


| Basic Information | |
|---|---|
| Family ID | F069928 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PRCPHCKARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYE |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 27.87 % |
| % of genes near scaffold ends (potentially truncated) | 69.92 % |
| % of genes from short scaffolds (< 2000 bps) | 78.05 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.187 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.390 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.520 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.659 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.09% Coil/Unstructured: 73.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF02517 | Rce1-like | 13.82 |
| PF05138 | PaaA_PaaC | 11.38 |
| PF01872 | RibD_C | 8.94 |
| PF02634 | FdhD-NarQ | 5.69 |
| PF06243 | PaaB | 2.44 |
| PF00202 | Aminotran_3 | 1.63 |
| PF02861 | Clp_N | 1.63 |
| PF16864 | Dimerisation2 | 1.63 |
| PF00781 | DAGK_cat | 0.81 |
| PF00486 | Trans_reg_C | 0.81 |
| PF03704 | BTAD | 0.81 |
| PF13458 | Peripla_BP_6 | 0.81 |
| PF02781 | G6PD_C | 0.81 |
| PF10604 | Polyketide_cyc2 | 0.81 |
| PF01883 | FeS_assembly_P | 0.81 |
| PF04075 | F420H2_quin_red | 0.81 |
| PF06271 | RDD | 0.81 |
| PF13147 | Obsolete Pfam Family | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 13.82 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 13.82 |
| COG3396 | 1,2-phenylacetyl-CoA epoxidase, catalytic subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 11.38 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 8.94 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 8.94 |
| COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 5.69 |
| COG3460 | 1,2-phenylacetyl-CoA epoxidase, PaaB subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.44 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 1.63 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.63 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.81 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.81 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.19 % |
| Unclassified | root | N/A | 0.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001326|A2835W6_1018870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 800 | Open in IMG/M |
| 3300002558|JGI25385J37094_10002373 | All Organisms → cellular organisms → Bacteria | 6269 | Open in IMG/M |
| 3300002908|JGI25382J43887_10000292 | All Organisms → cellular organisms → Bacteria | 15424 | Open in IMG/M |
| 3300004479|Ga0062595_100844307 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005174|Ga0066680_10100851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1766 | Open in IMG/M |
| 3300005177|Ga0066690_10470074 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005178|Ga0066688_10000128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20002 | Open in IMG/M |
| 3300005186|Ga0066676_10044410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2497 | Open in IMG/M |
| 3300005436|Ga0070713_102474243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300005444|Ga0070694_101279662 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005445|Ga0070708_100278728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1573 | Open in IMG/M |
| 3300005454|Ga0066687_10879741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 534 | Open in IMG/M |
| 3300005545|Ga0070695_100028899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3442 | Open in IMG/M |
| 3300005553|Ga0066695_10648424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300005554|Ga0066661_10146386 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300005554|Ga0066661_10409770 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005554|Ga0066661_10724435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300005556|Ga0066707_11027300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300005557|Ga0066704_10031669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3232 | Open in IMG/M |
| 3300005568|Ga0066703_10237518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1107 | Open in IMG/M |
| 3300005568|Ga0066703_10568741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300005575|Ga0066702_10336688 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005764|Ga0066903_100856051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1637 | Open in IMG/M |
| 3300006028|Ga0070717_11008989 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300006034|Ga0066656_10019900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3573 | Open in IMG/M |
| 3300006050|Ga0075028_100967914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300006794|Ga0066658_10426609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 721 | Open in IMG/M |
| 3300006796|Ga0066665_10009333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5604 | Open in IMG/M |
| 3300006804|Ga0079221_10455111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 814 | Open in IMG/M |
| 3300006804|Ga0079221_10912640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 646 | Open in IMG/M |
| 3300006806|Ga0079220_11481976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| 3300006854|Ga0075425_100567039 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300006903|Ga0075426_11179527 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006904|Ga0075424_100692295 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300006914|Ga0075436_100100276 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
| 3300007255|Ga0099791_10009103 | All Organisms → cellular organisms → Bacteria | 4120 | Open in IMG/M |
| 3300007265|Ga0099794_10791270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 507 | Open in IMG/M |
| 3300009012|Ga0066710_103450564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300009088|Ga0099830_10937133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 716 | Open in IMG/M |
| 3300009089|Ga0099828_10133564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2180 | Open in IMG/M |
| 3300009090|Ga0099827_10077457 | All Organisms → cellular organisms → Bacteria | 2585 | Open in IMG/M |
| 3300009649|Ga0105855_1245363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
| 3300010043|Ga0126380_10472083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Euzebyales → Euzebyaceae → unclassified Euzebyaceae → Euzebyaceae bacterium | 954 | Open in IMG/M |
| 3300010159|Ga0099796_10346906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 639 | Open in IMG/M |
| 3300010329|Ga0134111_10534384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300010333|Ga0134080_10078157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1336 | Open in IMG/M |
| 3300010366|Ga0126379_12392878 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010371|Ga0134125_11283514 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300010396|Ga0134126_11771866 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012189|Ga0137388_11259039 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012200|Ga0137382_11119288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 562 | Open in IMG/M |
| 3300012204|Ga0137374_10102059 | All Organisms → cellular organisms → Bacteria | 2700 | Open in IMG/M |
| 3300012205|Ga0137362_10811541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 801 | Open in IMG/M |
| 3300012207|Ga0137381_10704485 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300012208|Ga0137376_10089450 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
| 3300012208|Ga0137376_10120055 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
| 3300012285|Ga0137370_10005210 | All Organisms → cellular organisms → Bacteria | 5886 | Open in IMG/M |
| 3300012349|Ga0137387_10382513 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300012349|Ga0137387_10610607 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012351|Ga0137386_11262631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300012359|Ga0137385_10053995 | All Organisms → cellular organisms → Bacteria | 3587 | Open in IMG/M |
| 3300012361|Ga0137360_10369872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1203 | Open in IMG/M |
| 3300012685|Ga0137397_10204507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1469 | Open in IMG/M |
| 3300012917|Ga0137395_11198302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300012927|Ga0137416_10273338 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300012927|Ga0137416_11054598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 728 | Open in IMG/M |
| 3300012944|Ga0137410_11114083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 676 | Open in IMG/M |
| 3300013758|Ga0120147_1027740 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300013763|Ga0120179_1003003 | All Organisms → cellular organisms → Bacteria | 5166 | Open in IMG/M |
| 3300013766|Ga0120181_1012522 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
| 3300014829|Ga0120104_1087248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 617 | Open in IMG/M |
| 3300015193|Ga0167668_1011347 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300015357|Ga0134072_10331591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
| 3300017654|Ga0134069_1298855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300018027|Ga0184605_10154076 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300018028|Ga0184608_10228828 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300018071|Ga0184618_10105791 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300018431|Ga0066655_10006409 | All Organisms → cellular organisms → Bacteria | 4862 | Open in IMG/M |
| 3300018468|Ga0066662_10126767 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300018468|Ga0066662_10300995 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300018468|Ga0066662_12674985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300019885|Ga0193747_1063650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 912 | Open in IMG/M |
| 3300021180|Ga0210396_10675731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Euzebyales → Euzebyaceae → unclassified Euzebyaceae → Euzebyaceae bacterium | 893 | Open in IMG/M |
| 3300025910|Ga0207684_10735196 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300025922|Ga0207646_10167568 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300026309|Ga0209055_1013286 | All Organisms → cellular organisms → Bacteria | 4206 | Open in IMG/M |
| 3300026309|Ga0209055_1149460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 807 | Open in IMG/M |
| 3300026309|Ga0209055_1246221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
| 3300026309|Ga0209055_1268688 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300026317|Ga0209154_1206182 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300026322|Ga0209687_1119584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 849 | Open in IMG/M |
| 3300026326|Ga0209801_1269312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 626 | Open in IMG/M |
| 3300026333|Ga0209158_1002029 | All Organisms → cellular organisms → Bacteria | 12841 | Open in IMG/M |
| 3300026469|Ga0257169_1083207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300026540|Ga0209376_1305181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 623 | Open in IMG/M |
| 3300026540|Ga0209376_1410812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300026547|Ga0209156_10383927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300026548|Ga0209161_10349008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
| 3300027681|Ga0208991_1072928 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300027681|Ga0208991_1102779 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300027738|Ga0208989_10079828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1119 | Open in IMG/M |
| 3300027738|Ga0208989_10205202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300027765|Ga0209073_10088147 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300027787|Ga0209074_10062056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1174 | Open in IMG/M |
| 3300027857|Ga0209166_10589331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300027862|Ga0209701_10219029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1127 | Open in IMG/M |
| 3300027862|Ga0209701_10732030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300027875|Ga0209283_10019914 | All Organisms → cellular organisms → Bacteria | 4098 | Open in IMG/M |
| 3300027875|Ga0209283_10657612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 659 | Open in IMG/M |
| 3300027882|Ga0209590_10020978 | All Organisms → cellular organisms → Bacteria | 3297 | Open in IMG/M |
| 3300027882|Ga0209590_10853092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 576 | Open in IMG/M |
| 3300027910|Ga0209583_10270913 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300027915|Ga0209069_10352079 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300028884|Ga0307308_10445978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 621 | Open in IMG/M |
| 3300030596|Ga0210278_1008513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1240 | Open in IMG/M |
| 3300031672|Ga0307373_10553209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
| 3300031720|Ga0307469_10010435 | All Organisms → cellular organisms → Bacteria | 4515 | Open in IMG/M |
| 3300031720|Ga0307469_10316198 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300031720|Ga0307469_12446652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| 3300031823|Ga0307478_10350557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1216 | Open in IMG/M |
| 3300032180|Ga0307471_103544592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300032261|Ga0306920_102721072 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.06% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.06% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.63% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001326 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2835W6_10188702 | 3300001326 | Permafrost | MSSLPRRDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYE* |
| JGI25385J37094_100023734 | 3300002558 | Grasslands Soil | MPRCPHCREKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD* |
| JGI25382J43887_100002921 | 3300002908 | Grasslands Soil | MPRCPHCQEKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD* |
| Ga0062595_1008443072 | 3300004479 | Soil | VCPHCKARDPEVISLFGTQAMTLQYRCRRCATVFEAIKYE* |
| Ga0066680_101008511 | 3300005174 | Soil | REMPRCPHCREKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD* |
| Ga0066690_104700742 | 3300005177 | Soil | TSPRRGEGAEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKY* |
| Ga0066688_1000012812 | 3300005178 | Soil | MPRCPHCREKDSEVISLFGTQAMTLQYRCNRCGTVFEAIKYD* |
| Ga0066676_100444104 | 3300005186 | Soil | MPRCPHCRATDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYSG* |
| Ga0070713_1024742431 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PRCPHCHARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYDA* |
| Ga0070694_1012796622 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | PQCPHCREKDADVISLFGTQAMTLQYRCVRCGTVFEAIKYD* |
| Ga0070708_1002787282 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRCPHCHARDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYSD* |
| Ga0066687_108797411 | 3300005454 | Soil | PPRNTPRPEPRCPHCQARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD* |
| Ga0070699_1005335791 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PPRSDPHCPHCRAQDAEVISLFGTQAMTLQYRCRRCGTLFEAVKYSE* |
| Ga0070695_1000288992 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQCPHCREKDADVISLFGTQAMTLQYRCVRCGTVFEAIKYD* |
| Ga0066695_106484241 | 3300005553 | Soil | ARDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD* |
| Ga0066661_101463861 | 3300005554 | Soil | EGSREMPRCPHCREKDSEVISLFGTQAMTLQYRCNRCGTVFEAIKYD* |
| Ga0066661_104097701 | 3300005554 | Soil | CGERDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD* |
| Ga0066661_107244351 | 3300005554 | Soil | RRDSPRCTHCGERDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD* |
| Ga0066707_110273001 | 3300005556 | Soil | RTEPAPTNPRCPHCHAQEAEVISLFGTQAMTLQYRCRKCGTLFEALKY* |
| Ga0066704_100316696 | 3300005557 | Soil | RCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG* |
| Ga0066703_102375181 | 3300005568 | Soil | AEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD* |
| Ga0066703_105687412 | 3300005568 | Soil | SKPRTDPRCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG* |
| Ga0066702_103366881 | 3300005575 | Soil | ARDAEVISLFGTQAMTLQYRCRRCRTLFEAIKYD* |
| Ga0066903_1008560511 | 3300005764 | Tropical Forest Soil | RDAEVISLFGTQAMTLQYRCRRCGTLFEAVKYDG* |
| Ga0070717_110089891 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | CSARDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYEE* |
| Ga0066656_100199001 | 3300006034 | Soil | PPGGEVPDPRCPHCSARDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYD* |
| Ga0075028_1009679141 | 3300006050 | Watersheds | RCPHCRERDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYES* |
| Ga0066658_104266091 | 3300006794 | Soil | RSSPRCPHCGATDAEVLSLFGTQAMTLQYRCRSCATIYEAIKYDPPT* |
| Ga0066665_100093331 | 3300006796 | Soil | CPHCGKRDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD* |
| Ga0079221_104551113 | 3300006804 | Agricultural Soil | MPRCPHCKAKDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYAD* |
| Ga0079221_109126402 | 3300006804 | Agricultural Soil | VPALQAQDAEVISLFGTQAMTLQYRCRKCATVFEGLKY* |
| Ga0079220_114819762 | 3300006806 | Agricultural Soil | MPRCPHCKAKDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYSD* |
| Ga0075425_1005670391 | 3300006854 | Populus Rhizosphere | MPRCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG* |
| Ga0075426_111795272 | 3300006903 | Populus Rhizosphere | NPRCPHCKSQDAEVISLFGTQAMTLQYRCRNCGTYFEALKY* |
| Ga0075424_1006922953 | 3300006904 | Populus Rhizosphere | PHCRSTDAEVISLFGTQAMTLQYRCRKCGTVFEAIKY* |
| Ga0075436_1001002765 | 3300006914 | Populus Rhizosphere | MRKLSPIEKKPKCPHCQAQDAEVISLFGTQAMTLQYRCRKCGTVFEGLKY* |
| Ga0099791_100091033 | 3300007255 | Vadose Zone Soil | MPTCPHCHARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYDR* |
| Ga0099794_107912701 | 3300007265 | Vadose Zone Soil | AHDAEVISLFGAQAMTLQYKCRRCGTLFEAIKYD* |
| Ga0066710_1034505641 | 3300009012 | Grasslands Soil | PRCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG |
| Ga0099830_109371331 | 3300009088 | Vadose Zone Soil | HCGMRDAKVISLFGTQAMTLQYRCRKCGTLFEAIKYGE* |
| Ga0099828_101335642 | 3300009089 | Vadose Zone Soil | MRDAKVISLFGTQAMTLQYRCRKCGTLFEAIKYGE* |
| Ga0099827_100774574 | 3300009090 | Vadose Zone Soil | LPSCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKY* |
| Ga0105855_12453632 | 3300009649 | Permafrost Soil | PRAEPRCPHCAERDAEVISLFGMQAMTLQYRCRRCGTLFEAIKYEA* |
| Ga0126380_104720831 | 3300010043 | Tropical Forest Soil | APRCPRCGAVDGEVISLFGTQAMTLQYRCGSCGDLYEALKYPVEEDQ* |
| Ga0099796_103469061 | 3300010159 | Vadose Zone Soil | RAEPRCPHCAERDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYSE* |
| Ga0134111_105343841 | 3300010329 | Grasslands Soil | CSARDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYD* |
| Ga0134080_100781573 | 3300010333 | Grasslands Soil | PEGAREMPRCPHCQEKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD* |
| Ga0126379_123928782 | 3300010366 | Tropical Forest Soil | MPRCPHCGATESEVISLFGTQAMTLQYRCRRCGDFYEALKYEEEEERP* |
| Ga0134125_112835142 | 3300010371 | Terrestrial Soil | CSAQDAEVISLFGTQAMTLQYRCRRCATLFEAIKYEQA* |
| Ga0134126_117718661 | 3300010396 | Terrestrial Soil | RCPHCQATGAEVISLFGTQAMTLQYRCRRCGTVFEALKYD* |
| Ga0137388_112590392 | 3300012189 | Vadose Zone Soil | LRGEGAEPRCPHCSSREAEVISLFGTQAMTLQYKCRKCGTVFEAIKYG* |
| Ga0137382_111192881 | 3300012200 | Vadose Zone Soil | MPRCPHCREQDSEVISLFGTQAMTLQYRCKRCGTVFE |
| Ga0137374_101020595 | 3300012204 | Vadose Zone Soil | MPACPHCKALDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYS* |
| Ga0137362_108115412 | 3300012205 | Vadose Zone Soil | MPRCPHCSATDAEVISLFGTQAMTLQYRCKRCGTVFEAIKYG* |
| Ga0137381_107044851 | 3300012207 | Vadose Zone Soil | KAPKCPHCHQTDAEVISLFGTQAMTLQYRCRRCGTVFEALKYD* |
| Ga0137376_100894505 | 3300012208 | Vadose Zone Soil | PHCRENDAEVISLFGTQAMTLQYRCKRCGTVFEAIKYG* |
| Ga0137376_101200552 | 3300012208 | Vadose Zone Soil | MPRCPHCREQDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD* |
| Ga0137370_100052109 | 3300012285 | Vadose Zone Soil | MPRCPHCRETDAEVISLFGTQAMTLQYRCKRCGTVFEAIKYD* |
| Ga0137387_103825132 | 3300012349 | Vadose Zone Soil | MPRCPHCRATDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYPG* |
| Ga0137387_106106072 | 3300012349 | Vadose Zone Soil | CPHCHAQEAEVISLFGTQAMTLQYRCRKCGTLFEALKY* |
| Ga0137386_112626312 | 3300012351 | Vadose Zone Soil | CHAQDAEVISLFGTQAMTLQYRCRKCGTLFEALKY* |
| Ga0137385_100539954 | 3300012359 | Vadose Zone Soil | MPRCPHCQEKDSEVISLFGTQAMTLQYRCMRCGTVFEAIKYD* |
| Ga0137360_103698721 | 3300012361 | Vadose Zone Soil | CPHCQAQDAEVISLFGTQAMTLQYRCRKCGTYFEGLKY* |
| Ga0137397_102045073 | 3300012685 | Vadose Zone Soil | MPTCPHCHARDAEVISLFGTQAMTLQYRCRKCGALFEAIKYDR* |
| Ga0137395_111983021 | 3300012917 | Vadose Zone Soil | HCQAQDAEVISLFGTQAMTLQYRCRKCATYFEALKY* |
| Ga0137416_102733383 | 3300012927 | Vadose Zone Soil | VTPRADPRCPHCRARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYDR* |
| Ga0137416_110545982 | 3300012927 | Vadose Zone Soil | GAHDAEVISLFGTQAMTLQYKCRRCGTLFEAIKYD* |
| Ga0137410_111140832 | 3300012944 | Vadose Zone Soil | VEPACPHCRAREAEVISLFGTQAMTLQYRCRKCGTVFEAIKYDR* |
| Ga0120147_10277401 | 3300013758 | Permafrost | ERDAEVISLFGMQAMTLQYRCRRCGTLFEAIKYEE* |
| Ga0120179_10030038 | 3300013763 | Permafrost | RCPHCAERDAEVISLFGMQAMTLQYRCRRCGTLFEAIKYEE* |
| Ga0120181_10125221 | 3300013766 | Permafrost | PHCAKRDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYEE* |
| Ga0120104_10872482 | 3300014829 | Permafrost | PHCSERDAQVISLFGTQAMTLQYRCRRCGTLFEAVKYEE* |
| Ga0167668_10113472 | 3300015193 | Glacier Forefield Soil | LPDPTCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD* |
| Ga0134072_103315911 | 3300015357 | Grasslands Soil | PRNQPRSEPRCPHCNAKDSELISLFGTQAMTLQYRCRKCGTVFEAIKYA* |
| Ga0134069_12988551 | 3300017654 | Grasslands Soil | TSPPGGEVPDPRCPHCSARDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYD |
| Ga0184605_101540761 | 3300018027 | Groundwater Sediment | VPEEEQEEEQPRTSPRCPHCRATDGEVLSLFGTQAMTLQYRCRACGTIYE |
| Ga0184608_102288281 | 3300018028 | Groundwater Sediment | MPRCPHCRATDAEVISLFGTQAMTLQYRCRKCGTLFEAIK |
| Ga0184618_101057913 | 3300018071 | Groundwater Sediment | FQRDAQVISLFGTQAMTLQYRCRRCATLFEAVKYEE |
| Ga0066655_100064097 | 3300018431 | Grasslands Soil | MPRCPHCQEKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD |
| Ga0066662_101267671 | 3300018468 | Grasslands Soil | RCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG |
| Ga0066662_103009952 | 3300018468 | Grasslands Soil | MPRCPHCREKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD |
| Ga0066662_126749851 | 3300018468 | Grasslands Soil | RCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD |
| Ga0193747_10636502 | 3300019885 | Soil | MPRCPHCKATDAEVISLFGTQAMTLQYRCTQCGTMFEAIKYG |
| Ga0210396_106757311 | 3300021180 | Soil | AEVISLFGTQAMTLQYRCRRCGDIFEALKYEDGDEKG |
| Ga0207684_107351961 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PRNQPRSEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKYS |
| Ga0207646_101675681 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AVPHCKAQDAEVISLFGTQAMTLQYRCRKCGTLFEALKY |
| Ga0209055_10132861 | 3300026309 | Soil | EPRCPHCNAKDSELISLFGTQAMTLQYRCRKCGTVFEAIKYA |
| Ga0209055_11494603 | 3300026309 | Soil | HCSARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG |
| Ga0209055_12462212 | 3300026309 | Soil | PRCPHCREKDSEVISLFGTQAMTLQYRCNRCGTVFEAIKYD |
| Ga0209055_12686881 | 3300026309 | Soil | CGERDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD |
| Ga0209154_12061821 | 3300026317 | Soil | SSPRCTHCGERDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD |
| Ga0209687_11195843 | 3300026322 | Soil | DPRCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG |
| Ga0209801_12693122 | 3300026326 | Soil | RCPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKY |
| Ga0209158_100202917 | 3300026333 | Soil | MPRCPHCREKDSEVISLFGTQAMTLQYRCNRCGTVFEAIKYD |
| Ga0257169_10832071 | 3300026469 | Soil | DPPRSDPRCPHCIARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYG |
| Ga0209376_13051812 | 3300026540 | Soil | NPRCPHCHEQDAEVISLFGTQAMTLQYRCRKCGTLFEALKY |
| Ga0209376_14108121 | 3300026540 | Soil | GTEPAPTNPRCPHCHAQEAEVISLFGTQAMTLQYRCRKCGTLFEALKY |
| Ga0209156_103839271 | 3300026547 | Soil | RPEAARETPRCPHCRENDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYG |
| Ga0209161_103490081 | 3300026548 | Soil | HCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG |
| Ga0208991_10729281 | 3300027681 | Forest Soil | ARDAEVISLFGTQAMTLQYRCRKCGTLFEGIKYSG |
| Ga0208991_11027792 | 3300027681 | Forest Soil | KPREEPRCPHCRERNAEVISLFGTQAMTLQYRCRKCGTVFEAIKYEA |
| Ga0208989_100798283 | 3300027738 | Forest Soil | ERNAEVISLFGTQAMTLQYRCRKCGTVFEAIKYEA |
| Ga0208989_102052022 | 3300027738 | Forest Soil | PRCPHCKARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYE |
| Ga0209073_100881473 | 3300027765 | Agricultural Soil | PRSEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTLFEAIKY |
| Ga0209074_100620561 | 3300027787 | Agricultural Soil | CPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKY |
| Ga0209166_105893312 | 3300027857 | Surface Soil | PRCPHCSAMDAEVISLFGTQAMTLQYRCRRCATLFEAIKYD |
| Ga0209701_102190291 | 3300027862 | Vadose Zone Soil | HCGMRDAKVISLFGTQAMTLQYRCRKCGTLFEAIKYGE |
| Ga0209701_107320302 | 3300027862 | Vadose Zone Soil | THCGARDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD |
| Ga0209283_100199141 | 3300027875 | Vadose Zone Soil | PHCGARDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYA |
| Ga0209283_106576122 | 3300027875 | Vadose Zone Soil | CPHCGARDARVISLFGTQAMTLQYRCRKCGTLFEAIKYD |
| Ga0209590_100209785 | 3300027882 | Vadose Zone Soil | LPSCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKY |
| Ga0209590_108530922 | 3300027882 | Vadose Zone Soil | MPRCPHCSATDAEVISLFGTQAMTLQYRCKRCGTVFEAIKYG |
| Ga0209583_102709131 | 3300027910 | Watersheds | PRSDPRCPHCHARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYE |
| Ga0209069_103520791 | 3300027915 | Watersheds | RCPHCRERDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYES |
| Ga0307308_104459782 | 3300028884 | Soil | HCRAQDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYSQ |
| Ga0210278_10085132 | 3300030596 | Soil | VEPRSDPRCPHCTERDAQVISLFGTQAMTLQYRCRRCGTLFEAIKYDE |
| Ga0307373_105532092 | 3300031672 | Soil | QPRAAPRCPHCAERDAEVISLFGTQAMTLQYRCRKCRTLFEAIKYEE |
| Ga0307469_100104353 | 3300031720 | Hardwood Forest Soil | MPRCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYR |
| Ga0307469_103161983 | 3300031720 | Hardwood Forest Soil | CSERDAQVISLFGTQAMTLQYRCRRCGTLFEAIKYEE |
| Ga0307469_124466522 | 3300031720 | Hardwood Forest Soil | MPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTLFEAIKYS |
| Ga0307478_103505571 | 3300031823 | Hardwood Forest Soil | QPHSEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTLFEAIKYS |
| Ga0307471_1035445922 | 3300032180 | Hardwood Forest Soil | PRCPHCEARDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYD |
| Ga0306920_1027210721 | 3300032261 | Soil | KAGDAEVISLFGTQAITLQYRCRKCGTLFEAIKYE |
| ⦗Top⦘ |