 | GBBH-like_N | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 15.45 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 15.45 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 2.44 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.63 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.63 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.63 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.81 |
| COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.81 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.81 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.81 |
| COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.81 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.93 % |
| Unclassified | root | N/A | 17.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_105175755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300001593|JGI12635J15846_10343111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 918 | Open in IMG/M |
| 3300005177|Ga0066690_10677748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 685 | Open in IMG/M |
| 3300005180|Ga0066685_10989036 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005184|Ga0066671_10243081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1105 | Open in IMG/M |
| 3300005335|Ga0070666_10083043 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300005336|Ga0070680_100932508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 749 | Open in IMG/M |
| 3300005338|Ga0068868_102004052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 549 | Open in IMG/M |
| 3300005338|Ga0068868_102034827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 545 | Open in IMG/M |
| 3300005454|Ga0066687_10445640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 757 | Open in IMG/M |
| 3300005459|Ga0068867_100267983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1395 | Open in IMG/M |
| 3300005533|Ga0070734_10168309 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300005534|Ga0070735_10915626 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005541|Ga0070733_10491502 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005548|Ga0070665_101911140 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005554|Ga0066661_10943234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 505 | Open in IMG/M |
| 3300005564|Ga0070664_102168466 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005591|Ga0070761_10769504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
| 3300005617|Ga0068859_103024662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
| 3300005764|Ga0066903_105676138 | Not Available | 656 | Open in IMG/M |
| 3300005841|Ga0068863_102351833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 542 | Open in IMG/M |
| 3300005993|Ga0080027_10287365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 653 | Open in IMG/M |
| 3300005994|Ga0066789_10334654 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006059|Ga0075017_101467596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 537 | Open in IMG/M |
| 3300006358|Ga0068871_101228217 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300006358|Ga0068871_102251215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 519 | Open in IMG/M |
| 3300006358|Ga0068871_102348449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300006903|Ga0075426_10005851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 8760 | Open in IMG/M |
| 3300009148|Ga0105243_11540487 | Not Available | 690 | Open in IMG/M |
| 3300009177|Ga0105248_12773457 | Not Available | 559 | Open in IMG/M |
| 3300009519|Ga0116108_1149916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300009545|Ga0105237_10034908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5090 | Open in IMG/M |
| 3300009623|Ga0116133_1020004 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300009636|Ga0116112_1076159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300009665|Ga0116135_1327108 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300009700|Ga0116217_10529346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300009759|Ga0116101_1170322 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009824|Ga0116219_10036029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2967 | Open in IMG/M |
| 3300009839|Ga0116223_10894514 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300010373|Ga0134128_10940612 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300010376|Ga0126381_103551707 | Not Available | 612 | Open in IMG/M |
| 3300010379|Ga0136449_102232795 | Not Available | 797 | Open in IMG/M |
| 3300010401|Ga0134121_10228866 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300011120|Ga0150983_13020001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300011271|Ga0137393_11406502 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012189|Ga0137388_10502371 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300012202|Ga0137363_11074098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300012202|Ga0137363_11516909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300012349|Ga0137387_10433233 | Not Available | 954 | Open in IMG/M |
| 3300012582|Ga0137358_10146525 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300012683|Ga0137398_11178657 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012927|Ga0137416_10721531 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300012971|Ga0126369_12436099 | Not Available | 609 | Open in IMG/M |
| 3300013102|Ga0157371_11062035 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300014162|Ga0181538_10603197 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300014169|Ga0181531_10297197 | Not Available | 988 | Open in IMG/M |
| 3300014657|Ga0181522_10031250 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300014969|Ga0157376_11371154 | Not Available | 738 | Open in IMG/M |
| 3300015371|Ga0132258_10953036 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300015372|Ga0132256_100329161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1618 | Open in IMG/M |
| 3300015373|Ga0132257_103248770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300015374|Ga0132255_102797100 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300016270|Ga0182036_10033890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 3071 | Open in IMG/M |
| 3300016319|Ga0182033_12144086 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300016387|Ga0182040_11225907 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300016702|Ga0181511_1024142 | All Organisms → cellular organisms → Bacteria | 4945 | Open in IMG/M |
| 3300017928|Ga0187806_1376416 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300017933|Ga0187801_10223584 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300017934|Ga0187803_10136395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300017946|Ga0187879_10163349 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300017955|Ga0187817_10267325 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300017961|Ga0187778_10625304 | Not Available | 723 | Open in IMG/M |
| 3300018018|Ga0187886_1190791 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300018024|Ga0187881_10134356 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300018035|Ga0187875_10664160 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300018042|Ga0187871_10861065 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018043|Ga0187887_10116876 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300018086|Ga0187769_10061301 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
| 3300018089|Ga0187774_10315135 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300020580|Ga0210403_10086469 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
| 3300020580|Ga0210403_11355531 | Not Available | 541 | Open in IMG/M |
| 3300021170|Ga0210400_10726383 | Not Available | 816 | Open in IMG/M |
| 3300021170|Ga0210400_11020195 | Not Available | 672 | Open in IMG/M |
| 3300021181|Ga0210388_10971436 | Not Available | 729 | Open in IMG/M |
| 3300021405|Ga0210387_10747669 | Not Available | 865 | Open in IMG/M |
| 3300021433|Ga0210391_10365457 | Not Available | 1132 | Open in IMG/M |
| 3300021433|Ga0210391_11257142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300021475|Ga0210392_11436799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300021479|Ga0210410_10959687 | Not Available | 743 | Open in IMG/M |
| 3300022717|Ga0242661_1121479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 564 | Open in IMG/M |
| 3300024271|Ga0224564_1107267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300025917|Ga0207660_11281207 | Not Available | 595 | Open in IMG/M |
| 3300025938|Ga0207704_10031795 | All Organisms → cellular organisms → Bacteria | 2978 | Open in IMG/M |
| 3300026142|Ga0207698_10424016 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300026294|Ga0209839_10281960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300026328|Ga0209802_1084942 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300026329|Ga0209375_1277008 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300026343|Ga0209159_1111455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
| 3300026538|Ga0209056_10411033 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300026999|Ga0207949_1010228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300027521|Ga0209524_1031519 | Not Available | 1109 | Open in IMG/M |
| 3300027826|Ga0209060_10372792 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300027846|Ga0209180_10590588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300027853|Ga0209274_10103413 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300027879|Ga0209169_10129101 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300027905|Ga0209415_10302691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1377 | Open in IMG/M |
| 3300028037|Ga0265349_1029970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300028800|Ga0265338_10420896 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300029951|Ga0311371_12498170 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300029990|Ga0311336_10546510 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300030007|Ga0311338_12053163 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300030878|Ga0265770_1081502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 633 | Open in IMG/M |
| 3300031231|Ga0170824_118792201 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031708|Ga0310686_112231966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1845 | Open in IMG/M |
| 3300031821|Ga0318567_10354184 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031821|Ga0318567_10774105 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031938|Ga0308175_103084011 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031954|Ga0306926_10027914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6586 | Open in IMG/M |
| 3300032066|Ga0318514_10801525 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300032074|Ga0308173_10532745 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300032160|Ga0311301_11149647 | Not Available | 1002 | Open in IMG/M |
| 3300032205|Ga0307472_101108792 | Not Available | 749 | Open in IMG/M |
| 3300032892|Ga0335081_10040693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7383 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.13% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.32% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.25% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.25% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.63% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1051757552 | 3300000955 | Soil | YMVTFSLISRIESDAWIATAFGIIPFALGAGFLLDSYLIRRDAHGS* |
| JGI12635J15846_103431113 | 3300001593 | Forest Soil | MITFALIGRVESDAWVAAAFGIIPLSVGLGFFVDYALIRRDLHA* |
| Ga0066690_106777482 | 3300005177 | Soil | YISTFALIARVEHEAWMAAAFGIIPLAVGIGFFLDSALIRRDLRAS* |
| Ga0066685_109890361 | 3300005180 | Soil | TAGAIGYMATFALIARVEPDAWMAAAFGIIPLALGLGFFVDSALIRKDLHA* |
| Ga0066671_102430812 | 3300005184 | Soil | YMATFALIARVEPDAWMAAAFGIIPLALGLGFFVDSALIRKDLHA* |
| Ga0070666_100830431 | 3300005335 | Switchgrass Rhizosphere | TFSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS* |
| Ga0070680_1009325082 | 3300005336 | Corn Rhizosphere | LLVTGALGYIATFSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAT* |
| Ga0068868_1020040522 | 3300005338 | Miscanthus Rhizosphere | FSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS* |
| Ga0068868_1020348272 | 3300005338 | Miscanthus Rhizosphere | MIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS* |
| Ga0066687_104456401 | 3300005454 | Soil | TFGLIARVESDAWVAAAFGIIPLAVGLGFFLDWALIRRDSRA* |
| Ga0068867_1002679833 | 3300005459 | Miscanthus Rhizosphere | IARVESDAWTAAAFGIIPLAVGLGFFVDAYLIRRDLRAS* |
| Ga0070734_101683091 | 3300005533 | Surface Soil | FALIARVEPDAWIAGAFGIIPLSVGVGFFLDSAMVRRDVKSS* |
| Ga0070735_109156262 | 3300005534 | Surface Soil | IARAESDAWIAAAFGIIPLSVGIGFFVDSMLIRRDLHA* |
| Ga0070733_104915022 | 3300005541 | Surface Soil | TFALIARTDSDAWVAAAFGIIPLCVGVGFFVDATLVRRDARA* |
| Ga0070665_1019111401 | 3300005548 | Switchgrass Rhizosphere | YMATFGLIARVESDAWTAAAFGIIPLAVGLGFFVDAYLIRRDLRAS* |
| Ga0066661_109432341 | 3300005554 | Soil | FALIARVEPDAWMAAAFGIIPLALGLGFFVDSALIRKDLHA* |
| Ga0070664_1021684662 | 3300005564 | Corn Rhizosphere | FGLIARVESDAWTAAAFGIIPLAVGLGFFVDAYLIRRDLRAS* |
| Ga0070761_107695042 | 3300005591 | Soil | LGYMLTFALIARADSDAWLAAAFGIIPLSVGLGFFVDAALIRRDQHA* |
| Ga0068859_1030246621 | 3300005617 | Switchgrass Rhizosphere | RVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS* |
| Ga0066903_1056761381 | 3300005764 | Tropical Forest Soil | TFALIARVEPDAWVAASLGAIPFTLGLGFFLDSILVRRDLRTS* |
| Ga0068863_1023518332 | 3300005841 | Switchgrass Rhizosphere | VTGALGYIATFSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAT* |
| Ga0080027_102873652 | 3300005993 | Prmafrost Soil | AVGYIVAFGLVARFTEPEAWTAAAFGVIPLAVGMGFLLDWTLIRRDLRVSS* |
| Ga0066789_103346542 | 3300005994 | Soil | GILLVTGAIGYIGAFGLVARLTEPEAWTAAAFGVIPLAVGMGFLLDWTLIRRDLRTSS* |
| Ga0075017_1014675962 | 3300006059 | Watersheds | IGCCALIGRVEPDAWTAAAFGVIPLAVGLGFFVDFALIRRDVRAS* |
| Ga0068871_1012282173 | 3300006358 | Miscanthus Rhizosphere | ALIARVESDAWTAAAFGIIPLAVGLGFFVDAYLIRRDLRAS* |
| Ga0068871_1022512152 | 3300006358 | Miscanthus Rhizosphere | IARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS* |
| Ga0068871_1023484492 | 3300006358 | Miscanthus Rhizosphere | VEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS* |
| Ga0075426_100058511 | 3300006903 | Populus Rhizosphere | ALGYIGTFTLIARVEQDAWMAAAFGIIPLAIGVGFFVDSALIRRDLHAS* |
| Ga0105243_115404871 | 3300009148 | Miscanthus Rhizosphere | TFGLIARVESDAWTAAAFGIIPLAGGLGFVVDAYLIRRDLRAS* |
| Ga0105248_127734571 | 3300009177 | Switchgrass Rhizosphere | ATFSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS* |
| Ga0116108_11499162 | 3300009519 | Peatland | IGYMIAFALIARAEPDAWTAAAFGVIPLAVGIGFFLDSTLIRRDARA* |
| Ga0105237_100349081 | 3300009545 | Corn Rhizosphere | GLIARVESDAWTAAAFGIIPLAVGLGFFVDAYLIRRDLRAS* |
| Ga0116133_10200042 | 3300009623 | Peatland | GILLTSVAVGYIIAFALIARSEPDAWMASAFGVIPLAVGVGFFLDSTLIRRDARA* |
| Ga0116112_10761592 | 3300009636 | Peatland | GYMLTFGLIARVEPDAWVATSFRAIPLAVGVGYFIDALLIRRDLRASS* |
| Ga0116135_13271082 | 3300009665 | Peatland | MITFALIARVESDAWTAAAFGIIPLSIGIGFFVDSALIRRDLHA* |
| Ga0116217_105293462 | 3300009700 | Peatlands Soil | LVTGALGYMLTFALIARVESDAWIAAAFGIIPLSVGLGFFVDSALIRHDLHA* |
| Ga0116101_11703222 | 3300009759 | Peatland | GYMITFALIGRVESDAWTAAAFGIIPLSIGIGFFVDWALIRRDLHA* |
| Ga0116219_100360294 | 3300009824 | Peatlands Soil | RVESDAWMAAAFGIIPLSVGIGFFVDSALIRRDLHA* |
| Ga0116223_108945142 | 3300009839 | Peatlands Soil | GYMLTFALIARVESDAWIAAAFGIIPLSVGLGFFVDSALIRHDLHA* |
| Ga0134128_109406122 | 3300010373 | Terrestrial Soil | YIATFGLIARVESDAWTAAAFGIIPLAVGLGFFVDAYLIRRDLRAS* |
| Ga0126381_1035517071 | 3300010376 | Tropical Forest Soil | LGYTIAFGLIGRVEHDAWVAAALGLIPFAIGLGCFLDSALVRRDLRAS* |
| Ga0136449_1022327952 | 3300010379 | Peatlands Soil | MLTFALIARVESDAWMAAAFGIIPLSVGIGFFVDSALIRRDLHA* |
| Ga0134121_102288663 | 3300010401 | Terrestrial Soil | LGYIATFSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS* |
| Ga0150983_130200012 | 3300011120 | Forest Soil | GFVTTFALIARVEPDAWVAASFGAIPFTLGLGFFLDSTLVRRDMHAS* |
| Ga0137393_114065022 | 3300011271 | Vadose Zone Soil | FALIGRVEPDAFTAAAFGIIPTAIGFGYFLDSAMVRRDLHASN* |
| Ga0137388_105023711 | 3300012189 | Vadose Zone Soil | YMIAFALIARVESNAWVAAAFGVIPLTIGLGFFLDSALIRRDLRAS* |
| Ga0137363_110740982 | 3300012202 | Vadose Zone Soil | VEPDAWIAASFGAIPLTVGLGFFLDSALIRRDLRAS* |
| Ga0137363_115169092 | 3300012202 | Vadose Zone Soil | IGFVTTFALIARVEPDAWVAASFGAIPFTLGLGFFLDSTLVRRDMHPS* |
| Ga0137387_104332334 | 3300012349 | Vadose Zone Soil | ITFALIARVEPDAWVAASFGAIPFTVGLGFFLDSSLVRRDLRASA* |
| Ga0137358_101465253 | 3300012582 | Vadose Zone Soil | LVAGALGYMITFALIARTEPDAWTAVAFGAIPLALGLGFFLDATLVRRDLHV* |
| Ga0137398_111786572 | 3300012683 | Vadose Zone Soil | LGYMITFALIARTEPDAWTAAAFGAIPLALGLGFFVDSALVRRDLHA* |
| Ga0137416_107215311 | 3300012927 | Vadose Zone Soil | ITFSLIARDNPDAWNAVAFGAIPLALGLGFFLDSALVRRDLHA* |
| Ga0126369_124360992 | 3300012971 | Tropical Forest Soil | ATFALIARLEPEAWNAMAFGAIPLALGLGFFVDAFLVNRDLHA* |
| Ga0157371_110620351 | 3300013102 | Corn Rhizosphere | SDAWTAAAFGIIPLAVGLGFFVDAYLIRRDLRAS* |
| Ga0181538_106031972 | 3300014162 | Bog | LVTPSRSHFIARAEPDASVAAAFGVISLPVGIGFFLDSTLIRRDAKA* |
| Ga0181531_102971973 | 3300014169 | Bog | IVCCALLGREDVDIWRAAAFGVLPLSVGLGFFVDFALIRRDAKQIG* |
| Ga0181522_100312504 | 3300014657 | Bog | GYMATFALIARVQPDMWVAASFGIIPLALGAGFFVDSALVRKDLHG* |
| Ga0157376_113711542 | 3300014969 | Miscanthus Rhizosphere | ALGYIATFSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKA* |
| Ga0132258_109530361 | 3300015371 | Arabidopsis Rhizosphere | HDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS* |
| Ga0132256_1003291612 | 3300015372 | Arabidopsis Rhizosphere | IGYVATFAMIARVEPDAFIAASFGAIPFMLGLGFFLDSTLVRRDMQHAA* |
| Ga0132257_1032487702 | 3300015373 | Arabidopsis Rhizosphere | SRIESDAWIATAFGIIPFAIGAGFLLDSYLIRRDAHGS* |
| Ga0132255_1027971002 | 3300015374 | Arabidopsis Rhizosphere | VEPDAWLAAAFGIIPLALGLGCFLDSALIRRDLRAS* |
| Ga0182036_100338901 | 3300016270 | Soil | TAAAIGYMITFALIARVEPDAWVAASFGIIPLAVGVGFFLDAALVRRDVRTS |
| Ga0182033_121440862 | 3300016319 | Soil | ALIARVESDAWIAASFGLIPLAIGLGFFLDAALVRRDLRAS |
| Ga0182040_112259071 | 3300016387 | Soil | AAIGYMITFALIARVEPDAWVAASFGIIPLAVGVGFFLDAALVRRDVRTS |
| Ga0181511_10241421 | 3300016702 | Peatland | LVTPSRSHFIARAEPDASVAAAFGVISLPVGIGFFLDSTLIRRDAKA |
| Ga0187806_13764162 | 3300017928 | Freshwater Sediment | LGYMITFALISRYESDAWVAGAFGIIQLTVGLGFFLDSALIRRDLHS |
| Ga0187801_102235843 | 3300017933 | Freshwater Sediment | ALIARVESDAWIAAAFGIIPLSVGLGFFLDSALIRRDLHG |
| Ga0187803_101363951 | 3300017934 | Freshwater Sediment | SASIGYTVAFALIARAEPDAWVAAAFGVIPFAVGLGFFLDSTLVRRDLRAS |
| Ga0187879_101633491 | 3300017946 | Peatland | IAFALIARSEPDAWMASAFGVIPLAVGVGFFLDSTLIRRDARA |
| Ga0187817_102673252 | 3300017955 | Freshwater Sediment | MITFALISRYEHDAWVAGAFGIIPLTVGLGFFLDSALIRRDLHS |
| Ga0187778_106253042 | 3300017961 | Tropical Peatland | VAGAIGYMLTFGLIGRIESDAWIAAAFGILPLAVGLGFFLDSALIRRDLRAS |
| Ga0187886_11907911 | 3300018018 | Peatland | TSVAVGYIIAFALIARSEPDAWMASAFGVIPLAVGVGFFLDSTLIRRDARA |
| Ga0187881_101343561 | 3300018024 | Peatland | VAVGYIIAFALIARSEPDAWMASAFGVIPLAVGVGFFLDSTLIRRDARA |
| Ga0187875_106641601 | 3300018035 | Peatland | AGILLTSVAVGYIIAFALIARSEPDAWMASAFGVIPLAVGVGFFLDSTLIRRDARA |
| Ga0187871_108610652 | 3300018042 | Peatland | ALIARTDSDAWVAAAFGIIPLCVGVGFFVDSTLVRRDARV |
| Ga0187887_101168761 | 3300018043 | Peatland | FALIARSEPDAWMASAFGVIPLAVGVGFFLDSTLIRRDARA |
| Ga0187769_100613014 | 3300018086 | Tropical Peatland | ALGYMITFALIARVEQDAWIAGAFGVIPLTLGLGFFLDAALVRRDARHS |
| Ga0187774_103151354 | 3300018089 | Tropical Peatland | ALISRVEPDAWIAGAFGIIPFTVGLGFFLDSFLVRRDLKSS |
| Ga0210403_100864691 | 3300020580 | Soil | MLTFALIGRMEPDAWVAGTFGVIPFTIGLGFFLDSALVRRDARHS |
| Ga0210403_113555311 | 3300020580 | Soil | MITFALIARMESDAWFAAAFGIIPLSVGLGFFVDSALIRRDVHA |
| Ga0210400_107263831 | 3300021170 | Soil | VESEAWVAAAFGIIPLSIGIGFFVDSALIRRDQHA |
| Ga0210400_110201951 | 3300021170 | Soil | IARAESDAWIAATFGIIPLSVGLGFFVDSMLIRRDLHA |
| Ga0210388_109714362 | 3300021181 | Soil | ALIARVESDAWTAAAFGIIPLSIGIGFFVDSALIRRDLHA |
| Ga0210387_107476691 | 3300021405 | Soil | ALIARIESDAWVAAAFGIIPLSIGLGFFVDSALIRRDLRA |
| Ga0210391_103654571 | 3300021433 | Soil | YMLTFALIARTESDAWIAAAFGIIPLSVGLGFFVDSALIRRDLHA |
| Ga0210391_112571422 | 3300021433 | Soil | LIARVESDAWLAAAFGAIPFTLGLGFFLDSALIRRDAHPS |
| Ga0210392_114367991 | 3300021475 | Soil | TFALIARVESNAWVAAAFGIIPLCVGLGFFLDSALIRRDLHA |
| Ga0210410_109596872 | 3300021479 | Soil | TFALIARVESDAWMAAAFGIIPLSVGIGFFVDSALIRRDQHA |
| Ga0242661_11214791 | 3300022717 | Soil | LTFALIARVESEAWIAAAFGIIPLSVGLGFFLDSALIRRDLHA |
| Ga0224564_11072672 | 3300024271 | Soil | RVESDAWIAAAFGIIPLSVGFGFFLDSALIRRDLHA |
| Ga0207660_112812072 | 3300025917 | Corn Rhizosphere | LVTGALGYIATFSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAT |
| Ga0207704_100317954 | 3300025938 | Miscanthus Rhizosphere | IATFSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS |
| Ga0207698_104240161 | 3300026142 | Corn Rhizosphere | GALGYIATFSMIARVEHDAWVAASFGIIPLAVGLGYFLDSALIRRDVKAS |
| Ga0209839_102819602 | 3300026294 | Soil | GAIGYIAAFGLVARLTEPEAWTAAAFGVIPLAVGMGFLLDWTLIRRDLRVSS |
| Ga0209802_10849422 | 3300026328 | Soil | FVTTFALIARVEPDAWVAASFGAIPFTLGLGFFLDSTLVRRDMHPS |
| Ga0209375_12770081 | 3300026329 | Soil | TAGAIGYMATFALIARVEPDAWMAAAFGIIPLALGLGFFVDSALIRKDLHA |
| Ga0209159_11114551 | 3300026343 | Soil | MATFALIARVEPDAWMAAAFGIIPLALGLGFFVDSALIRKDLHA |
| Ga0209056_104110331 | 3300026538 | Soil | ISTFALIARVEHEAWMAAAFGIIPLAVGIGFFLDSALIRRDLGAS |
| Ga0207949_10102283 | 3300026999 | Forest Soil | TFALIARVEPDAWVAAPFGAIPFTLGLGFFLDSTLVRRDMHAS |
| Ga0209524_10315192 | 3300027521 | Forest Soil | AGAIGYMITFTLIARVERDAWIAASFGAIPLTVGLGFFLDSALIRRDLRAS |
| Ga0209060_103727921 | 3300027826 | Surface Soil | FALIARVEPDAWIAGAFGIIPLSVGVGFFLDSAMVRRDVKSS |
| Ga0209180_105905881 | 3300027846 | Vadose Zone Soil | LVIGALGYMLTFALIARIESEPDVWTAAAFGVIPLAVGIGYFLDATLIRRDLRASS |
| Ga0209274_101034133 | 3300027853 | Soil | VITFALIARVEPDAWTAAAFGIIPLSIGIGFFVDSALIRRDLHA |
| Ga0209169_101291011 | 3300027879 | Soil | TFALIARADSDAWLAAAFGIIPLSVGLGFFVDAALIRRDQHA |
| Ga0209415_103026912 | 3300027905 | Peatlands Soil | LVTGALGYMLTFALIARVESDAWIAAAFGIIPLSVGLGFFVDSALIRHDLHA |
| Ga0265349_10299701 | 3300028037 | Soil | LGYMLTFALIARVESQAWIAAAFGIIPLSVGLGFFVDYALIRRDQHA |
| Ga0265338_104208962 | 3300028800 | Rhizosphere | YMIAFALVARTEPDAWVAAAFGVIPLAIGIGFFLDSTLIRRDAQS |
| Ga0311371_124981701 | 3300029951 | Palsa | LGYSIAFSLIGHVDADAHIAAAFGIIPFAVGLGFFLDSVLIKRDLKA |
| Ga0311336_105465101 | 3300029990 | Fen | ALGYMATFGMIARVESDAWIAAAFGIIPLAIGLGFFVDSALIHRDARAS |
| Ga0311338_120531631 | 3300030007 | Palsa | FILIARIEPDAWVAAAFGAIPLALGIGFFVDSALIHRDARAS |
| Ga0265770_10815022 | 3300030878 | Soil | FALIARVESNAWIAAAFGIIPLSVGLGFFLDSALIRRDLHA |
| Ga0170824_1187922012 | 3300031231 | Forest Soil | TFALIARVEHDAWIAASFGIIPLAVGLGFFLDSTLVRRDLRAL |
| Ga0310686_1122319661 | 3300031708 | Soil | IGRVESDAWVAAAFGIIPLSVGLGFFVDSALIRRDLHA |
| Ga0318567_103541841 | 3300031821 | Soil | SRLEPDALIAAAFGIIPLCVGIGYFVDFALLRRDQIA |
| Ga0318567_107741051 | 3300031821 | Soil | LTAAAIGYMITFALIARVEPDAWVAASFGIIPLAVGVGFFLDAALVRRDVRTS |
| Ga0308175_1030840111 | 3300031938 | Soil | ATFALIGRVEQDAWTAAAFGIIPLAIGLGFFVDWALIRRDARA |
| Ga0306926_100279141 | 3300031954 | Soil | RLEPDALIAAAFGIIPLCVGIGYFVDFALLRRDQIA |
| Ga0318514_108015251 | 3300032066 | Soil | LGYIATFALISRLEPDALIAAAFGIIPLCVGIGYFVDFALLRRDQIA |
| Ga0308173_105327451 | 3300032074 | Soil | LGYMATFALIGRVEQDAWTAAAFGIIPLAIGLGFFVDWALIRRDARA |
| Ga0311301_111496473 | 3300032160 | Peatlands Soil | YMLTFALIARVESDAWMAAAFGIIPLSVGIGFFVDSALIRRDLHA |
| Ga0307472_1011087921 | 3300032205 | Hardwood Forest Soil | VITFALIAKVEPDAWVAASFGAIPFTVGLGFFLDSTLVRRDLKASA |
| Ga0335081_100406931 | 3300032892 | Soil | GYIATFALLARVEHEAWMAAAFGVIPLALGVGFFLDSALIRRDLRA |
| ⦗Top⦘ |