


| Basic Information | |
|---|---|
| Family ID | F070121 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSNKR |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.83 % |
| % of genes near scaffold ends (potentially truncated) | 20.33 % |
| % of genes from short scaffolds (< 2000 bps) | 60.16 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.780 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (30.894 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.220 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (45.528 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF02739 | 5_3_exonuc_N | 7.32 |
| PF04297 | UPF0122 | 4.07 |
| PF08299 | Bac_DnaA_C | 3.25 |
| PF12684 | DUF3799 | 3.25 |
| PF13481 | AAA_25 | 2.44 |
| PF01555 | N6_N4_Mtase | 1.63 |
| PF14550 | Peptidase_S78_2 | 1.63 |
| PF02086 | MethyltransfD12 | 1.63 |
| PF04404 | ERF | 1.63 |
| PF11753 | DUF3310 | 1.63 |
| PF01541 | GIY-YIG | 0.81 |
| PF00149 | Metallophos | 0.81 |
| PF12855 | Ecl1 | 0.81 |
| PF01501 | Glyco_transf_8 | 0.81 |
| PF00959 | Phage_lysozyme | 0.81 |
| PF03237 | Terminase_6N | 0.81 |
| PF00182 | Glyco_hydro_19 | 0.81 |
| PF05766 | NinG | 0.81 |
| PF00988 | CPSase_sm_chain | 0.81 |
| PF05257 | CHAP | 0.81 |
| PF13539 | Peptidase_M15_4 | 0.81 |
| PF00176 | SNF2-rel_dom | 0.81 |
| PF05105 | Phage_holin_4_1 | 0.81 |
| PF04466 | Terminase_3 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 7.32 |
| COG2739 | Predicted DNA-binding protein YlxM, UPF0122 family | Transcription [K] | 4.07 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 3.25 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.63 |
| COG0505 | Carbamoylphosphate synthase small subunit | Amino acid transport and metabolism [E] | 1.63 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.63 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.63 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.63 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.63 |
| COG1442 | Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.81 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 0.81 |
| COG5597 | N-acetylglucosaminyl transferase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.22 % |
| Unclassified | root | N/A | 48.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10063939 | Not Available | 954 | Open in IMG/M |
| 3300000792|BS_KBA_SWE02_21mDRAFT_10115942 | Not Available | 673 | Open in IMG/M |
| 3300002835|B570J40625_100272142 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
| 3300002835|B570J40625_100611821 | Not Available | 995 | Open in IMG/M |
| 3300003277|JGI25908J49247_10020096 | All Organisms → Viruses → Predicted Viral | 1993 | Open in IMG/M |
| 3300003277|JGI25908J49247_10148710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300003277|JGI25908J49247_10153964 | Not Available | 536 | Open in IMG/M |
| 3300003393|JGI25909J50240_1059309 | Not Available | 784 | Open in IMG/M |
| 3300003393|JGI25909J50240_1084126 | Not Available | 636 | Open in IMG/M |
| 3300003394|JGI25907J50239_1063819 | Not Available | 735 | Open in IMG/M |
| 3300003412|JGI25912J50252_10003671 | Not Available | 5212 | Open in IMG/M |
| 3300003429|JGI25914J50564_10148962 | Not Available | 563 | Open in IMG/M |
| 3300004282|Ga0066599_100227125 | Not Available | 1041 | Open in IMG/M |
| 3300004481|Ga0069718_10111459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1931 | Open in IMG/M |
| 3300005581|Ga0049081_10005640 | All Organisms → Viruses → Predicted Viral | 4727 | Open in IMG/M |
| 3300005581|Ga0049081_10170564 | Not Available | 790 | Open in IMG/M |
| 3300006484|Ga0070744_10000576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10712 | Open in IMG/M |
| 3300006484|Ga0070744_10139883 | Not Available | 696 | Open in IMG/M |
| 3300006805|Ga0075464_10000197 | Not Available | 25785 | Open in IMG/M |
| 3300006805|Ga0075464_10012563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4211 | Open in IMG/M |
| 3300006920|Ga0070748_1189133 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 755 | Open in IMG/M |
| 3300006920|Ga0070748_1280817 | Not Available | 594 | Open in IMG/M |
| 3300007538|Ga0099851_1041684 | All Organisms → Viruses → Predicted Viral | 1818 | Open in IMG/M |
| 3300007538|Ga0099851_1237665 | Not Available | 654 | Open in IMG/M |
| 3300007538|Ga0099851_1276218 | Not Available | 596 | Open in IMG/M |
| 3300007538|Ga0099851_1306714 | Not Available | 559 | Open in IMG/M |
| 3300007538|Ga0099851_1316377 | Not Available | 549 | Open in IMG/M |
| 3300007542|Ga0099846_1018685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2702 | Open in IMG/M |
| 3300007542|Ga0099846_1269644 | Not Available | 588 | Open in IMG/M |
| 3300007972|Ga0105745_1023109 | All Organisms → Viruses → Predicted Viral | 1575 | Open in IMG/M |
| 3300008450|Ga0114880_1166605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300009009|Ga0105105_10540917 | Not Available | 672 | Open in IMG/M |
| 3300009026|Ga0102829_1002447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5128 | Open in IMG/M |
| 3300009082|Ga0105099_10112790 | All Organisms → Viruses → Predicted Viral | 1503 | Open in IMG/M |
| 3300009163|Ga0114970_10361321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300009168|Ga0105104_10572695 | Not Available | 641 | Open in IMG/M |
| 3300009169|Ga0105097_10010536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4777 | Open in IMG/M |
| 3300009169|Ga0105097_10031597 | Not Available | 2827 | Open in IMG/M |
| 3300009169|Ga0105097_10267897 | Not Available | 942 | Open in IMG/M |
| 3300009169|Ga0105097_10546873 | Not Available | 649 | Open in IMG/M |
| 3300009169|Ga0105097_10584769 | Not Available | 628 | Open in IMG/M |
| 3300009169|Ga0105097_10806893 | Not Available | 535 | Open in IMG/M |
| 3300010357|Ga0116249_10583923 | Not Available | 1025 | Open in IMG/M |
| 3300010368|Ga0129324_10257979 | Not Available | 693 | Open in IMG/M |
| 3300010885|Ga0133913_11425828 | All Organisms → Viruses → Predicted Viral | 1760 | Open in IMG/M |
| 3300011115|Ga0151514_10354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20389 | Open in IMG/M |
| 3300011335|Ga0153698_1166 | All Organisms → Viruses | 31557 | Open in IMG/M |
| 3300011335|Ga0153698_1465 | Not Available | 16883 | Open in IMG/M |
| 3300011336|Ga0153703_1718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10336 | Open in IMG/M |
| 3300012348|Ga0157140_10000030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 33120 | Open in IMG/M |
| 3300012665|Ga0157210_1007767 | Not Available | 2008 | Open in IMG/M |
| 3300013006|Ga0164294_11151600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300017701|Ga0181364_1007563 | All Organisms → Viruses → Predicted Viral | 1861 | Open in IMG/M |
| 3300017723|Ga0181362_1045249 | Not Available | 922 | Open in IMG/M |
| 3300017761|Ga0181356_1022790 | All Organisms → Viruses → Predicted Viral | 2286 | Open in IMG/M |
| 3300017774|Ga0181358_1126997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
| 3300017777|Ga0181357_1231268 | Not Available | 649 | Open in IMG/M |
| 3300017780|Ga0181346_1110674 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
| 3300017784|Ga0181348_1038132 | All Organisms → Viruses → Predicted Viral | 2000 | Open in IMG/M |
| 3300017785|Ga0181355_1007082 | All Organisms → Viruses | 4949 | Open in IMG/M |
| 3300017785|Ga0181355_1013042 | All Organisms → Viruses → Predicted Viral | 3655 | Open in IMG/M |
| 3300017785|Ga0181355_1071022 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300017785|Ga0181355_1173073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300017785|Ga0181355_1279286 | Not Available | 633 | Open in IMG/M |
| 3300019783|Ga0181361_100423 | All Organisms → Viruses → Predicted Viral | 2417 | Open in IMG/M |
| 3300019784|Ga0181359_1001776 | Not Available | 6000 | Open in IMG/M |
| 3300019784|Ga0181359_1004448 | All Organisms → Viruses → Predicted Viral | 4451 | Open in IMG/M |
| 3300019784|Ga0181359_1058587 | All Organisms → Viruses → Predicted Viral | 1477 | Open in IMG/M |
| 3300019784|Ga0181359_1074224 | All Organisms → Viruses → Predicted Viral | 1284 | Open in IMG/M |
| 3300019784|Ga0181359_1094498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
| 3300019784|Ga0181359_1147101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300019784|Ga0181359_1255737 | Not Available | 528 | Open in IMG/M |
| 3300020048|Ga0207193_1613220 | Not Available | 723 | Open in IMG/M |
| 3300020048|Ga0207193_1876907 | Not Available | 508 | Open in IMG/M |
| 3300020561|Ga0207934_1001459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3451 | Open in IMG/M |
| 3300022164|Ga0212022_1076596 | Not Available | 513 | Open in IMG/M |
| 3300022190|Ga0181354_1074260 | Not Available | 1126 | Open in IMG/M |
| 3300022190|Ga0181354_1203407 | Not Available | 588 | Open in IMG/M |
| 3300022200|Ga0196901_1007511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4743 | Open in IMG/M |
| 3300022200|Ga0196901_1100197 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300022407|Ga0181351_1007986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4202 | Open in IMG/M |
| 3300022407|Ga0181351_1198690 | Not Available | 672 | Open in IMG/M |
| 3300022407|Ga0181351_1204104 | Not Available | 657 | Open in IMG/M |
| 3300024346|Ga0244775_10002446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20212 | Open in IMG/M |
| 3300025647|Ga0208160_1050570 | Not Available | 1183 | Open in IMG/M |
| 3300025896|Ga0208916_10000283 | Not Available | 25770 | Open in IMG/M |
| 3300025896|Ga0208916_10016964 | All Organisms → Viruses → Predicted Viral | 2862 | Open in IMG/M |
| 3300027193|Ga0208800_1006888 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
| 3300027659|Ga0208975_1006053 | All Organisms → Viruses → Predicted Viral | 4402 | Open in IMG/M |
| 3300027721|Ga0209492_1000545 | All Organisms → Viruses | 11739 | Open in IMG/M |
| 3300027721|Ga0209492_1002821 | Not Available | 5483 | Open in IMG/M |
| 3300027721|Ga0209492_1238002 | Not Available | 619 | Open in IMG/M |
| 3300027764|Ga0209134_10101271 | Not Available | 984 | Open in IMG/M |
| 3300027764|Ga0209134_10220301 | Not Available | 652 | Open in IMG/M |
| 3300027764|Ga0209134_10267439 | Not Available | 584 | Open in IMG/M |
| 3300027798|Ga0209353_10000771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18826 | Open in IMG/M |
| 3300027808|Ga0209354_10011840 | All Organisms → Viruses → Predicted Viral | 3492 | Open in IMG/M |
| 3300027900|Ga0209253_10108495 | All Organisms → Viruses → Predicted Viral | 2269 | Open in IMG/M |
| 3300028027|Ga0247722_10005816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5715 | Open in IMG/M |
| 3300032046|Ga0315289_11111060 | Not Available | 649 | Open in IMG/M |
| 3300032053|Ga0315284_11607434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300032092|Ga0315905_11562596 | Not Available | 514 | Open in IMG/M |
| 3300033552|Ga0326734_1000069 | All Organisms → cellular organisms → Bacteria | 36640 | Open in IMG/M |
| 3300033984|Ga0334989_0073430 | All Organisms → Viruses → Predicted Viral | 1890 | Open in IMG/M |
| 3300033995|Ga0335003_0049533 | All Organisms → Viruses → Predicted Viral | 2256 | Open in IMG/M |
| 3300034022|Ga0335005_0074689 | All Organisms → Viruses → Predicted Viral | 2248 | Open in IMG/M |
| 3300034022|Ga0335005_0725940 | Not Available | 522 | Open in IMG/M |
| 3300034050|Ga0335023_0000060 | Not Available | 65291 | Open in IMG/M |
| 3300034068|Ga0334990_0000281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 31124 | Open in IMG/M |
| 3300034071|Ga0335028_0000568 | All Organisms → Viruses | 27050 | Open in IMG/M |
| 3300034105|Ga0335035_0000494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30976 | Open in IMG/M |
| 3300034105|Ga0335035_0005775 | Not Available | 8324 | Open in IMG/M |
| 3300034107|Ga0335037_0138095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300034117|Ga0335033_0013339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5572 | Open in IMG/M |
| 3300034121|Ga0335058_0791798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300034167|Ga0335017_0009151 | Not Available | 5455 | Open in IMG/M |
| 3300034167|Ga0335017_0011282 | All Organisms → Viruses | 4991 | Open in IMG/M |
| 3300034167|Ga0335017_0279390 | Not Available | 936 | Open in IMG/M |
| 3300034168|Ga0335061_0216280 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300034356|Ga0335048_0132626 | Not Available | 1451 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 30.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.63% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 11.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 4.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.44% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.44% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.63% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.63% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.63% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.63% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.81% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.81% |
| Ice | Environmental → Aquatic → Freshwater → Ice → Glacier → Ice | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.81% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.81% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.81% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.81% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.81% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.81% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033552 | Glacier ice microbial communities from Ngari, Tibet, China - 15_GP2_131.5 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE12_21mDRAFT_100639395 | 3300000124 | Marine | MTKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSKR* |
| BS_KBA_SWE02_21mDRAFT_101159423 | 3300000792 | Marine | MKSKQSAIQRINRIMDFLWKRGDNKESVNKVYRKIINQKLLKQ* |
| B570J40625_1002721426 | 3300002835 | Freshwater | MTRSKQSALQRIQRIMKFNYNRGLNSERVNEIYRKIINLKLSNQK* |
| B570J40625_1006118213 | 3300002835 | Freshwater | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIINQRLSNKR* |
| JGI25908J49247_100200961 | 3300003277 | Freshwater Lake | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSNKR* |
| JGI25908J49247_101487103 | 3300003277 | Freshwater Lake | MTKSKQSALQRIQRIMKFNYNRGLNSERVNEIYRKIINLKLSNQK* |
| JGI25908J49247_101539642 | 3300003277 | Freshwater Lake | MTKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLLKQ* |
| JGI25909J50240_10593092 | 3300003393 | Freshwater Lake | MTKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQXLLKQ* |
| JGI25909J50240_10841262 | 3300003393 | Freshwater Lake | MKVKQSPLQRIQRVMKFNYNRGLNSERVNAVYRKIIKLKLEGSN* |
| JGI25907J50239_10638194 | 3300003394 | Freshwater Lake | MTKSKQSPLQRINRIIDFNWKRGNNKESVNEVYRKIINQRLL |
| JGI25912J50252_100036713 | 3300003412 | Freshwater Lake | MTKSKQSPLQRINRIIDFNWKRGNNKESVNEVYRKIINQRLLKQ* |
| JGI25914J50564_101489621 | 3300003429 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSNKR* |
| Ga0066599_1002271254 | 3300004282 | Freshwater | MKQSPLQRIQRIMKFNYNRGLNSERVNAVYRKIIKQKLEGSN* |
| Ga0069718_101114592 | 3300004481 | Sediment | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIERLSQKR* |
| Ga0049081_1000564012 | 3300005581 | Freshwater Lentic | MSVIKKKQSPLQRINRIMKFYASRGVNSERVNEVYRKIINIKLLL* |
| Ga0049081_101705642 | 3300005581 | Freshwater Lentic | MTRSKQSALQRIQRIMKFNYNRGLNSERVNEVYRKIINLKLSNQK* |
| Ga0070744_1000057622 | 3300006484 | Estuarine | MKSKQSALQRINRIMDFLWKRGNNKESVNEVYRKIINERLSKR* |
| Ga0070744_101398832 | 3300006484 | Estuarine | MTKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSNKR* |
| Ga0075464_1000019730 | 3300006805 | Aqueous | MKKQLSPKQRINRIMDFYYKRGVNKESVVNVYRKIIALKFA* |
| Ga0075464_100125636 | 3300006805 | Aqueous | MKSKQSPLQRINRIIDFNWKRGTNKESINNVYRNIINLKLSKR* |
| Ga0070748_11891332 | 3300006920 | Aqueous | MKNKQSNWQRINRVMDFLWKRGDNKESVNDVYRKVLKERLSQKR* |
| Ga0070748_12808171 | 3300006920 | Aqueous | WQRINRVMDFLWKRGDNKESVNDVYRKVLKERLSQKR* |
| Ga0099851_10416843 | 3300007538 | Aqueous | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQRLLKQ* |
| Ga0099851_12376653 | 3300007538 | Aqueous | MAKQSALQRINRIIEFNYKRGINKESVNDVHRKIIKP |
| Ga0099851_12762183 | 3300007538 | Aqueous | MAKQSPLQRINRIIEFNYKRGINKESVNDVHRKIIKPRYE |
| Ga0099851_13067142 | 3300007538 | Aqueous | MKSKESPLQRVLKILDFNHKRGNNKESVNKVYRKIINQNLKEYIK* |
| Ga0099851_13163772 | 3300007538 | Aqueous | MTKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQ |
| Ga0099846_10186853 | 3300007542 | Aqueous | MKSKQSPLQRINRIMDFLWKRGNNKESVNNVYRKIINQRLLSK* |
| Ga0099846_12696441 | 3300007542 | Aqueous | MTKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQRLLKQ* |
| Ga0105745_10231096 | 3300007972 | Estuary Water | MTRSKQSALQRIQRIMKFNYNRGLNSERVNEIYRKIINEKLSVKR* |
| Ga0114880_11666053 | 3300008450 | Freshwater Lake | MTKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIINERLSQKR* |
| Ga0105105_105409173 | 3300009009 | Freshwater Sediment | MKQSPLQRILRIMKFNYNRGLNSERVNAVYRKIIKLKLEGSN* |
| Ga0102829_10024471 | 3300009026 | Estuarine | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSQKR* |
| Ga0105099_101127903 | 3300009082 | Freshwater Sediment | MKSKQSPLQRINRIIDFNWKRGNNKESVNEVYRKIINQRLLKQ* |
| Ga0114970_103613213 | 3300009163 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIINLKLQKNANTTTKSR* |
| Ga0105104_105726951 | 3300009168 | Freshwater Sediment | MKSKQAALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSKKV* |
| Ga0105097_100105367 | 3300009169 | Freshwater Sediment | MKSKQSPLQRINRIIDFNWKRGNNKESVNNVYRKIINERLSQKR* |
| Ga0105097_100315972 | 3300009169 | Freshwater Sediment | MTRSKQSALQRIQRIMKFNYNRGLNSERVNKIYRKIINLKLSNQK* |
| Ga0105097_102678971 | 3300009169 | Freshwater Sediment | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSKKV* |
| Ga0105097_105468731 | 3300009169 | Freshwater Sediment | MAKQSALQRINRIIEFNYKRGINKESVNDVHRKIIKPK |
| Ga0105097_105847691 | 3300009169 | Freshwater Sediment | SKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSKKN* |
| Ga0105097_108068933 | 3300009169 | Freshwater Sediment | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLAKKV* |
| Ga0105096_100024065 | 3300009170 | Freshwater Sediment | MKQSPLQRINRIMNFYYHRGQNRENVNEVYRKIINLKKK* |
| Ga0116249_105839231 | 3300010357 | Anaerobic Digestor Sludge | KIIIMKSKQSPLIRINRIIKLYYKRGQNRESVNNVYRKIIFKKK* |
| Ga0129324_102579791 | 3300010368 | Freshwater To Marine Saline Gradient | LQRINRIIDFNWKRGNNKESVNEVYRKIINQRLLKQ* |
| Ga0133913_114258285 | 3300010885 | Freshwater Lake | MKNKQTCLQRINRVMKFNYNRGLNSERVNAVYRKIIKLKFKGSN* |
| Ga0151514_1035437 | 3300011115 | Freshwater | MTKSKQSALQRIQRIMKFNYNRGLNSERVNEIYIKIINLKLKTNANTTT* |
| Ga0153698_116640 | 3300011335 | Freshwater | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIERLSNKR* |
| Ga0153698_146518 | 3300011335 | Freshwater | MKSKQTPLQRIQRVMKFNYNRGLNSERVNAVYRKIIKLKLEGSN* |
| Ga0153703_171820 | 3300011336 | Freshwater | MKSKQSALQRIQRILKFNYNRGLNSERVNEVYRKIINLKLKTNANTTT* |
| Ga0157140_1000003014 | 3300012348 | Freshwater | MKQSPLQRILRVMKFNYNRGLNSERVNAVYRKIIKLKLEGSN* |
| Ga0157138_10700063 | 3300012352 | Freshwater | MKQSPLQRIQRIMKFNYNRGLNSERVNAVYRKIIK |
| Ga0157210_10077675 | 3300012665 | Freshwater | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIMIERLSQKR* |
| Ga0164294_111516002 | 3300013006 | Freshwater | MKSKQSPLQRINRIMDFLWKRGDNKESVNEVYRKIIIQKLSNKR* |
| Ga0181364_10075635 | 3300017701 | Freshwater Lake | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIIIQKLSNKR |
| Ga0181362_10452494 | 3300017723 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSQKFSSS |
| Ga0181356_10227901 | 3300017761 | Freshwater Lake | MKSKQSPLQRINRIMDFNWKRGNNKESVNEVYRKIINQKLSKR |
| Ga0181358_11269973 | 3300017774 | Freshwater Lake | MTKSKQSALQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSNKR |
| Ga0181357_12312681 | 3300017777 | Freshwater Lake | SNMTRSKQSALQRIQRIMKFNYNRGLNSERVNEIYRKIINLKLSNQK |
| Ga0181346_11106744 | 3300017780 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIINQRLSQKR |
| Ga0181348_10381326 | 3300017784 | Freshwater Lake | MSVIKKKQSPLQRINRIMKFYASRGINSERVNEVYRKIINIKLLL |
| Ga0181355_100708216 | 3300017785 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEEYRKIIIQKLSNKR |
| Ga0181355_10130429 | 3300017785 | Freshwater Lake | MTKSKQSALQRIQRIMKFNYNRGLNSERVNEVYRKIINLKLSNQK |
| Ga0181355_10710226 | 3300017785 | Freshwater Lake | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKI |
| Ga0181355_11730732 | 3300017785 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIERLSQKR |
| Ga0181355_12792863 | 3300017785 | Freshwater Lake | MTKSKQSALQRINRIMDFLWKRGNNKESVNEVYRKIINQRLSQKR |
| Ga0181361_1004234 | 3300019783 | Freshwater Lake | MKQSPLQRILRIMKFNYNRGLNSERVNAVYRKIIKLKLEGSN |
| Ga0181359_10017764 | 3300019784 | Freshwater Lake | MKVKQSPLQRIQRVMKFNYNRGLNSERVNAVYRKIIKLKLEGSN |
| Ga0181359_100444812 | 3300019784 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSNKR |
| Ga0181359_10585871 | 3300019784 | Freshwater Lake | MTKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIINERLSQKR |
| Ga0181359_10742243 | 3300019784 | Freshwater Lake | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSNKR |
| Ga0181359_10944981 | 3300019784 | Freshwater Lake | MTKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSN |
| Ga0181359_11471013 | 3300019784 | Freshwater Lake | MTKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSNKR |
| Ga0181359_12557371 | 3300019784 | Freshwater Lake | MTKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIERLSNKR |
| Ga0207193_16132204 | 3300020048 | Freshwater Lake Sediment | HIMKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLAKKN |
| Ga0207193_18769071 | 3300020048 | Freshwater Lake Sediment | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIEKLSQKR |
| Ga0207934_10014595 | 3300020561 | Freshwater | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIINQRLSNKR |
| Ga0212022_10765961 | 3300022164 | Aqueous | MKNKQSNWQRINRVMDFLWKRGDNKESVNDVYRKVLKERLSQKR |
| Ga0181354_10742606 | 3300022190 | Freshwater Lake | GKSKQSALQRIQRIMKFNYNRGLNSERVNEVYRKIINLKLSNQK |
| Ga0181354_12034072 | 3300022190 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIINQRLSKR |
| Ga0196901_10075113 | 3300022200 | Aqueous | MKSKQSPLQRINRIMDFLWKRGNNKESVNNVYRKIINQRLLSK |
| Ga0196901_11001972 | 3300022200 | Aqueous | MTKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLLKQ |
| Ga0181351_10079867 | 3300022407 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSQKR |
| Ga0181351_11986901 | 3300022407 | Freshwater Lake | MKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKII |
| Ga0181351_12041043 | 3300022407 | Freshwater Lake | MTKSKQSALQRIQRIMKFNYNRGLNSERVNEVYRKIINSKLSNQK |
| Ga0244775_1000244624 | 3300024346 | Estuarine | MKSKQSALQRINRIMDFLWKRGNNKESVNEVYRKIINERLSKR |
| Ga0208160_10505703 | 3300025647 | Aqueous | MKSKESPLQRVLKILDFNHKRGNNKESVNKVYRKIINQNLKEYIK |
| Ga0208916_1000028330 | 3300025896 | Aqueous | MKKQLSPKQRINRIMDFYYKRGVNKESVVNVYRKIIALKFA |
| Ga0208916_100169646 | 3300025896 | Aqueous | MKSKQSPLQRINRIIDFNWKRGTNKESINNVYRNIINLKLSKR |
| Ga0208800_10068881 | 3300027193 | Estuarine | MTRSKQSALQRIQRIMKFNYNRGLNSERVNEIYRKI |
| Ga0208975_10060532 | 3300027659 | Freshwater Lentic | MSVIKKKQSPLQRINRIMKFYASRGVNSERVNEVYRKIINIKLLL |
| Ga0209392_10070715 | 3300027683 | Freshwater Sediment | MKQSPLQRINRIMNFYYHRGQNRENVNEVYRKIINLKKK |
| Ga0209492_100054516 | 3300027721 | Freshwater Sediment | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSKKN |
| Ga0209492_100282115 | 3300027721 | Freshwater Sediment | MTKSKQSALQRIQRIMKFNYNRGLNSERVNEIYRKIINLKLSNQK |
| Ga0209492_12380021 | 3300027721 | Freshwater Sediment | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLAKKV |
| Ga0209134_101012711 | 3300027764 | Freshwater Lake | LNMTKSKQSPLQRINRIIDFNWKRGNNKESVNEVYRKIINQRLLKQ |
| Ga0209134_102203011 | 3300027764 | Freshwater Lake | SKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIMIERLSQKR |
| Ga0209134_102674391 | 3300027764 | Freshwater Lake | MTKSKQSPLQRINRIIDFNWKRGNNKESVNEVYRKIINQKLS |
| Ga0209353_1000077133 | 3300027798 | Freshwater Lake | TRSKQSALQRIQRIMKFNYNRGLNSERVNEIYRKIINLKLSNQK |
| Ga0209354_100118402 | 3300027808 | Freshwater Lake | MEKKQSNYQRILRIMKFYLLRGVCKERVNRVYRKIINERLKIKL |
| Ga0209253_101084951 | 3300027900 | Freshwater Lake Sediment | MTRSKQSALQRIQRIMKFNYNRGLNSERVNEVYRKIINLKLSNQK |
| Ga0247722_100058167 | 3300028027 | Deep Subsurface Sediment | MKQSPLQRINRIMRFNYLRGTNKESVNKVYLKIISRKGKI |
| Ga0315289_111110602 | 3300032046 | Sediment | MTKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIQKLSQKR |
| Ga0315284_116074342 | 3300032053 | Sediment | MSVIKKKQSPLQRINRIIKFYASRGVNSERVNEVYRKIINIKLLL |
| Ga0315905_115625963 | 3300032092 | Freshwater | QSPLQRINRIMDFLWKRGNNKESVNEVYRKIINERLSQKR |
| Ga0326734_100006947 | 3300033552 | Ice | MKKKQSPLTRINRIMEFLRKRGNNKESVNEVYRNVLKARNES |
| Ga0334989_0073430_609_746 | 3300033984 | Freshwater | MTKSKQSPLQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSNKR |
| Ga0335003_0049533_1538_1675 | 3300033995 | Freshwater | MSVIKKKQSPLQRINRIMKFYASRGVNSERVNEVYRKVINIKLLL |
| Ga0335005_0074689_758_895 | 3300034022 | Freshwater | MTKSKQSALQRIQRILKFNYNRGLNSERVNEIYRKIINEKLSVKR |
| Ga0335005_0725940_291_416 | 3300034022 | Freshwater | MKSKQSPLQRINRIIDFLWKRGNNKESVNNVYRKIINNKAK |
| Ga0335023_0000060_375_512 | 3300034050 | Freshwater | MSIVKKKQSPLQRINRIMKFYTSRGVNSERVNKVYRKIINIKLLL |
| Ga0334990_0000281_6169_6303 | 3300034068 | Freshwater | MKSKQSPLQRINRIIDFNWKRGNNKESVNEVYRKIINEKLAKKN |
| Ga0335028_0000568_18725_18859 | 3300034071 | Freshwater | MKNKQTCLQRINRIMKFNYNRGLNSERVNAVYRKIIKLKFEGSN |
| Ga0335035_0000494_24681_24818 | 3300034105 | Freshwater | MAKSKQSPLQRINRIMDFLWKRGNNKESVNEVYRKIIIEKLSQKR |
| Ga0335035_0005775_3506_3640 | 3300034105 | Freshwater | MTKSKQSPLQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSKR |
| Ga0335037_0138095_358_504 | 3300034107 | Freshwater | MNEIKQKQYSPLQRILRIIKFNYNRGCNKESINTVYHKIIKLKYENRN |
| Ga0335033_0013339_4593_4727 | 3300034117 | Freshwater | MKNKQTCLQRINRVIKFNYNRGLNSERVNTVYRKIIKLKFEGSN |
| Ga0335058_0791798_2_148 | 3300034121 | Freshwater | QRNKMTKSKQSPLQRINRIIDFNWKRGNNKESVNEVYRKIINQKLSKR |
| Ga0335017_0009151_1785_1922 | 3300034167 | Freshwater | MTRSKQSELQRIQRIMKFNYNRGLNSERVNEIYRKIINLKLSNQK |
| Ga0335017_0011282_3_110 | 3300034167 | Freshwater | QRINRIMDFLWKRGNNKESVNEVYRKIINERLSKR |
| Ga0335017_0279390_262_396 | 3300034167 | Freshwater | MKSKQSALQRINRIIDFLWKRGNNKESVNNVYRKIINERLSQKR |
| Ga0335061_0216280_515_649 | 3300034168 | Freshwater | MKSKQSALQRINRIIDFNWKRGNNKESVNEVYRKIINQKLAKKN |
| Ga0335048_0132626_243_377 | 3300034356 | Freshwater | MTKSKQSALQRINIIIDFNWKRGNNKESVNEVYRKIINQRLLKQ |
| ⦗Top⦘ |