


| Basic Information | |
|---|---|
| Family ID | F070063 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DDNEKVAGPPEMEFSFNVGVQFGLTDATSDTALKFQGSLSF |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.69 % |
| % of genes near scaffold ends (potentially truncated) | 94.31 % |
| % of genes from short scaffolds (< 2000 bps) | 86.99 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.992 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.195 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.268 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.772 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF12706 | Lactamase_B_2 | 34.96 |
| PF13537 | GATase_7 | 3.25 |
| PF01569 | PAP2 | 2.44 |
| PF13522 | GATase_6 | 2.44 |
| PF00196 | GerE | 1.63 |
| PF02239 | Cytochrom_D1 | 1.63 |
| PF01641 | SelR | 1.63 |
| PF04966 | OprB | 1.63 |
| PF03734 | YkuD | 1.63 |
| PF05532 | CsbD | 0.81 |
| PF05690 | ThiG | 0.81 |
| PF05235 | CHAD | 0.81 |
| PF12625 | Arabinose_bd | 0.81 |
| PF00535 | Glycos_transf_2 | 0.81 |
| PF02696 | SelO | 0.81 |
| PF04226 | Transgly_assoc | 0.81 |
| PF13460 | NAD_binding_10 | 0.81 |
| PF10282 | Lactonase | 0.81 |
| PF01699 | Na_Ca_ex | 0.81 |
| PF08241 | Methyltransf_11 | 0.81 |
| PF07730 | HisKA_3 | 0.81 |
| PF13411 | MerR_1 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.63 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.81 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0397 | Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.81 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.81 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.81 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.81 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.81 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.81 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.81 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.81 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.81 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.99 % |
| Unclassified | root | N/A | 13.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0625148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 839 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1029843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 700 | Open in IMG/M |
| 3300000787|JGI11643J11755_11692296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus | 699 | Open in IMG/M |
| 3300000891|JGI10214J12806_11338710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 601 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1014272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1337 | Open in IMG/M |
| 3300004003|Ga0055445_10331473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 529 | Open in IMG/M |
| 3300004063|Ga0055483_10208991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 635 | Open in IMG/M |
| 3300004156|Ga0062589_100760223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus | 871 | Open in IMG/M |
| 3300004479|Ga0062595_100074366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Aquisalinus → Aquisalinus flavus | 1686 | Open in IMG/M |
| 3300005093|Ga0062594_102989838 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 528 | Open in IMG/M |
| 3300005332|Ga0066388_105481914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 643 | Open in IMG/M |
| 3300005332|Ga0066388_106292750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 599 | Open in IMG/M |
| 3300005332|Ga0066388_107168035 | Not Available | 560 | Open in IMG/M |
| 3300005340|Ga0070689_100371794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 1203 | Open in IMG/M |
| 3300005340|Ga0070689_100699039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
| 3300005436|Ga0070713_101301209 | Not Available | 704 | Open in IMG/M |
| 3300005547|Ga0070693_101640816 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005607|Ga0070740_10280476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 672 | Open in IMG/M |
| 3300005615|Ga0070702_100173642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1404 | Open in IMG/M |
| 3300005616|Ga0068852_101461593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 706 | Open in IMG/M |
| 3300005719|Ga0068861_102110862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300005764|Ga0066903_100924598 | Not Available | 1582 | Open in IMG/M |
| 3300005764|Ga0066903_104501753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 743 | Open in IMG/M |
| 3300005764|Ga0066903_107054162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 582 | Open in IMG/M |
| 3300005764|Ga0066903_107582870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 559 | Open in IMG/M |
| 3300005764|Ga0066903_108051353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 540 | Open in IMG/M |
| 3300005840|Ga0068870_11092974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
| 3300005840|Ga0068870_11446300 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005843|Ga0068860_101844646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300006635|Ga0075526_1007215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 766 | Open in IMG/M |
| 3300006846|Ga0075430_100472868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 1034 | Open in IMG/M |
| 3300006846|Ga0075430_100516596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 985 | Open in IMG/M |
| 3300006880|Ga0075429_101952195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300006903|Ga0075426_10309330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 1156 | Open in IMG/M |
| 3300006904|Ga0075424_100373535 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300006954|Ga0079219_11184723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 659 | Open in IMG/M |
| 3300006954|Ga0079219_12015337 | Not Available | 549 | Open in IMG/M |
| 3300006969|Ga0075419_10142391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1564 | Open in IMG/M |
| 3300007076|Ga0075435_100236506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1553 | Open in IMG/M |
| 3300007076|Ga0075435_101195316 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009081|Ga0105098_10566307 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009092|Ga0105250_10018983 | All Organisms → cellular organisms → Bacteria | 2781 | Open in IMG/M |
| 3300009098|Ga0105245_11324917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 769 | Open in IMG/M |
| 3300009100|Ga0075418_10174778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2287 | Open in IMG/M |
| 3300009146|Ga0105091_10194624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 964 | Open in IMG/M |
| 3300009157|Ga0105092_10153325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 1280 | Open in IMG/M |
| 3300009488|Ga0114925_10028562 | All Organisms → cellular organisms → Bacteria | 3241 | Open in IMG/M |
| 3300009778|Ga0116151_10456490 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009792|Ga0126374_10212424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1234 | Open in IMG/M |
| 3300009815|Ga0105070_1097765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 577 | Open in IMG/M |
| 3300010362|Ga0126377_12984230 | Not Available | 546 | Open in IMG/M |
| 3300010397|Ga0134124_12729342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 537 | Open in IMG/M |
| 3300010403|Ga0134123_12571219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 576 | Open in IMG/M |
| 3300012895|Ga0157309_10279880 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 555 | Open in IMG/M |
| 3300012899|Ga0157299_10208599 | Not Available | 594 | Open in IMG/M |
| 3300012901|Ga0157288_10008647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1620 | Open in IMG/M |
| 3300012908|Ga0157286_10051441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1058 | Open in IMG/M |
| 3300012948|Ga0126375_10320705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1085 | Open in IMG/M |
| 3300012951|Ga0164300_11148148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 511 | Open in IMG/M |
| 3300012958|Ga0164299_10610932 | Not Available | 747 | Open in IMG/M |
| 3300012958|Ga0164299_10611693 | Not Available | 747 | Open in IMG/M |
| 3300012964|Ga0153916_12129805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 630 | Open in IMG/M |
| 3300012987|Ga0164307_10009089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4757 | Open in IMG/M |
| 3300012989|Ga0164305_10329996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1140 | Open in IMG/M |
| 3300013297|Ga0157378_10075757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3030 | Open in IMG/M |
| 3300013307|Ga0157372_11551434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus | 763 | Open in IMG/M |
| 3300014317|Ga0075343_1095932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 670 | Open in IMG/M |
| 3300014320|Ga0075342_1085429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 807 | Open in IMG/M |
| 3300014324|Ga0075352_1084959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 808 | Open in IMG/M |
| 3300014325|Ga0163163_11048458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 879 | Open in IMG/M |
| 3300014745|Ga0157377_10358497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 981 | Open in IMG/M |
| 3300015371|Ga0132258_13491032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis | 1077 | Open in IMG/M |
| 3300018053|Ga0184626_10240396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300018429|Ga0190272_11525075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300018920|Ga0190273_11723018 | Not Available | 566 | Open in IMG/M |
| 3300019487|Ga0187893_10531397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis | 760 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10063919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 1483 | Open in IMG/M |
| 3300025167|Ga0209642_10336026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 854 | Open in IMG/M |
| 3300025174|Ga0209324_10031903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 3622 | Open in IMG/M |
| 3300025321|Ga0207656_10207941 | Not Available | 947 | Open in IMG/M |
| 3300025544|Ga0208078_1044471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 952 | Open in IMG/M |
| 3300025566|Ga0210140_1108288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 570 | Open in IMG/M |
| 3300025912|Ga0207707_11581005 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 517 | Open in IMG/M |
| 3300025928|Ga0207700_11573508 | Not Available | 582 | Open in IMG/M |
| 3300025938|Ga0207704_11910522 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 511 | Open in IMG/M |
| 3300025940|Ga0207691_11537873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 543 | Open in IMG/M |
| 3300025945|Ga0207679_11813468 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300025949|Ga0207667_10339092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1534 | Open in IMG/M |
| 3300025960|Ga0207651_10196318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1613 | Open in IMG/M |
| 3300025961|Ga0207712_10028176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3755 | Open in IMG/M |
| 3300026035|Ga0207703_11318160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300026041|Ga0207639_10028995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4047 | Open in IMG/M |
| 3300026075|Ga0207708_10077104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2558 | Open in IMG/M |
| 3300027379|Ga0209842_1062719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 661 | Open in IMG/M |
| 3300027706|Ga0209581_1180670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 672 | Open in IMG/M |
| 3300027723|Ga0209703_1257527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300027765|Ga0209073_10339207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 604 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10391885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 674 | Open in IMG/M |
| 3300027880|Ga0209481_10262698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 871 | Open in IMG/M |
| 3300028379|Ga0268266_10087552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2725 | Open in IMG/M |
| 3300030003|Ga0302172_10119255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 810 | Open in IMG/M |
| 3300030006|Ga0299907_10308802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 1288 | Open in IMG/M |
| 3300030619|Ga0268386_10013698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 6303 | Open in IMG/M |
| 3300031226|Ga0307497_10139546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 994 | Open in IMG/M |
| 3300031232|Ga0302323_100225963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 1905 | Open in IMG/M |
| 3300031539|Ga0307380_10209381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1875 | Open in IMG/M |
| 3300031563|Ga0307436_1121127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 733 | Open in IMG/M |
| 3300031565|Ga0307379_10325824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis | 1503 | Open in IMG/M |
| 3300031566|Ga0307378_10518506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 1065 | Open in IMG/M |
| 3300031673|Ga0307377_10448338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis | 950 | Open in IMG/M |
| 3300031747|Ga0318502_10498074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 730 | Open in IMG/M |
| 3300031847|Ga0310907_10404076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 712 | Open in IMG/M |
| 3300031902|Ga0302322_103463192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 540 | Open in IMG/M |
| 3300032003|Ga0310897_10380658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 663 | Open in IMG/M |
| 3300032041|Ga0318549_10077335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 1421 | Open in IMG/M |
| 3300032076|Ga0306924_11925657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 612 | Open in IMG/M |
| 3300032273|Ga0316197_10153337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans | 1375 | Open in IMG/M |
| 3300032516|Ga0315273_13190497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.20% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.06% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.25% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.44% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.44% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.44% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.63% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.63% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.81% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.81% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300004003 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 | Environmental | Open in IMG/M |
| 3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006635 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-three | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009778 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG | Engineered | Open in IMG/M |
| 3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025566 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031563 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032273 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxic | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_06251482 | 2228664021 | Soil | NAPEPAGTEFSMNIGYQFGLTDVTSDGALKLQGSLAF |
| AP72_2010_repI_A10DRAFT_10298432 | 3300000651 | Forest Soil | AAGSPNLELSFNVGVQFGLTDATSDGALKFQGTFSW* |
| JGI11643J11755_116922961 | 3300000787 | Soil | EGDEEEVKGDKDNDKASGPSEMQLSFNIGLQFGVTDATSDTALKFQGSLSF* |
| JGI10214J12806_113387102 | 3300000891 | Soil | VPAGMELTFNLGVQFGLTDATSDTALKFQGSLSF* |
| AP72_2010_repI_A001DRAFT_10142721 | 3300000893 | Forest Soil | GPTLFWKPVGGEDEAKNEGGENDNRAAGSPNLELSFNVGVQFGLTDATSDGALKFQGTFSW* |
| Ga0055445_103314731 | 3300004003 | Natural And Restored Wetlands | GGEGDADEDDVASAPEMELYLNVGLQFGLTDATSDTALKFQGSLQF* |
| Ga0055483_102089911 | 3300004063 | Natural And Restored Wetlands | ADEGDADGAQGTSLSLNVGVQFGLTDATSDTALKFQGSLQF* |
| Ga0062589_1007602231 | 3300004156 | Soil | KKSDDNEKVAGPPEMEFSFNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0062595_1000743664 | 3300004479 | Soil | MYQTTGKDNDKASGPSEMQLSFNIGLQFGLMDATSDTALKFQGSLSF* |
| Ga0062594_1029898382 | 3300005093 | Soil | EAKGGDEDEDNNKVPGPPNLELSFNVGVQFGLTDVTSDGALKFQGSLAW* |
| Ga0066388_1054819141 | 3300005332 | Tropical Forest Soil | AEGGNDDRVAGPAQMAFSMNLGVQFGLTDATSDTALKLQGSLSF* |
| Ga0066388_1062927501 | 3300005332 | Tropical Forest Soil | GKEDNDNEKVAGTPEMELSFNVGVQFGLTDATSDAALKFQGTISF* |
| Ga0066388_1071680351 | 3300005332 | Tropical Forest Soil | AGGDEDENEAKSPAPLELSFNVGVQFGLTDATSDTTLKFQGSLSF* |
| Ga0070689_1003717941 | 3300005340 | Switchgrass Rhizosphere | GGDDDDKATEAPAMKFSLNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0070689_1006990391 | 3300005340 | Switchgrass Rhizosphere | GGEGDDDDENNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF* |
| Ga0070713_1013012091 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF* |
| Ga0068853_1013313932 | 3300005539 | Corn Rhizosphere | GDDDEAEGEGKKKGGDDDDKATEAPAMKFSLNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0070693_1016408162 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | KKGGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF* |
| Ga0070740_102804762 | 3300005607 | Surface Soil | TKKQEDVGDAAGGEDEENGTPGPEPLELSFNVGVQFGLTDATSDGALKFQGSLSW* |
| Ga0070702_1001736423 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EGEGKKKGGDDDDKATEAPPMKFSLNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0068852_1014615931 | 3300005616 | Corn Rhizosphere | NAPEPASTEFSMNVGVQFGLTDATSDTALKFQGSLAF* |
| Ga0068861_1021108622 | 3300005719 | Switchgrass Rhizosphere | DDDENKKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF* |
| Ga0066903_1009245981 | 3300005764 | Tropical Forest Soil | EKVAGASEMELSFNVGVQFGLTDATSDTALKFQGTISF* |
| Ga0066903_1045017531 | 3300005764 | Tropical Forest Soil | AAGPPKMEFSLNVGVQFGLTDATSDTAPKFQGSLSF* |
| Ga0066903_1070541622 | 3300005764 | Tropical Forest Soil | KEVKQGKEDNDNEKVAGASEMELSFNVGVQFGLTDATSDTALKFQGTFSF* |
| Ga0066903_1075828701 | 3300005764 | Tropical Forest Soil | ESEEREGKEDNDNEKVAGQPKLELSFNVGVQFGLTDATSDTALKFQGTVSF* |
| Ga0066903_1080513532 | 3300005764 | Tropical Forest Soil | NDNEKVAGAPEMELSFNVGLQFGLTDATSDTALKFQGSLSF* |
| Ga0068870_110929741 | 3300005840 | Miscanthus Rhizosphere | NHNPEPAKMEFSMNVGVQFGLTDVTSDSALKFQGSLAF* |
| Ga0068870_114463002 | 3300005840 | Miscanthus Rhizosphere | GDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF* |
| Ga0068860_1018446461 | 3300005843 | Switchgrass Rhizosphere | ENKKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF* |
| Ga0075526_10072152 | 3300006635 | Arctic Peat Soil | DDDDERKVGGPPEMEVSFNVGVQFGLTDFTSDTALKFQGSLGF* |
| Ga0075430_1004728682 | 3300006846 | Populus Rhizosphere | AEAPEMEVSLNVGVQFGLTDATSDTAVKFQGSIGF* |
| Ga0075430_1005165962 | 3300006846 | Populus Rhizosphere | GSEEEEAKGGDEDEDNNKVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSLAW* |
| Ga0075429_1019521951 | 3300006880 | Populus Rhizosphere | APEPAKTEFSMNFGVQFGLTDVTSDGALKFQGSLAF* |
| Ga0075426_103093301 | 3300006903 | Populus Rhizosphere | VPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSLAW* |
| Ga0075424_1003735354 | 3300006904 | Populus Rhizosphere | DAAGGDEDENKGPGPAPLELSFNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0079219_111847232 | 3300006954 | Agricultural Soil | DEEEAKGDKDNDKASGPSEMQLSFNIGLQFGVTDATSDTALKFQGSLSF* |
| Ga0079219_120153371 | 3300006954 | Agricultural Soil | EGEEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGLLSF* |
| Ga0075419_101423911 | 3300006969 | Populus Rhizosphere | EEEAKGGDEDEDNNKVPGPPNMELSFNVGVQSGLTDVTSDGALKFQGSLAW* |
| Ga0075435_1002365062 | 3300007076 | Populus Rhizosphere | LQGDGDEAEEKGAGPAPLELSLNVGVQFGLTDATSDVALKFQGSLAF* |
| Ga0075435_1011953162 | 3300007076 | Populus Rhizosphere | NKSQGPAPLELSFNVGVQLGLTDATSDTALKFQGSLSF* |
| Ga0105098_105663071 | 3300009081 | Freshwater Sediment | NGKFTAEAPEMEVSLNIGVQFGLTDATSDTALKFQGSLAF* |
| Ga0105250_100189836 | 3300009092 | Switchgrass Rhizosphere | EKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF* |
| Ga0105245_113249172 | 3300009098 | Miscanthus Rhizosphere | DKDEDNNKVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSLAW* |
| Ga0075418_101747785 | 3300009100 | Populus Rhizosphere | GDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF* |
| Ga0105091_101946241 | 3300009146 | Freshwater Sediment | EEGEGENGDDDDGATEAAEMEFSLNVGVQFGLTDVTSDSALKFQGSLAF* |
| Ga0105092_101533251 | 3300009157 | Freshwater Sediment | DDENGVAEAPEMEVSLNVGVQFGLTVATSDTAVKFQGSIGF* |
| Ga0114925_100285624 | 3300009488 | Deep Subsurface | GDDDDEKVGGPPEMELSLNIGVQFGLTDVTSDTALKFQGSLAF* |
| Ga0116151_104564901 | 3300009778 | Anaerobic Digestor Sludge | DDGDEGELELDDDVVAGPPEMELSFNVGVQFGLTDNTSDSALKFQDSLEF* |
| Ga0114923_110799552 | 3300009788 | Deep Subsurface | GDDDAVGGEGKGAEDEVAGPRKMEFFLNVGVQFGLTDMTSDTALKFQGSLEF* |
| Ga0126374_102124242 | 3300009792 | Tropical Forest Soil | EEEEAKAGDEDEDNNKIPGPPNMELSFNVGVQFGLTDVTSDGALKFQGTFSW* |
| Ga0105070_10977651 | 3300009815 | Groundwater Sand | VGAPPEMEFSLNVGVQFGLTDVTSDTALKFQGTLEF* |
| Ga0126377_129842302 | 3300010362 | Tropical Forest Soil | GDAAGGDENENKGPGPAPLELSFNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0134124_127293421 | 3300010397 | Terrestrial Soil | IGLRLVAGTRAMELSFNVGVQFGLTDATSDTALKIQGSLSF* |
| Ga0134122_116724761 | 3300010400 | Terrestrial Soil | LFYNPGGYDDEAEGEGKKKGGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF* |
| Ga0134123_125712191 | 3300010403 | Terrestrial Soil | PEPAKTEFSMNVGVQFGLTDVTSDSALKFQGSLAF* |
| Ga0157309_102798801 | 3300012895 | Soil | EAKGGDEDEDNNKVRGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW* |
| Ga0157299_102085991 | 3300012899 | Soil | DKDNDKASGPSEMQLSFNIGLQFGVTDATSDTALKFQGSLSF* |
| Ga0157288_100086473 | 3300012901 | Soil | KGGDEDEDNNKVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSIAW* |
| Ga0157286_100514411 | 3300012908 | Soil | VGDAAGGDEEENKGPGPAPLELSFNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0126375_103207053 | 3300012948 | Tropical Forest Soil | DKEKVAGAPEMELSFNVGVQFGLTDATSDTALKFQGTVSF* |
| Ga0164300_111481481 | 3300012951 | Soil | HQAAKAEFSMNVGVQFGLTDATSDTALKFQGSLAF* |
| Ga0164299_106109322 | 3300012958 | Soil | GEEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF* |
| Ga0164299_106116931 | 3300012958 | Soil | TGKKHQAAKAEFSMNVGVQFGLTDATSDTALKFQGSLAF* |
| Ga0153916_121298051 | 3300012964 | Freshwater Wetlands | KGSDDDDKAIEAPDMEFSLNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0164307_100090898 | 3300012987 | Soil | EGKEDKDTEKVAGPPKMELSFNVGVQLGLTDATSDAALKFQGSLSF* |
| Ga0164307_117759852 | 3300012987 | Soil | KAKARGQEQASEPSAMAFSMNVGVQFGLTDATSDTALKFQGSLAF* |
| Ga0164305_103299961 | 3300012989 | Soil | KDNEKVAGPPKMELSFNVGVQFGLTDATFDAALKFQGSLSF* |
| Ga0157378_100757571 | 3300013297 | Miscanthus Rhizosphere | ENVGGEGDDDDENNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF* |
| Ga0163162_129522162 | 3300013306 | Switchgrass Rhizosphere | DEESEGEGKKKGGDDDDKATEAPAMKFSLNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0157372_115514341 | 3300013307 | Corn Rhizosphere | DDNEKVAGPPEMEFSFNVGVQFGLTDATSDTALKFQGSLSF* |
| Ga0075343_10959321 | 3300014317 | Natural And Restored Wetlands | DVGEDDDDDNGGVTKAPETEFSMNVGLQFGLTDMTSDTAMKFQGSLAF* |
| Ga0075342_10854292 | 3300014320 | Natural And Restored Wetlands | GKGDDDGDKRVAGPSKMDFSLNVGVQFGLTDLTSDTALKFQGSLAF* |
| Ga0075352_10849592 | 3300014324 | Natural And Restored Wetlands | KVAGPPDMELSFNVGVQFGLTDATSDGALKFQGSLTW* |
| Ga0163163_110484583 | 3300014325 | Switchgrass Rhizosphere | GSSEMELSFNIGLQFGLTDATSDTALKFQGSLSF* |
| Ga0157377_103584971 | 3300014745 | Miscanthus Rhizosphere | NPEPAKMEFSMNVGVQFGLTDVTSDSALRFQGSLAF* |
| Ga0132258_134910323 | 3300015371 | Arabidopsis Rhizosphere | EKKKEGGGPADMEFSLNVGVQFGLTDATSDTALKFQGELDF* |
| Ga0184626_102403961 | 3300018053 | Groundwater Sediment | NEKVASPPEMEFSLNVGVQFGLTEVTSDTALKFQGSLAF |
| Ga0190272_115250752 | 3300018429 | Soil | SGPPEMEFSLNVGVQFGLSDVTSDTALKFQGSLAF |
| Ga0190273_117230181 | 3300018920 | Soil | KKVGGAPEMEFSLNVGLQFGLTDVTSDTALKFQGTLEF |
| Ga0187893_105313972 | 3300019487 | Microbial Mat On Rocks | EVEIYDDEQAGGAVAMTFSMNVGVQFGLTDSTSDTALKFQGAVQF |
| (restricted) Ga0255046_100639193 | 3300024519 | Seawater | NDDDEIAGEPEMEFVFNVGLQFGLTDATSDTALKFQGAMEF |
| Ga0209642_103360261 | 3300025167 | Soil | GGPPEMEFSMNVGVQFGLTDVTSDTALKFQGTLEF |
| Ga0209324_100319031 | 3300025174 | Soil | GDDNGNGKGPGDDDDKKKVGGPPEMEFSMNVGVQFGLTDVTSDTALKFQGTLEF |
| Ga0207656_102079412 | 3300025321 | Corn Rhizosphere | EGEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF |
| Ga0208078_10444712 | 3300025544 | Arctic Peat Soil | GDDDEKGGGGAETEFSMNIGVQFGLTDATSEGALKVQGSLQF |
| Ga0210140_11082882 | 3300025566 | Natural And Restored Wetlands | VPGGPVEMEVSFNVGVQFGLTDETSDSALKFQGMLEF |
| Ga0207707_115810051 | 3300025912 | Corn Rhizosphere | ARCRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW |
| Ga0207700_115735081 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF |
| Ga0207704_119105221 | 3300025938 | Miscanthus Rhizosphere | EDEDNNKVPGPPNLELSFNVGVQFGLTDVTSDGALKFQGSLAW |
| Ga0207691_115378731 | 3300025940 | Miscanthus Rhizosphere | NNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLNF |
| Ga0207679_118134681 | 3300025945 | Corn Rhizosphere | EGKKKGGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF |
| Ga0207667_103390921 | 3300025949 | Corn Rhizosphere | EAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF |
| Ga0207651_101963181 | 3300025960 | Switchgrass Rhizosphere | NKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW |
| Ga0207712_100281761 | 3300025961 | Switchgrass Rhizosphere | DEDEDNNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW |
| Ga0207703_113181602 | 3300026035 | Switchgrass Rhizosphere | GGEGDDDDENKKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF |
| Ga0207639_100289959 | 3300026041 | Corn Rhizosphere | NGNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF |
| Ga0207708_100771043 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | EKDENVGGEGDDDDENNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF |
| Ga0209842_10627191 | 3300027379 | Groundwater Sand | DNGNGNGDDDNKIAGPAKVEFSMNVGVQFGLTDLTSDTALKFQGTLEF |
| Ga0209581_11806702 | 3300027706 | Surface Soil | TKKQEDVGDAAGGEDEENGTPGPEPLELSFNVGVQFGLTDATSDGALKFQGSLSW |
| Ga0209703_12575271 | 3300027723 | Freshwater Sediment | NGNAPEPAKTEFSMNVGVQFGLTDVTSDGALKFQGSLAF |
| Ga0209073_103392071 | 3300027765 | Agricultural Soil | EGGDDDKKAAGPPDMELSFNVGVQLGLTDAASDGALKFQGSLSW |
| (restricted) Ga0255058_103918852 | 3300027872 | Seawater | EIAGEPEMEFVFNVGLQFGLTDATSDTALKFQGGVEF |
| Ga0209481_102626982 | 3300027880 | Populus Rhizosphere | EEEAKGGDEDEDNNKVPGPPNMELSFNVGVQSGLTDVTSDGALKFQGSLAW |
| Ga0268266_100875521 | 3300028379 | Switchgrass Rhizosphere | PGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW |
| Ga0302172_101192551 | 3300030003 | Fen | DKVAGPPPLELSFNVGVQFGLTDVTSDTALKFQGELNF |
| Ga0299907_103088021 | 3300030006 | Soil | DDDDDDNGNRNGNHEVAGPAKPEFSMNVGVQFGLTDFTSETALKFQGALEF |
| Ga0268386_100136987 | 3300030619 | Soil | DDERKVGGPPEMEVSLNVGVQFGLTDFTSDTALKFQGSLGF |
| Ga0307497_101395461 | 3300031226 | Soil | SAGGPAAMEFSMNVGVQFGLTDATSDTALKFQGSLAF |
| Ga0302323_1002259631 | 3300031232 | Fen | NDEDGVGKAEGGDDDKVAGPPPLELSFNVGVQFGLTDVTSDTALKFQGELNF |
| Ga0307380_102093811 | 3300031539 | Soil | DGDDDDGDNGATKAPEMEFSMNVGLQFGLTDLTSDGAVKFQGSLAF |
| Ga0307436_11211272 | 3300031563 | Salt Marsh | GEGDADEDDAAGASQASLSLNVGVQFGLTDATSDTALKFQGSFQF |
| Ga0307379_103258241 | 3300031565 | Soil | GDDDEEDDVAGPPDMEFSLNVGLQFGLTDAASDTALKFQGSLAF |
| Ga0307378_105185062 | 3300031566 | Soil | GDDDDDDRKVGGPPEIEFSLNVGVQFGLIDVTSDGALKFQGSLAF |
| Ga0307377_104483382 | 3300031673 | Soil | AVAGPPEMEFSFNVGLQFGLTDATSDTALKFQGSLGF |
| Ga0318502_104980742 | 3300031747 | Soil | PREGDDEKVAGPPKMELSLNVGVQFGLTDATSDLQLKFQTSLSF |
| Ga0310907_104040762 | 3300031847 | Soil | SEEEEAKGGDEDEDNNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW |
| Ga0302322_1034631922 | 3300031902 | Fen | KVAGPPPLELSFNVGVQFGLTDVTSDTALKFQGELNF |
| Ga0310897_103806582 | 3300032003 | Soil | NNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW |
| Ga0318549_100773351 | 3300032041 | Soil | ARAGPDALSMNVGYQFGLADATSDSALKFQGSLSF |
| Ga0306924_119256572 | 3300032076 | Soil | DEKAAGPPATELALNVGVQFGLTDATSDTALKFQGSIGF |
| Ga0316197_101533372 | 3300032273 | Sediment | DLDEDFVPGGPVEMEMSFNVGVQFGLTDETSDSALKFQGKLEF |
| Ga0315273_131904972 | 3300032516 | Sediment | DDKESQKSTEFQMNVGVQFGLTELASDAALKVQGALQF |
| ⦗Top⦘ |