


| Basic Information | |
|---|---|
| Family ID | F069878 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MADSGLPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGF |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.74 % |
| % of genes near scaffold ends (potentially truncated) | 91.87 % |
| % of genes from short scaffolds (< 2000 bps) | 83.74 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.236 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (28.455 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.033 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00464 | SHMT | 43.90 |
| PF13620 | CarboxypepD_reg | 5.69 |
| PF06468 | Spond_N | 4.88 |
| PF07087 | DUF1353 | 4.07 |
| PF00160 | Pro_isomerase | 3.25 |
| PF02502 | LacAB_rpiB | 2.44 |
| PF09844 | DUF2071 | 2.44 |
| PF02737 | 3HCDH_N | 1.63 |
| PF12833 | HTH_18 | 1.63 |
| PF04993 | TfoX_N | 0.81 |
| PF01523 | PmbA_TldD | 0.81 |
| PF02276 | CytoC_RC | 0.81 |
| PF04389 | Peptidase_M28 | 0.81 |
| PF10503 | Esterase_PHB | 0.81 |
| PF02190 | LON_substr_bdg | 0.81 |
| PF00082 | Peptidase_S8 | 0.81 |
| PF07606 | DUF1569 | 0.81 |
| PF09865 | DUF2092 | 0.81 |
| PF00083 | Sugar_tr | 0.81 |
| PF04402 | SIMPL | 0.81 |
| PF00723 | Glyco_hydro_15 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 43.90 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 43.90 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 3.25 |
| COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 2.44 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.63 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 1.63 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.63 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 1.63 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 1.63 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.81 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.81 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.81 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.24 % |
| Unclassified | root | N/A | 22.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10009113 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 3740 | Open in IMG/M |
| 3300002916|JGI25389J43894_1009185 | Not Available | 1635 | Open in IMG/M |
| 3300002917|JGI25616J43925_10101720 | Not Available | 1186 | Open in IMG/M |
| 3300004058|Ga0055498_10147532 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005167|Ga0066672_10179768 | Not Available | 1340 | Open in IMG/M |
| 3300005171|Ga0066677_10486654 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300005177|Ga0066690_10621298 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005181|Ga0066678_10945838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 561 | Open in IMG/M |
| 3300005186|Ga0066676_10093812 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1807 | Open in IMG/M |
| 3300005445|Ga0070708_102205228 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005451|Ga0066681_10381461 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005540|Ga0066697_10090943 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300005540|Ga0066697_10187946 | Not Available | 1227 | Open in IMG/M |
| 3300005553|Ga0066695_10042247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2683 | Open in IMG/M |
| 3300005554|Ga0066661_10000971 | All Organisms → cellular organisms → Bacteria | 10946 | Open in IMG/M |
| 3300005554|Ga0066661_10447368 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005557|Ga0066704_10546674 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 755 | Open in IMG/M |
| 3300005569|Ga0066705_10861131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 539 | Open in IMG/M |
| 3300005574|Ga0066694_10264545 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005576|Ga0066708_10140465 | Not Available | 1475 | Open in IMG/M |
| 3300005586|Ga0066691_10221359 | Not Available | 1107 | Open in IMG/M |
| 3300005598|Ga0066706_10305785 | Not Available | 1252 | Open in IMG/M |
| 3300005719|Ga0068861_101839300 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
| 3300005883|Ga0075299_1040418 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006032|Ga0066696_10169582 | Not Available | 1374 | Open in IMG/M |
| 3300006797|Ga0066659_10372080 | Not Available | 1115 | Open in IMG/M |
| 3300006797|Ga0066659_10774459 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300006806|Ga0079220_10673839 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006845|Ga0075421_101704288 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006854|Ga0075425_100597751 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1269 | Open in IMG/M |
| 3300007076|Ga0075435_101335548 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 628 | Open in IMG/M |
| 3300009012|Ga0066710_100757769 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300009090|Ga0099827_11907391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
| 3300009137|Ga0066709_100627175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1535 | Open in IMG/M |
| 3300009137|Ga0066709_103323739 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 585 | Open in IMG/M |
| 3300010304|Ga0134088_10206732 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300010320|Ga0134109_10455358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
| 3300010329|Ga0134111_10561116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 507 | Open in IMG/M |
| 3300010399|Ga0134127_12429825 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300011269|Ga0137392_10880861 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 738 | Open in IMG/M |
| 3300011270|Ga0137391_10445596 | Not Available | 1102 | Open in IMG/M |
| 3300011271|Ga0137393_11248891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 630 | Open in IMG/M |
| 3300011417|Ga0137326_1000339 | All Organisms → cellular organisms → Bacteria | 16785 | Open in IMG/M |
| 3300012200|Ga0137382_10577593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 802 | Open in IMG/M |
| 3300012200|Ga0137382_10826497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 667 | Open in IMG/M |
| 3300012203|Ga0137399_11379659 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300012203|Ga0137399_11742755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300012206|Ga0137380_11462898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
| 3300012207|Ga0137381_11263269 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012208|Ga0137376_10977491 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
| 3300012351|Ga0137386_10286867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1185 | Open in IMG/M |
| 3300012356|Ga0137371_11231483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 557 | Open in IMG/M |
| 3300012359|Ga0137385_10512303 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300012363|Ga0137390_10491241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1202 | Open in IMG/M |
| 3300012396|Ga0134057_1277740 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012582|Ga0137358_11063271 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012683|Ga0137398_10584474 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 772 | Open in IMG/M |
| 3300012917|Ga0137395_10823812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp. Root1444 | 672 | Open in IMG/M |
| 3300012918|Ga0137396_10139998 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300012918|Ga0137396_10432637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 976 | Open in IMG/M |
| 3300012918|Ga0137396_10605146 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 811 | Open in IMG/M |
| 3300012927|Ga0137416_10702896 | Not Available | 888 | Open in IMG/M |
| 3300014154|Ga0134075_10066468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1502 | Open in IMG/M |
| 3300014154|Ga0134075_10199413 | Not Available | 861 | Open in IMG/M |
| 3300014882|Ga0180069_1150429 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 567 | Open in IMG/M |
| 3300015357|Ga0134072_10081674 | Not Available | 961 | Open in IMG/M |
| 3300017656|Ga0134112_10163558 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 860 | Open in IMG/M |
| 3300017656|Ga0134112_10273410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 674 | Open in IMG/M |
| 3300017657|Ga0134074_1021911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2111 | Open in IMG/M |
| 3300017659|Ga0134083_10151576 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300017961|Ga0187778_10729470 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300018084|Ga0184629_10113823 | Not Available | 1339 | Open in IMG/M |
| 3300018431|Ga0066655_10070183 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300018431|Ga0066655_10214995 | Not Available | 1200 | Open in IMG/M |
| 3300018431|Ga0066655_10661869 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 706 | Open in IMG/M |
| 3300018433|Ga0066667_10154260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1625 | Open in IMG/M |
| 3300018468|Ga0066662_11147487 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300018482|Ga0066669_10319970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1271 | Open in IMG/M |
| 3300020003|Ga0193739_1101480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
| 3300022195|Ga0222625_1223535 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300025905|Ga0207685_10637486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium amorphae | 575 | Open in IMG/M |
| 3300026301|Ga0209238_1157979 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300026307|Ga0209469_1031327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1785 | Open in IMG/M |
| 3300026308|Ga0209265_1084149 | Not Available | 895 | Open in IMG/M |
| 3300026313|Ga0209761_1156359 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300026316|Ga0209155_1160328 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300026327|Ga0209266_1176524 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300026342|Ga0209057_1208215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
| 3300026524|Ga0209690_1034211 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300026528|Ga0209378_1004852 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8853 | Open in IMG/M |
| 3300026529|Ga0209806_1178692 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300026536|Ga0209058_1073825 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1818 | Open in IMG/M |
| 3300026540|Ga0209376_1350750 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026542|Ga0209805_1452130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300026547|Ga0209156_10216860 | Not Available | 906 | Open in IMG/M |
| 3300026548|Ga0209161_10387415 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300026548|Ga0209161_10486678 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300027643|Ga0209076_1146425 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300027846|Ga0209180_10064495 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300027862|Ga0209701_10032100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3407 | Open in IMG/M |
| 3300027961|Ga0209853_1139449 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 594 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10623505 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300028536|Ga0137415_10004157 | All Organisms → cellular organisms → Bacteria | 14341 | Open in IMG/M |
| 3300028536|Ga0137415_10183710 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300031576|Ga0247727_10012823 | All Organisms → cellular organisms → Bacteria | 14285 | Open in IMG/M |
| 3300031576|Ga0247727_10480519 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 972 | Open in IMG/M |
| 3300031965|Ga0326597_11891345 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300032180|Ga0307471_101112379 | Not Available | 956 | Open in IMG/M |
| 3300032770|Ga0335085_11324768 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300032805|Ga0335078_10389129 | Not Available | 1835 | Open in IMG/M |
| 3300033433|Ga0326726_12202735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaU1.Bin208 | 536 | Open in IMG/M |
| 3300033814|Ga0364930_0216340 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 651 | Open in IMG/M |
| 3300034114|Ga0364938_104059 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300034164|Ga0364940_0242583 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 28.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.38% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.44% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.63% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.63% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.81% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_100091135 | 3300002561 | Grasslands Soil | MRDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHGRPVG |
| JGI25389J43894_10091853 | 3300002916 | Grasslands Soil | VAERPSRGSGSFTVHIADELEVYFNEVAHGRPVGFVASSKWKPPT |
| JGI25616J43925_101017201 | 3300002917 | Grasslands Soil | MSDSSSSSGTRSSRGSGGFTVHLADELEVYFSEVKDGRPVGFVASPKWRP |
| Ga0055498_101475321 | 3300004058 | Natural And Restored Wetlands | MADSGSSGPRRPPRSSGPFTAHSADELEVYFNEASLGRPVGFV |
| Ga0066672_101797681 | 3300005167 | Soil | VAERPSRGSGSFTVHIADELEVYFNEVAHGRPVGFVASSKWK |
| Ga0066677_104866542 | 3300005171 | Soil | VAESGQGSSGRSSRASGGFTVHLAEELEVYFNEVAHGRPVGFVSSSKW |
| Ga0066683_103943393 | 3300005172 | Soil | MADSGSSSTGPGGSGGPNRPSRGSGSFTVHLADELDVYFNEVAHGRPV |
| Ga0066690_106212981 | 3300005177 | Soil | MPDSSGSSGRPSRGSGSFTVHPAEELEVYFNEVAHGRPVGFVASSKWKPP |
| Ga0066678_109458382 | 3300005181 | Soil | MPDIGSSAGGNRPSRGSGSFTVHLADELEVYFNEVAHGRPVGFV |
| Ga0066676_100938121 | 3300005186 | Soil | MGDSGLPPPSSPPNRPSRGSGSLTVHLADELDVYFNEVAHG |
| Ga0070708_1022052282 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDSGSFGGGPNRPSRGSGGFTVHLADELDVYFNEVAHGRPVG |
| Ga0066681_103814611 | 3300005451 | Soil | MAETGSGGSGFSGRPSRGSGSFTVHLADELEVYFNEVAHGRP |
| Ga0066697_100909433 | 3300005540 | Soil | MPDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHGRP |
| Ga0066697_101879462 | 3300005540 | Soil | MPDSSGSSSRPSRGSGSFTVHPAEELEVYFNEVAHGRPVGFVVSS |
| Ga0066695_100422471 | 3300005553 | Soil | MADSGSSSTGPGGSGGPNRPSRGSGSCTVHLADELDVYFNEVA |
| Ga0066661_100009711 | 3300005554 | Soil | MPDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHGRPVGF |
| Ga0066661_104473681 | 3300005554 | Soil | VAERPSRGSGSFTVHLADELEVYFNEVAHGRPVGFVASS |
| Ga0066704_105466742 | 3300005557 | Soil | MADSGSFSGGPGRPSRGSGSLTVHAADELEVYFNEVAHGRPV |
| Ga0066705_108611312 | 3300005569 | Soil | MRDSGASSGRPSRGSGSFTVHPAEELEVYFNEVAHGRPVGFVASS |
| Ga0066705_109834162 | 3300005569 | Soil | MADSAGAGSGPGGRPSRGSGSFTVHLAEELEVYFNEVAHGRPVGFVASP |
| Ga0066694_102645451 | 3300005574 | Soil | MPDSSGSSGRPSRGSGSLTVHPAEELEVYFNEVAHGR |
| Ga0066708_101404652 | 3300005576 | Soil | MADTGGSSGRPSRGSGSLTVHPAEELEVYFNEVAHGRPVGFVAS |
| Ga0066691_102213591 | 3300005586 | Soil | MADSGGSSRRPSRGSGSFTVHPAEALEGYFNEVAHGRPV |
| Ga0066706_103057852 | 3300005598 | Soil | MADSAGAGSGPGGRPSRGSGSFTVHLAEELEVYFNEVAHGR |
| Ga0068861_1018393002 | 3300005719 | Switchgrass Rhizosphere | MADSGHPNRPSRGSGSLTVHLADELDVYFNEVAHG |
| Ga0075299_10404182 | 3300005883 | Rice Paddy Soil | MADSGSHRSSRGSGAYLVHMADELEVYFNEVAHGRPVGF |
| Ga0066696_101695822 | 3300006032 | Soil | VAESGQGSSGRSSRASGGFTVHLAEELEVYFNEVAHGRP |
| Ga0066652_1002663494 | 3300006046 | Soil | MADSGSSSTGPGGSGGPNRPSRGSGSFTVHLADELDVYFNEVAHG |
| Ga0066659_103720802 | 3300006797 | Soil | MADSAGAGSGPGGRPSRGSGSFTVHLAEELEVYFNEVAHG |
| Ga0066659_107744591 | 3300006797 | Soil | MPDSSGSSGRPSRGSGSFTVHPAEELEVYFNEVAHGRPVGFVASSKWKP |
| Ga0079220_106738393 | 3300006806 | Agricultural Soil | MADGSHRSSKGSGAFPVHQADELEVYFNEVAHGRPVGFVGSPKWKP |
| Ga0075421_1017042881 | 3300006845 | Populus Rhizosphere | MADSGSFGSGPNRPSRGSGAFTVHLADELDVYFNEVAHGRPVGFVASPKWKPR |
| Ga0075425_1005977511 | 3300006854 | Populus Rhizosphere | MADSGSFGSGPNRPSRGSGGFTVHLADELDVYFNE |
| Ga0075435_1013355481 | 3300007076 | Populus Rhizosphere | MADSGSFGSGPNRPSRGSGGFTVHLADELDVYFNEVAHGRPV |
| Ga0066710_1007577693 | 3300009012 | Grasslands Soil | MSDASSTGGNRPSRGSGSFTVHLADELEVYFNEVAHGRPVGFVASPKW |
| Ga0099827_119073911 | 3300009090 | Vadose Zone Soil | MRDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHGRPVGFV |
| Ga0066709_1006271751 | 3300009137 | Grasslands Soil | MADSGLPNRPSLGSGSLTVHLADELDVYFNGVAHGRPGGVVASP |
| Ga0066709_1033237391 | 3300009137 | Grasslands Soil | MGDSGLPPPSSPPNRPSRGSGSLTVHLADELDVYFNEVAH |
| Ga0134088_102067321 | 3300010304 | Grasslands Soil | VAESGQGSSGRSSRASGSFTVHLAEELEVYFNEVAH |
| Ga0134109_104553582 | 3300010320 | Grasslands Soil | MADSDLPPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGFVASPKWKP |
| Ga0134084_103083612 | 3300010322 | Grasslands Soil | MAETGSGGSGFSGRPSRGSGSFTVHLADELEVYFNEVAHGRPVGFVASSKW |
| Ga0134064_101846531 | 3300010325 | Grasslands Soil | MADDSLFGSSGGGESPPPGRPSRGSGSLTVHLADELDVYFNEV |
| Ga0134111_105611161 | 3300010329 | Grasslands Soil | MGDSGLPPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGF |
| Ga0134127_124298252 | 3300010399 | Terrestrial Soil | MADSGSFGSGPNRPSRGSGAFTVHLADELDVYFNEVAHGRP |
| Ga0137392_108808611 | 3300011269 | Vadose Zone Soil | MADSGFSPPPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGFVASPKW |
| Ga0137391_104455961 | 3300011270 | Vadose Zone Soil | MPDSGGSSGRSSRGSGSFTVHPAEELEVYFNEVAHGRPVGF |
| Ga0137393_112488912 | 3300011271 | Vadose Zone Soil | MADSGSPNRPSRGSGALTVHLADELDVYFNEVAHGRPVGFVASPKW |
| Ga0137326_10003391 | 3300011417 | Soil | MADSGQSNRPPRGSGSLTVHLADELDVYFNEVAHGRPVGFVASPKWK |
| Ga0137382_105775932 | 3300012200 | Vadose Zone Soil | MSDMTSSGGNRPSRGSGSLTVHLADELEVYFNEVAHGRPVGFVASPKWK |
| Ga0137382_108264971 | 3300012200 | Vadose Zone Soil | MVDSSWFGSSGTPPGRPGRGSGSLTVHLADELDVYFNE |
| Ga0137399_113796592 | 3300012203 | Vadose Zone Soil | MPDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHGRPVGFVASS |
| Ga0137399_117427551 | 3300012203 | Vadose Zone Soil | MAESGLPNRPSRGSGSLTVHLADELDVYFNEVAHGR |
| Ga0137380_114628981 | 3300012206 | Vadose Zone Soil | MADSGLPPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGFVASPKW |
| Ga0137381_112632691 | 3300012207 | Vadose Zone Soil | VAESGQGSSGRSSRASGGFTVHLAEELEVYFNEVAHGRPVGFV |
| Ga0137376_109774911 | 3300012208 | Vadose Zone Soil | MADSGFTPPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGFVA |
| Ga0137386_102868671 | 3300012351 | Vadose Zone Soil | MADSGSFGSGPNRPSRGSGGFTVHLADELDVYFNEVAH |
| Ga0137371_112314832 | 3300012356 | Vadose Zone Soil | MSDMTSSGGNRPSRGSGSLTVHPADELEVYFNEVA |
| Ga0137385_105123032 | 3300012359 | Vadose Zone Soil | MVERGGGSSSRPSRGSGSFTVHPPEELEVYFNEVAHGRPVGFVA |
| Ga0137390_104912411 | 3300012363 | Vadose Zone Soil | MADSGSPNRPSRGSGALTVHLADELDVYFNEVAHGRPVGFVASPKWKP |
| Ga0134057_12777402 | 3300012396 | Grasslands Soil | MAETGSGGSGFSGRPSRGSGSFTVHLADELEVYFNEV |
| Ga0137358_110632711 | 3300012582 | Vadose Zone Soil | MPDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHG |
| Ga0137398_105844742 | 3300012683 | Vadose Zone Soil | MADSGLPNRPSRGSGSLTVHLADELDVYFNEVAHGR |
| Ga0137395_108238122 | 3300012917 | Vadose Zone Soil | MSDSSSSSGARSSRGSGGFTVHLADELEVYFSEVKDGRPVGFVA |
| Ga0137396_101399984 | 3300012918 | Vadose Zone Soil | MADSGSFGSGPNRPSRGSGGFTVHLADELDVYFNEVAHGRPVGFVASPEW* |
| Ga0137396_104326371 | 3300012918 | Vadose Zone Soil | MADSGSPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGFVASPKWKP |
| Ga0137396_106051461 | 3300012918 | Vadose Zone Soil | MADSGLPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGF |
| Ga0137416_107028961 | 3300012927 | Vadose Zone Soil | MPDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHGRPVGFVA |
| Ga0134075_100664681 | 3300014154 | Grasslands Soil | MGDSGLPPSPPPNRPSRGSGSLTVHLADELDVYFNEV |
| Ga0134075_101994131 | 3300014154 | Grasslands Soil | MPDSGGSSGRSSRGSGSFTVHPAEELEVYFNEVAHG |
| Ga0180069_11504291 | 3300014882 | Soil | MADSGSFGSGPNRPSRGSGGFTVHLADELDVYFNEVAHGRPVGFVASPK |
| Ga0134072_100816741 | 3300015357 | Grasslands Soil | MAETGSGGSGFSGRPSRGSGSFTVHLADELEVYFNEVAH |
| Ga0134085_102317942 | 3300015359 | Grasslands Soil | MADSGSSSTGPGGSGGPNRPSRGSGSFTVHLADELDVYFNEVAHGRPVGFVASPKWKPR |
| Ga0134112_101635581 | 3300017656 | Grasslands Soil | MSDASSTGGNRPSRGSGSFTVHLADELEVYFNEVAH |
| Ga0134112_102734103 | 3300017656 | Grasslands Soil | MGDSGLPPSPPPNRPSRGSGSLTVHLADELDVYFN |
| Ga0134074_10219114 | 3300017657 | Grasslands Soil | MGDSGLPPPSSPPNRPSRGSGSLTVHLADELDVYF |
| Ga0134083_101515761 | 3300017659 | Grasslands Soil | MSETGGGFSGRPRGSGPFTVHPADELEVYFNEVAHG |
| Ga0187778_107294701 | 3300017961 | Tropical Peatland | GRPPRGSGGFTVYLADELEVYFNEVAHGRPVGFVASTK |
| Ga0184629_101138231 | 3300018084 | Groundwater Sediment | MADSGSHRSSRSGAYTVHLADELEVYFNEVAHGRPVGFVASPKW |
| Ga0066655_100701831 | 3300018431 | Grasslands Soil | MADSSGSSSRPSRGSGSFTVHPAEELEVYFNEVAHGRPVGFV |
| Ga0066655_102149952 | 3300018431 | Grasslands Soil | MPDSSGSSGRPSRGSGSFTVHPAEELEVYFNEVAHGRPVGFVASS |
| Ga0066655_106618691 | 3300018431 | Grasslands Soil | MADSGLPPPASPPNRPSRGSGSLTVHLADELDVYFNE |
| Ga0066667_101542603 | 3300018433 | Grasslands Soil | MADTGGSSGRPSRGSGSLTVHPAEELEVYFNEVAHGRPVGFVASAKWKPPT |
| Ga0066662_111474871 | 3300018468 | Grasslands Soil | VAERPSRGSGSFTVHLADELEVYFNEVAHGRPVGF |
| Ga0066669_103199703 | 3300018482 | Grasslands Soil | MAEPSSPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGFVA |
| Ga0193739_11014801 | 3300020003 | Soil | MAPGGSDFSSGPSRPPRGSGPFTTHVADELEVYFNEVAGRPV |
| Ga0210382_102039912 | 3300021080 | Groundwater Sediment | MPDSGSFSTGPGGGAGGPNRPSRGSGAFTVHLADELDVYFNEVAHGRPV |
| Ga0222625_12235353 | 3300022195 | Groundwater Sediment | MTDSGSFGSGPNRPSRGSGGFTVHLADELDVYFNEVAHGRPVGFVAS |
| Ga0207685_106374862 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDSGFSPPPNRPSRGSGSLTVHLADELDVYFNEVAHG |
| Ga0209235_12731922 | 3300026296 | Grasslands Soil | MTDSSAGSGGGSSGRPSRGSGSFTVHLAEELEVYFNEVAHGRPVGFVASAK |
| Ga0209238_11579791 | 3300026301 | Grasslands Soil | MPDSSGSSGRPSRGSGSLTVHPAEELEVYFNEVAHGRPVGFVAS |
| Ga0209469_10313271 | 3300026307 | Soil | MADSDLPPNRPSRGSGSLTVHLADELDVYFNEVAHGRP |
| Ga0209265_10841491 | 3300026308 | Soil | VAERPSRGSGSFTVHIADELEVYFNEVAHGRPVGFVASS |
| Ga0209761_11563591 | 3300026313 | Grasslands Soil | MSDTGFTGGGNRPSRGSGSFTVHLADELEVYFNEVAH |
| Ga0209155_11603282 | 3300026316 | Soil | MPESGGSSGRPSRGSGSLTVHPAEELEVYFNEVAHGRPVGFVASAK |
| Ga0209266_11765242 | 3300026327 | Soil | MAESGQGSSGRASRASGGFTVHLAEELEVYFNEVAHGRPVGFAA |
| Ga0209057_12082152 | 3300026342 | Soil | MPDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHGRPVGFVASSKWK |
| Ga0209690_10342111 | 3300026524 | Soil | MADSGGSSRRPSRGSGSFTVHPAEELEVYFNEVAHGRPVGFVASSKWKPP |
| Ga0209378_10048529 | 3300026528 | Soil | VAESGQGSSGRSSRASGGFTVHLAEELEVYFNEVAH |
| Ga0209806_11786922 | 3300026529 | Soil | VAERPSRGSGSFTVHLADELEVYFNEVAHGRPVGFVASSKW |
| Ga0209058_10738251 | 3300026536 | Soil | MADSGLPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGFVASPKWK |
| Ga0209376_13507501 | 3300026540 | Soil | MADTGGSSGRPSRGSGSLTVHPAEELEVYFNEVAHGRPVGFVASAKW |
| Ga0209805_14521302 | 3300026542 | Soil | MADSGSPNRPSRGSGSLTVHLADELDVYFNEVAHGR |
| Ga0209156_102168601 | 3300026547 | Soil | VADRPSSGSGSFTVHLADELEVYFNEVAHGRPVGFVASSKWKP |
| Ga0209161_103874151 | 3300026548 | Soil | MPDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHGRPVGFVASSKWKP |
| Ga0209161_104866781 | 3300026548 | Soil | MADSAGAGSGPGGRPSRGSGSFTVHLAEELEVYFNEVAHGRPVGFG |
| Ga0209076_11464252 | 3300027643 | Vadose Zone Soil | MPDSGGSSGRSSRGSGSFTVHPAEELEVYFNEVAHGRPVGFVASSKWK |
| Ga0209180_100644951 | 3300027846 | Vadose Zone Soil | MPDSGGSSGRSSRGSGSFTVHPAEELEVYFNEVAHGRPV |
| Ga0209701_100321005 | 3300027862 | Vadose Zone Soil | MPDSGASSGRPGRGSGSFTVHPAEELEVYFNEVAHGR |
| Ga0209283_103036932 | 3300027875 | Vadose Zone Soil | MADSAGAGSGPGGRPSRGSGSFTVHLAEELEVYFNEVAHGRPVGFVASPKWK |
| Ga0209853_11394492 | 3300027961 | Groundwater Sand | MADSGSSNRPSRGSSSLTVHLADELDVYFNEVAHGRPVGFV |
| (restricted) Ga0233417_106235051 | 3300028043 | Sediment | MADSGSSGPRRPPRSSGPFTAHSADELEVYFNEASAGRPVGFVQSAKW |
| Ga0137415_100041571 | 3300028536 | Vadose Zone Soil | MADSGQPNRPSRGSGSLTVHLADELDVYFNEVAHG |
| Ga0137415_101837101 | 3300028536 | Vadose Zone Soil | MADSGLPNRPSRGSGSLTVHLADELDVYFNEVAHG |
| Ga0247727_1001282321 | 3300031576 | Biofilm | MADTGSSRRASSGAFFLGSADELEVYFNEVAHGRPVGFV |
| Ga0247727_104805192 | 3300031576 | Biofilm | MFSPMADTGSSRRPSGGAFFLGSADELEVYFNEVAHGRPVGFVASNKWR |
| Ga0326597_118913452 | 3300031965 | Soil | MADTGSFGGPNRPSRGSGAFTVHLADELDVYFNEVAHGRPV |
| Ga0307471_1011123791 | 3300032180 | Hardwood Forest Soil | MADSDFSPPPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGFVASPKWK |
| Ga0335085_113247682 | 3300032770 | Soil | MADSGSHRARGSGAYIMHMADELEVYFNEVGPGRPVGFVASPKWKP |
| Ga0335078_103891291 | 3300032805 | Soil | MADTGSSGRPPHGPGILAVHAADELEVYFNEMARGRPIG |
| Ga0326726_122027351 | 3300033433 | Peat Soil | MADSGSHRPPRGSGASTVHLADELEVYFNEVAHGRPVGFV |
| Ga0364930_0216340_1_129 | 3300033814 | Sediment | MADSGLPNRPSRGSGSLTVHLADELDVYFNEVAHGRPVGFASP |
| Ga0364938_104059_437_550 | 3300034114 | Sediment | MADSGSFGSGPNRPSRGSGGFTVHLADELDVYFNEVGH |
| Ga0364940_0242583_411_530 | 3300034164 | Sediment | MADSGSFGSGPNRPSRGSGGFTVHLADELDVYFNEVGHGR |
| ⦗Top⦘ |