


| Basic Information | |
|---|---|
| Family ID | F069974 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GVYYVGLDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.65 % |
| % of genes near scaffold ends (potentially truncated) | 83.74 % |
| % of genes from short scaffolds (< 2000 bps) | 86.99 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.358 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.382 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.390 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.528 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.16% β-sheet: 23.68% Coil/Unstructured: 63.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF01068 | DNA_ligase_A_M | 4.88 |
| PF01118 | Semialdhyde_dh | 3.25 |
| PF00486 | Trans_reg_C | 2.44 |
| PF03625 | DUF302 | 1.63 |
| PF07509 | DUF1523 | 1.63 |
| PF02774 | Semialdhyde_dhC | 1.63 |
| PF00933 | Glyco_hydro_3 | 0.81 |
| PF00582 | Usp | 0.81 |
| PF01063 | Aminotran_4 | 0.81 |
| PF07508 | Recombinase | 0.81 |
| PF01391 | Collagen | 0.81 |
| PF14518 | Haem_oxygenas_2 | 0.81 |
| PF09278 | MerR-DNA-bind | 0.81 |
| PF00403 | HMA | 0.81 |
| PF02798 | GST_N | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 4.88 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 4.88 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 1.63 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.63 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 1.63 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 1.63 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.81 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.81 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.36 % |
| Unclassified | root | N/A | 27.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_10516239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 713 | Open in IMG/M |
| 3300001904|JGI24736J21556_1032181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 810 | Open in IMG/M |
| 3300001915|JGI24741J21665_1059750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 562 | Open in IMG/M |
| 3300001977|JGI24746J21847_1009567 | Not Available | 1445 | Open in IMG/M |
| 3300002070|JGI24750J21931_1024020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 867 | Open in IMG/M |
| 3300004114|Ga0062593_102106117 | Not Available | 629 | Open in IMG/M |
| 3300004633|Ga0066395_10277411 | Not Available | 908 | Open in IMG/M |
| 3300005332|Ga0066388_105657595 | Not Available | 632 | Open in IMG/M |
| 3300005434|Ga0070709_10182804 | Not Available | 1473 | Open in IMG/M |
| 3300005435|Ga0070714_100013537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6538 | Open in IMG/M |
| 3300005435|Ga0070714_100077713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2883 | Open in IMG/M |
| 3300005436|Ga0070713_100060943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3155 | Open in IMG/M |
| 3300005437|Ga0070710_10025909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3109 | Open in IMG/M |
| 3300005444|Ga0070694_100030573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3524 | Open in IMG/M |
| 3300005457|Ga0070662_100761673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 821 | Open in IMG/M |
| 3300005468|Ga0070707_100983578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 809 | Open in IMG/M |
| 3300005764|Ga0066903_101428967 | Not Available | 1301 | Open in IMG/M |
| 3300005764|Ga0066903_102317193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1037 | Open in IMG/M |
| 3300005764|Ga0066903_104006759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 790 | Open in IMG/M |
| 3300005764|Ga0066903_104934610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 708 | Open in IMG/M |
| 3300005841|Ga0068863_100299864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1559 | Open in IMG/M |
| 3300006057|Ga0075026_100792972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 574 | Open in IMG/M |
| 3300006755|Ga0079222_10546334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 865 | Open in IMG/M |
| 3300006844|Ga0075428_101347935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 749 | Open in IMG/M |
| 3300006845|Ga0075421_100156761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 2843 | Open in IMG/M |
| 3300006845|Ga0075421_101284074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 811 | Open in IMG/M |
| 3300006847|Ga0075431_100413562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1348 | Open in IMG/M |
| 3300006854|Ga0075425_101157327 | Not Available | 880 | Open in IMG/M |
| 3300006854|Ga0075425_101799165 | Not Available | 688 | Open in IMG/M |
| 3300006854|Ga0075425_101944166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 658 | Open in IMG/M |
| 3300006880|Ga0075429_101075821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 703 | Open in IMG/M |
| 3300006881|Ga0068865_101317108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 643 | Open in IMG/M |
| 3300006914|Ga0075436_101361529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 537 | Open in IMG/M |
| 3300007076|Ga0075435_101542760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 583 | Open in IMG/M |
| 3300009092|Ga0105250_10020625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 2663 | Open in IMG/M |
| 3300009147|Ga0114129_10187253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2812 | Open in IMG/M |
| 3300009156|Ga0111538_13911021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 515 | Open in IMG/M |
| 3300009545|Ga0105237_10187180 | Not Available | 2070 | Open in IMG/M |
| 3300009839|Ga0116223_10296227 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300010047|Ga0126382_10827837 | Not Available | 792 | Open in IMG/M |
| 3300010371|Ga0134125_10866149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 993 | Open in IMG/M |
| 3300010398|Ga0126383_10049820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3480 | Open in IMG/M |
| 3300010403|Ga0134123_11119072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 812 | Open in IMG/M |
| 3300010868|Ga0124844_1039249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1587 | Open in IMG/M |
| 3300010868|Ga0124844_1267747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 592 | Open in IMG/M |
| 3300012019|Ga0120139_1002452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5040 | Open in IMG/M |
| 3300012351|Ga0137386_11195737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 532 | Open in IMG/M |
| 3300012897|Ga0157285_10007360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 2065 | Open in IMG/M |
| 3300012898|Ga0157293_10205401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 596 | Open in IMG/M |
| 3300012899|Ga0157299_10025949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1154 | Open in IMG/M |
| 3300012899|Ga0157299_10093704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 764 | Open in IMG/M |
| 3300012909|Ga0157290_10204358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 673 | Open in IMG/M |
| 3300012910|Ga0157308_10158895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 728 | Open in IMG/M |
| 3300012911|Ga0157301_10333979 | Not Available | 565 | Open in IMG/M |
| 3300012911|Ga0157301_10425335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 521 | Open in IMG/M |
| 3300012955|Ga0164298_10427837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 864 | Open in IMG/M |
| 3300012958|Ga0164299_10265536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1034 | Open in IMG/M |
| 3300012960|Ga0164301_11311730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 587 | Open in IMG/M |
| 3300013766|Ga0120181_1021722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1627 | Open in IMG/M |
| 3300013770|Ga0120123_1024960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1220 | Open in IMG/M |
| 3300014052|Ga0120109_1044891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 997 | Open in IMG/M |
| 3300014052|Ga0120109_1125146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 599 | Open in IMG/M |
| 3300014056|Ga0120125_1040706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1009 | Open in IMG/M |
| 3300014326|Ga0157380_13007767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 537 | Open in IMG/M |
| 3300015371|Ga0132258_13930104 | Not Available | 1010 | Open in IMG/M |
| 3300015372|Ga0132256_100162547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 2252 | Open in IMG/M |
| 3300016294|Ga0182041_10954335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300016294|Ga0182041_11682650 | Not Available | 587 | Open in IMG/M |
| 3300016319|Ga0182033_12222912 | Not Available | 500 | Open in IMG/M |
| 3300016341|Ga0182035_11500806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 607 | Open in IMG/M |
| 3300016422|Ga0182039_10916760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 783 | Open in IMG/M |
| 3300016445|Ga0182038_10671129 | Not Available | 900 | Open in IMG/M |
| 3300016445|Ga0182038_11631925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 580 | Open in IMG/M |
| 3300017823|Ga0187818_10410690 | Not Available | 602 | Open in IMG/M |
| 3300017928|Ga0187806_1254338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 609 | Open in IMG/M |
| 3300017937|Ga0187809_10023784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1954 | Open in IMG/M |
| 3300017943|Ga0187819_10554720 | Not Available | 653 | Open in IMG/M |
| 3300017955|Ga0187817_10266683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1091 | Open in IMG/M |
| 3300018001|Ga0187815_10308396 | Not Available | 671 | Open in IMG/M |
| 3300019356|Ga0173481_10229570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 823 | Open in IMG/M |
| 3300021560|Ga0126371_12002206 | Not Available | 697 | Open in IMG/M |
| 3300021560|Ga0126371_13499048 | Not Available | 530 | Open in IMG/M |
| 3300023064|Ga0247801_1013057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1056 | Open in IMG/M |
| 3300023066|Ga0247793_1035296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 766 | Open in IMG/M |
| 3300023261|Ga0247796_1016919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1101 | Open in IMG/M |
| 3300025893|Ga0207682_10367954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 678 | Open in IMG/M |
| 3300025898|Ga0207692_10265350 | Not Available | 1034 | Open in IMG/M |
| 3300025916|Ga0207663_11540570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 535 | Open in IMG/M |
| 3300025926|Ga0207659_10574970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 959 | Open in IMG/M |
| 3300025936|Ga0207670_10667645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 858 | Open in IMG/M |
| 3300025940|Ga0207691_10012760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8042 | Open in IMG/M |
| 3300025940|Ga0207691_10451319 | Not Available | 1094 | Open in IMG/M |
| 3300025941|Ga0207711_10306965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1464 | Open in IMG/M |
| 3300025960|Ga0207651_10238862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1479 | Open in IMG/M |
| 3300025986|Ga0207658_10234939 | Not Available | 1549 | Open in IMG/M |
| 3300026041|Ga0207639_10366032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1291 | Open in IMG/M |
| 3300026088|Ga0207641_12607012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 503 | Open in IMG/M |
| 3300027462|Ga0210000_1041040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 734 | Open in IMG/M |
| 3300027765|Ga0209073_10192234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 772 | Open in IMG/M |
| 3300027787|Ga0209074_10294155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 647 | Open in IMG/M |
| 3300027874|Ga0209465_10316847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 781 | Open in IMG/M |
| 3300027909|Ga0209382_10672103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1118 | Open in IMG/M |
| 3300031545|Ga0318541_10837216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 513 | Open in IMG/M |
| 3300031573|Ga0310915_10800906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 663 | Open in IMG/M |
| 3300031716|Ga0310813_11018881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 756 | Open in IMG/M |
| 3300031763|Ga0318537_10197953 | Not Available | 748 | Open in IMG/M |
| 3300031771|Ga0318546_10986730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 593 | Open in IMG/M |
| 3300031879|Ga0306919_11100821 | Not Available | 606 | Open in IMG/M |
| 3300031910|Ga0306923_10532894 | Not Available | 1325 | Open in IMG/M |
| 3300031940|Ga0310901_10387498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 606 | Open in IMG/M |
| 3300031941|Ga0310912_10777533 | Not Available | 740 | Open in IMG/M |
| 3300031942|Ga0310916_11065336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 673 | Open in IMG/M |
| 3300031947|Ga0310909_11117619 | Not Available | 640 | Open in IMG/M |
| 3300031954|Ga0306926_10747801 | Not Available | 1182 | Open in IMG/M |
| 3300032001|Ga0306922_12114764 | Not Available | 545 | Open in IMG/M |
| 3300032013|Ga0310906_10986692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 605 | Open in IMG/M |
| 3300032059|Ga0318533_11106533 | Not Available | 580 | Open in IMG/M |
| 3300032075|Ga0310890_10138245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1593 | Open in IMG/M |
| 3300032122|Ga0310895_10118234 | Not Available | 1105 | Open in IMG/M |
| 3300032261|Ga0306920_101579232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 934 | Open in IMG/M |
| 3300032892|Ga0335081_11120074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 905 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.88% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Host-Associated | Open in IMG/M |
| 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Host-Associated | Open in IMG/M |
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_105162392 | 3300000890 | Soil | TPALALTSGVYYVGLDMTTHTCSVVTHMTHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| JGI24736J21556_10321812 | 3300001904 | Corn Rhizosphere | VHYVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| JGI24741J21665_10597502 | 3300001915 | Corn Rhizosphere | LALTSGVXYVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| JGI24746J21847_10095673 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | CSVVTHMTHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| JGI24750J21931_10240202 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | SGVHYVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0062593_1021061171 | 3300004114 | Soil | LTEGPYFVGLNTTTHTCSVVTKMEAGMKMMGKYKTKAAAEKAMAGMAECKA* |
| Ga0066395_102774111 | 3300004633 | Tropical Forest Soil | ESGVYYVGLDKTTHTCSVVTSLAPGMKMMGKFKSQAAAEKAMHGMKSCKA* |
| Ga0066388_1056575951 | 3300005332 | Tropical Forest Soil | WALEEGMYFVGLDTTTHTCSVMTEMKAGMKMMGKYKSKDEAEKAMASMAECKG* |
| Ga0070709_101828041 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LALTSGVYYVGLDMTTHTCSVVTHMTHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0070714_1000135371 | 3300005435 | Agricultural Soil | TPALALTSGVYYVGLDMTTHTCSVVTHLTHGMEMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0070714_1000777134 | 3300005435 | Agricultural Soil | LALTSGVYYVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAVAGMKKCHA* |
| Ga0070713_1000609435 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LALTSGVHYVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0070710_100259093 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LALTSGVYYVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0070694_1000305735 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LALTSGVYYVGLDVTTHTCSVVTKMSHGMKMMEKYKSKEAAEKAMAGMKKCHA* |
| Ga0070662_1007616731 | 3300005457 | Corn Rhizosphere | SGVYYVGLDMTTHTCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0070707_1009835781 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | YYVGLDMTTHTCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0066903_1014289672 | 3300005764 | Tropical Forest Soil | HTCSVVTKMEAGMKMMGKYKTKAAAEKAMHGMAECKA* |
| Ga0066903_1023171933 | 3300005764 | Tropical Forest Soil | PYFVGLNTTTHTCSVVRHMSAGMKMMGKFKTRAAAEKAMAGMKECKG* |
| Ga0066903_1040067592 | 3300005764 | Tropical Forest Soil | ALTAGTYFVGLDSTTHTCSVMTEMKAGMKMMGKYDSKEAAEQAMATMKECKGG* |
| Ga0066903_1049346101 | 3300005764 | Tropical Forest Soil | GVYYVGLDTTTHTCSVMTEMKAGMKMMGKYKSKEEAEKAMASMKECKA* |
| Ga0068863_1002998645 | 3300005841 | Switchgrass Rhizosphere | TPALALTSGVYYVGLDMTTHTCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0075026_1007929721 | 3300006057 | Watersheds | AGPYFVGLDTATKKCSVVTSLPAGMKMMGKYKTKARAEKAMAAMKACKG* |
| Ga0079222_105463343 | 3300006755 | Agricultural Soil | TPALALTSGVYYVGLDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0075428_1013479352 | 3300006844 | Populus Rhizosphere | GVYYVGLDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0075421_1001567611 | 3300006845 | Populus Rhizosphere | TTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0075421_1012840742 | 3300006845 | Populus Rhizosphere | YVGLDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0075431_1004135621 | 3300006847 | Populus Rhizosphere | LDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0075425_1011573272 | 3300006854 | Populus Rhizosphere | FALTEGPYFVGLNTTTHTCSVVTKMEAGMKMMGKYKTKAAAEKAMAGMACRM* |
| Ga0075425_1017991651 | 3300006854 | Populus Rhizosphere | CSVVTKMSPGMKRMGKFKSKEAAEKAMAGMKKCHA* |
| Ga0075425_1019441661 | 3300006854 | Populus Rhizosphere | PALALTSGVYYVGLDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0075429_1010758211 | 3300006880 | Populus Rhizosphere | ALALTSGVYYVGLDMTTHTCSVVTHLTHGMEMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0068865_1013171081 | 3300006881 | Miscanthus Rhizosphere | HTCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0075436_1013615291 | 3300006914 | Populus Rhizosphere | HTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0075435_1015427601 | 3300007076 | Populus Rhizosphere | PALALTSGVYYVGLDMTTHTCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0105250_100206255 | 3300009092 | Switchgrass Rhizosphere | TTHTCSVVTHLTHGMEMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0114129_101872531 | 3300009147 | Populus Rhizosphere | CSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0111538_139110211 | 3300009156 | Populus Rhizosphere | SGVYYVGLDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0105237_101871804 | 3300009545 | Corn Rhizosphere | TCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0116223_102962272 | 3300009839 | Peatlands Soil | GLDTATHTCSVVTSMSPGMKRMGKYKTQAAAEKAMHGMKKCQG* |
| Ga0126382_108278371 | 3300010047 | Tropical Forest Soil | EGPYFVGLNTTTHTCSVVTKMEAGMKMMGKYKTKAAAEKAMAGMAECKA* |
| Ga0134125_108661492 | 3300010371 | Terrestrial Soil | MTTHTCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0126383_100498204 | 3300010398 | Tropical Forest Soil | VGLDTTTHTCSVMTEMKAGMKMMGKYKSKEEAEKAMASMAECKG* |
| Ga0134123_111190721 | 3300010403 | Terrestrial Soil | YVGLDMTTHTCSVVTKLAPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0124844_10392491 | 3300010868 | Tropical Forest Soil | MYFVGLDTTTHTCSVMTEMKAGMKMMGKYKSKEEAEKAMASMAECKG* |
| Ga0124844_12677472 | 3300010868 | Tropical Forest Soil | YFVGLDTTTHTCSVMTEMKAGMKMMGKYKSKEEAEKAMASMAECKG* |
| Ga0120139_10024521 | 3300012019 | Permafrost | TYYVGLDPTTHTCSVVTKMTTGMKMMGKYKSKEAAETAMAGMKKCHA* |
| Ga0137386_111957372 | 3300012351 | Vadose Zone Soil | DTTTHTCSVVTKMTTGMKKMGKYKSKEAAETAMAGMKKCHA* |
| Ga0157285_100073603 | 3300012897 | Soil | LALTSGVYYVGLDVTTHTCSVVTKMSHGIKMMGKYKFKEAAEKAMAGMKKCHA* |
| Ga0157293_102054011 | 3300012898 | Soil | LALTTGTYYVGLDTSSHTCSVVTKMAPGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0157299_100259492 | 3300012899 | Soil | TCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0157299_100937041 | 3300012899 | Soil | DMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0157290_102043581 | 3300012909 | Soil | LALTSGVYYVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMNGMKKCHA* |
| Ga0157308_101588952 | 3300012910 | Soil | LALTSGVYYVGLDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0157301_103339792 | 3300012911 | Soil | ALTSGVYYVGLDMTTHTSSVVTEMKPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0157301_104253351 | 3300012911 | Soil | TAGTYYVGLDMTTHTCSVVTHMAHGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0164298_104278371 | 3300012955 | Soil | MTTHTCSVVTHLTHGMEMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0164299_102655361 | 3300012958 | Soil | LTVGTYYVGLDTSSHTCSVVTKMTPGMKMMGKYKSKEAAEKAMAGMKKCHA* |
| Ga0164301_113117302 | 3300012960 | Soil | LDVTTHTCSVVTKMSHGMKMRGKYKSKEAAEKAMAGMKKCHAYTFRVYEFS* |
| Ga0120181_10217221 | 3300013766 | Permafrost | GTYYVGLDNTTHTCSVVTKMTTGMKMMGKYKSKEAAETAMAGMKKCHA* |
| Ga0120123_10249604 | 3300013770 | Permafrost | GTYYVGLDTTTHTCSVVTTMTTGMKMMGKYKSKEAAEKAMAGMKKCKA* |
| Ga0120109_10448911 | 3300014052 | Permafrost | GTYYVGLDTTTHTCSVVTTMTTGMKMMGKYKSKEAAKKAMAGMKKCKA* |
| Ga0120109_11251461 | 3300014052 | Permafrost | TGTYYVGLDTTTHTCSVVTKMTTGMKMMGKYKSKEAADTAMASMKKCHA* |
| Ga0120125_10407064 | 3300014056 | Permafrost | TGTYYVGLDTTTHTCSVVTTMTTGMKMMGKYKSKEAAEKAMAGMKKCKA* |
| Ga0157380_130077671 | 3300014326 | Switchgrass Rhizosphere | VGLDMTTHTCSVVTKMGPGMKMMGKYKSQKAAEKAMAGMKKCHA* |
| Ga0132258_139301043 | 3300015371 | Arabidopsis Rhizosphere | SQGVGGEWYVGLDTATNKCSVVSSMPSGMKMMGKYKSKEEAETAMHGMKECKV* |
| Ga0132256_1001625474 | 3300015372 | Arabidopsis Rhizosphere | GLDMTTHTCSVVTKMSHGMKMMGKYKSREAAEKAMAGMKKCHA* |
| Ga0182041_109543352 | 3300016294 | Soil | PYFVGLNTTTHTCSVVTKMESGMKMMGKYKTHSAAERAMARMKECKG |
| Ga0182041_116826501 | 3300016294 | Soil | ALVSGPYFVGLNTTTHTCSVVTKMEPGMKMMGTYKSHSAAERAMARMKECKG |
| Ga0182033_122229122 | 3300016319 | Soil | SGVYYVGLDKTTHTCSVVTSLAPGMKMMGKFKSQAAAEKAMHGMKACKA |
| Ga0182035_115008061 | 3300016341 | Soil | HTCSVVTKMEPGMKMMGKYKSQAAAEKAMARMKECKG |
| Ga0182039_109167601 | 3300016422 | Soil | LTSGTYYVGLDTTTHKCSVVTEMKSGMKIMGKYDSKEAAEKAMSSMKECKA |
| Ga0182038_106711291 | 3300016445 | Soil | ALVSGPYVVGLNTTTHTCSVVTKMEPGMKMMGKYKSHSAAERAMARMKECKG |
| Ga0182038_116319251 | 3300016445 | Soil | MPGAGPYFVGLDTATHKCSVVTSMTAGMKMMGKYSSKARAERAMHRMKECKG |
| Ga0187818_104106901 | 3300017823 | Freshwater Sediment | TCSVVTKMTAGMKMMGKYKSKEAAEKAMAGMKECKGG |
| Ga0187806_12543381 | 3300017928 | Freshwater Sediment | ALALTAGKYYVGLDTTTHTCSVVTHMSAGMKMMGRYRSKAAAEKAMAGMKECQG |
| Ga0187809_100237845 | 3300017937 | Freshwater Sediment | GEYYVGLDTATHTCSVVTKMTAGMKMMGKYKSKEAAEKAMASMKECKA |
| Ga0187819_105547202 | 3300017943 | Freshwater Sediment | GAYYVGFDTATKKCSVVNKMAAGMKMMGKYKTQEAAEKAMAGMKECKA |
| Ga0187817_102666833 | 3300017955 | Freshwater Sediment | ALALTSSRYYVGLDTTTHTCSVVTHMSAGMKMMGRYHSKAAAEKAMAGMKECKG |
| Ga0187815_103083961 | 3300018001 | Freshwater Sediment | YYVGFDTATKKCSVVNKMAAGMKMMGKYKTREAAEKAMAGMKECKA |
| Ga0173481_102295702 | 3300019356 | Soil | TTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0126371_120022062 | 3300021560 | Tropical Forest Soil | CSVMTEMKAGMKMMGKYKSKEEAEKAMASMKECKA |
| Ga0126371_134990482 | 3300021560 | Tropical Forest Soil | GPYFVGLNTTTHTCSVVRHMSAGMKMMGTFKTRAAAEKAMAGMKECKG |
| Ga0247801_10130571 | 3300023064 | Soil | ATPALALTSGVYYVGLDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0247793_10352962 | 3300023066 | Soil | YVGLDMTTHTCSVVTEMKPGMKMMGKYKSQKAAEKAMAGMKKCHA |
| Ga0247796_10169191 | 3300023261 | Soil | YYVGLDMTTHTCSVVTEMKPGMKMMGKYKSQKAAEKAMAGMKKCHA |
| Ga0207682_103679542 | 3300025893 | Miscanthus Rhizosphere | LALTSGVYYVGLDMTTHTCSVVTHLTHGMEMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0207692_102653501 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTHTCSVVTHLTHGMEMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0207663_115405702 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTHTCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA |
| Ga0207659_105749701 | 3300025926 | Miscanthus Rhizosphere | TPAFALTAGTYYVGLDMTTHRCSVVTHMAHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0207670_106676451 | 3300025936 | Switchgrass Rhizosphere | SIMWGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0207691_1001276017 | 3300025940 | Miscanthus Rhizosphere | YVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0207691_104513191 | 3300025940 | Miscanthus Rhizosphere | TCSVVTHLTHGMEMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0207711_103069651 | 3300025941 | Switchgrass Rhizosphere | LDMTTHTCAVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0207651_102388621 | 3300025960 | Switchgrass Rhizosphere | VHYVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0207658_102349396 | 3300025986 | Switchgrass Rhizosphere | LALTSGVYYVGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKFHA |
| Ga0207639_103660323 | 3300026041 | Corn Rhizosphere | CGLDVTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0207641_126070121 | 3300026088 | Switchgrass Rhizosphere | TPALALTSGVYYVGLDMTTHTCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA |
| Ga0210000_10410402 | 3300027462 | Arabidopsis Thaliana Rhizosphere | GLDTSSHTCSVVTKMAPGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0209073_101922341 | 3300027765 | Agricultural Soil | SGVYYVGLDMTTHTCSVVTHLTHGMEMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0209074_102941552 | 3300027787 | Agricultural Soil | DMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0209465_103168471 | 3300027874 | Tropical Forest Soil | LALTSGTYYVGLDTTTHKCSVVTEMKAGMKMMGKYDSKEAAEKAMSSMKECKA |
| Ga0209382_106721032 | 3300027909 | Populus Rhizosphere | GLDMTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0318541_108372161 | 3300031545 | Soil | LALTSGTYYVGLDTTTHKCSLVTEMKSGMKMMGKYDSKEAAEKAMSIMKECKA |
| Ga0310915_108009061 | 3300031573 | Soil | EAEQYYVGLDTTTHTCSVVTKMTPGMKMMGKYKSKEAAEKAMAGMKECKG |
| Ga0310813_110188811 | 3300031716 | Soil | VGLDMTTHTCSVVTHMTHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0318537_101979531 | 3300031763 | Soil | FVGLNTTTHTCSVVTKMEAGMKMMGKYKTKAAAEKAMAGMAECKA |
| Ga0318546_109867301 | 3300031771 | Soil | TTTHTCSVVTKMTPGMKMMGKYKSKEAAEKAMAGMKECKG |
| Ga0306919_101747301 | 3300031879 | Soil | EQIPSSYKMDTTTHTCSVMTEMKAGMKMMGKYKSKEEAEKAMAGMKECKVLT |
| Ga0306919_111008211 | 3300031879 | Soil | VGLDTTTHTCSVMTEMKAGMKMMGKYKSQEEAEKAMAGMKECHA |
| Ga0306923_105328943 | 3300031910 | Soil | VYYVGLDKTTHSCSVVTSLAPGMKMMGKFKSQAAAEKAMHGMKACKA |
| Ga0306923_111958302 | 3300031910 | Soil | MDTTTHTCSVMTEMKAGMKMMGKYKSKEEAEKAMAGMKECKV |
| Ga0310901_103874981 | 3300031940 | Soil | MTTHTCSVVTKMSHGMKMMGKYKSKEAAEKAMAGMKKCHA |
| Ga0310912_107775331 | 3300031941 | Soil | LNTTTHTCSVVTKMEAGMKMMGKYKTKAAAEKAMAGMAECKA |
| Ga0310916_110653362 | 3300031942 | Soil | AMPGAAPYFVGLDPTTHKCSVVTSMAPGMKNMGKFRTQARAERAMARMKKCKG |
| Ga0310909_111176191 | 3300031947 | Soil | YVGLDMTTHTCSVKTEMKSGMKNMGKFNSKEAAEKAMAGMKECKA |
| Ga0306926_107478011 | 3300031954 | Soil | MDTTTHTCSVMTEMKAGMKMMGKYKSKEEAEKAMAGMKECKVLT |
| Ga0306922_121147642 | 3300032001 | Soil | ALVAGPYFVGLNTTTHTCSVVTKMEAGMKMMGKYKTKAAAEKAMAGMKECKG |
| Ga0310906_109866921 | 3300032013 | Soil | SSHTCSVVTKMAPGMKMMGKYKSKEAAEKAMAGMQKCHA |
| Ga0318533_111065332 | 3300032059 | Soil | VTPALALVAGPYFVGLNTTTHTCSVVTKMEAGMKMMGKYKTKAAAEKAMAGMKECKG |
| Ga0310890_101382454 | 3300032075 | Soil | YYVGLDMTTHTCSVVTKMAPGMKMMGKYKSQKAAEKAMAGMKKCHA |
| Ga0310895_101182342 | 3300032122 | Soil | VGLDTATNKCSVVSSMPSGMKMMGKYKSKEEAETAMHGMKEC |
| Ga0306920_1015792323 | 3300032261 | Soil | YALESGVYYVGLDTTTHTCSVMTEMKAGMKMMGKYKSKEEAEKAMAGMKECKV |
| Ga0335081_111200741 | 3300032892 | Soil | ALEASEYYVGLDTTTHTCSVVTKMTAGMKMMGKYKSKEAAEKAMAGMKECKA |
| ⦗Top⦘ |