


| Basic Information | |
|---|---|
| Family ID | F069801 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MLFLKNTPINQILSMNEMIEVIEDTLKEVALGRGFELPRRRIHH |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 46.34 % |
| % of genes near scaffold ends (potentially truncated) | 97.56 % |
| % of genes from short scaffolds (< 2000 bps) | 86.99 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.561 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.195 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.707 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.837 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.39% β-sheet: 5.56% Coil/Unstructured: 68.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 61.79 |
| PF05050 | Methyltransf_21 | 11.38 |
| PF00497 | SBP_bac_3 | 3.25 |
| PF02423 | OCD_Mu_crystall | 1.63 |
| PF00285 | Citrate_synt | 0.81 |
| PF13432 | TPR_16 | 0.81 |
| PF01797 | Y1_Tnp | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 1.63 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.81 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.56 % |
| Unclassified | root | N/A | 2.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11797111 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300000890|JGI11643J12802_12232208 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300000891|JGI10214J12806_11953361 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300000953|JGI11615J12901_10557170 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300004480|Ga0062592_100097199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1810 | Open in IMG/M |
| 3300005169|Ga0066810_10134607 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005293|Ga0065715_10950930 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005295|Ga0065707_10456192 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005331|Ga0070670_101342693 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005332|Ga0066388_104945600 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005340|Ga0070689_102150134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300005356|Ga0070674_101685854 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005366|Ga0070659_100070890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2770 | Open in IMG/M |
| 3300005518|Ga0070699_100997186 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005518|Ga0070699_101180311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300005540|Ga0066697_10719631 | Not Available | 545 | Open in IMG/M |
| 3300005546|Ga0070696_101716507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300005713|Ga0066905_101322749 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005764|Ga0066903_104767496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300005764|Ga0066903_107535441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300005764|Ga0066903_107558801 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006049|Ga0075417_10479017 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300006844|Ga0075428_101601202 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006845|Ga0075421_100602551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Candidatus Magnetoglobus | 1291 | Open in IMG/M |
| 3300006845|Ga0075421_101563432 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300006847|Ga0075431_101567724 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006847|Ga0075431_102156990 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006852|Ga0075433_10119423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2340 | Open in IMG/M |
| 3300006871|Ga0075434_100991965 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300006903|Ga0075426_10756184 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006904|Ga0075424_102829398 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300007004|Ga0079218_10976376 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300009087|Ga0105107_10151128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio | 1633 | Open in IMG/M |
| 3300009100|Ga0075418_11610252 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300009147|Ga0114129_11601426 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300009162|Ga0075423_12162834 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300009174|Ga0105241_12256706 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009444|Ga0114945_10070201 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
| 3300009444|Ga0114945_10187377 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1197 | Open in IMG/M |
| 3300009610|Ga0105340_1056502 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300010046|Ga0126384_10533867 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300010359|Ga0126376_11932488 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010361|Ga0126378_11370696 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300010362|Ga0126377_10126616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2368 | Open in IMG/M |
| 3300010371|Ga0134125_10029201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6142 | Open in IMG/M |
| 3300010398|Ga0126383_12317300 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010401|Ga0134121_12855491 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010403|Ga0134123_10028550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4038 | Open in IMG/M |
| 3300010403|Ga0134123_11759777 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300011412|Ga0137424_1115603 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300011435|Ga0137426_1007532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2468 | Open in IMG/M |
| 3300012172|Ga0137320_1144960 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012179|Ga0137334_1158192 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012204|Ga0137374_11247148 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012351|Ga0137386_11048867 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012353|Ga0137367_10238011 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300012922|Ga0137394_10358579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1244 | Open in IMG/M |
| 3300012922|Ga0137394_10432127 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300012925|Ga0137419_10396014 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300012927|Ga0137416_11978466 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012927|Ga0137416_12114543 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012930|Ga0137407_10646709 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300012948|Ga0126375_11451382 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300013100|Ga0157373_10202761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
| 3300014270|Ga0075325_1167063 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300014300|Ga0075321_1069809 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300014310|Ga0075331_1010208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2089 | Open in IMG/M |
| 3300014311|Ga0075322_1194917 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300015077|Ga0173483_10641042 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300015261|Ga0182006_1128001 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300015358|Ga0134089_10083281 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300015372|Ga0132256_101700065 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300015373|Ga0132257_100926717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
| 3300015374|Ga0132255_100597132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1632 | Open in IMG/M |
| 3300015374|Ga0132255_102948298 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300015374|Ga0132255_106051338 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300016371|Ga0182034_10038341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3067 | Open in IMG/M |
| 3300018028|Ga0184608_10518538 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018029|Ga0187787_10006141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2866 | Open in IMG/M |
| 3300018032|Ga0187788_10054477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
| 3300018051|Ga0184620_10182723 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300018052|Ga0184638_1262219 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300018056|Ga0184623_10319190 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300018063|Ga0184637_10114222 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300018064|Ga0187773_10014143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3354 | Open in IMG/M |
| 3300018064|Ga0187773_11238411 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018077|Ga0184633_10264455 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300018078|Ga0184612_10606248 | Not Available | 518 | Open in IMG/M |
| 3300018422|Ga0190265_10909031 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300018465|Ga0190269_11342436 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300018476|Ga0190274_10849014 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300018482|Ga0066669_10708476 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300020186|Ga0163153_10129474 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300022534|Ga0224452_1228999 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300022563|Ga0212128_10078121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2134 | Open in IMG/M |
| 3300022756|Ga0222622_10572711 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300024055|Ga0247794_10087951 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300025289|Ga0209002_10385486 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300025925|Ga0207650_10297481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1317 | Open in IMG/M |
| 3300025937|Ga0207669_11522725 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300025981|Ga0207640_10045090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2829 | Open in IMG/M |
| 3300026029|Ga0208002_1000680 | All Organisms → cellular organisms → Bacteria | 2895 | Open in IMG/M |
| 3300026067|Ga0207678_10290954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
| 3300026325|Ga0209152_10024728 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300026528|Ga0209378_1047498 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300026529|Ga0209806_1241943 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027614|Ga0209970_1006682 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300027650|Ga0256866_1226387 | Not Available | 503 | Open in IMG/M |
| 3300027815|Ga0209726_10135183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1407 | Open in IMG/M |
| 3300027873|Ga0209814_10421029 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300027909|Ga0209382_10289106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio | 1851 | Open in IMG/M |
| 3300031720|Ga0307469_10110321 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300031892|Ga0310893_10520790 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031942|Ga0310916_11364443 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031995|Ga0307409_102252673 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300032004|Ga0307414_10958951 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300032017|Ga0310899_10137266 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300032122|Ga0310895_10757099 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300032122|Ga0310895_10760095 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300032261|Ga0306920_100032825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio | 7428 | Open in IMG/M |
| 3300033004|Ga0335084_10247565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1847 | Open in IMG/M |
| 3300033412|Ga0310810_10802956 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300034148|Ga0364927_0075359 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.06% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.06% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.25% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.25% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 2.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.81% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026029 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_117971111 | 3300000890 | Soil | MLFIKNTPVDQILSMTEMIEAIEEALKELRLGRGF |
| JGI11643J12802_122322082 | 3300000890 | Soil | MLFLKDTPICQILSINEMIEVIEDTLKEIALGRGFELPRRRIHHPNR |
| JGI10214J12806_119533612 | 3300000891 | Soil | MLFLKNTPINQILSMNEMIEVIEDTLKEVALGRGFELPRRRIHH |
| JGI11615J12901_105571702 | 3300000953 | Soil | MLFLKDTPIHQILSMDEMIGAIEATLKEVALDRAHELPRRRIHHPNRMIFGLL |
| Ga0062592_1000971991 | 3300004480 | Soil | MLFIKNTPVDQILSMPEMIEAIEEALKELRLGRGFDLPRRRIH |
| Ga0066810_101346071 | 3300005169 | Soil | MLFLKNTPIDQIVSMDEMIVAIEDALKEMALGRGFDLPRRRIHHPNRMIF |
| Ga0065715_109509301 | 3300005293 | Miscanthus Rhizosphere | MLFLKDTPIHQILSMNEMIGAIEETLKEVALGRGHELPRRRIHHPNRMIFGL |
| Ga0065707_104561921 | 3300005295 | Switchgrass Rhizosphere | MLFLRDTPISQILSTNEMIEVIEDTLKEVAQGRGFELPRRRIHHP |
| Ga0070670_1013426932 | 3300005331 | Switchgrass Rhizosphere | MLFLKDTPIHQILPMNEMIGAIEETLKEVALGRGHELPRRRIHHPNRM |
| Ga0066388_1049456001 | 3300005332 | Tropical Forest Soil | MLFLKNTPIDQIVSMEEIIVAIEDALKEMALGRGFDLPRRRIHHPNRMIFGLLPGS |
| Ga0070689_1021501341 | 3300005340 | Switchgrass Rhizosphere | MLYLKDTPLDKIVSMAEAIGAIEDALKEKALGRAFELPRRRIHHPNRMLFGLLPGSV |
| Ga0070674_1016858541 | 3300005356 | Miscanthus Rhizosphere | MLFIKNTPVDQILSMMEMIEAIEEALKELRLGRGFDLPRRRIHHPNRMI |
| Ga0070659_1000708905 | 3300005366 | Corn Rhizosphere | MLFLKDTPIHQILPMNEMIGAIEETLKEVALGRGHELPRRRIHHPNRMIFGLLPGSVHGVMG |
| Ga0070699_1009971861 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLYLKNTPIDQILSMKEIMNVIEDALKALAEGRGFDLPRRRIHHPNRM |
| Ga0070699_1011803111 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLYLKNTPIEQILSMNEMIETIEDALKELALGRGFNLPRRRIHHPNRMIFGL |
| Ga0066697_107196311 | 3300005540 | Soil | MLFLKNTPINHILSIHEMIESIEDALKEIALGRGFDLPRRRIHHPNKMIF |
| Ga0070696_1017165071 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFLQNTPINQILSLNEMIETIEDTLREIAQGRGFEIPRQRIHHPNRMIFGILPGSVH |
| Ga0066905_1013227491 | 3300005713 | Tropical Forest Soil | MLYLKNTPIDQILSMREMMDVIEDALKALAEGLGFDL |
| Ga0066903_1047674962 | 3300005764 | Tropical Forest Soil | MLFLKNTPIDQIVSMDEIIVAIEDALKEMALGRGFDLPRRRIHHPNRMIFGLLPGSVHGV |
| Ga0066903_1075354411 | 3300005764 | Tropical Forest Soil | MLFLKNTPIDQILSMDEIIVAIEDALKEMALGRGFDLPRRRIHHPNRMIFGL |
| Ga0066903_1075588011 | 3300005764 | Tropical Forest Soil | MLFLKNTPIDQIVSMDEIIVAIEDALKEMALGRGFDLPRRRIHHPNRMIFGL |
| Ga0075417_104790171 | 3300006049 | Populus Rhizosphere | MLYLKDTPINQILSMNEMIEAVEDTLKEVALGRGFELPRRRIHHPNRMIYGLLPGSVHGAMGA |
| Ga0075428_1016012021 | 3300006844 | Populus Rhizosphere | MLFLKETPINQILSMHEMIEAIENTLKELAAGRGFDLPRRRIHHPNRMIFGLLPGS |
| Ga0075421_1006025511 | 3300006845 | Populus Rhizosphere | MLFLKNTPIHQILTMAEMIEAIEGTLKEVAAGRGFELPRRRIHHPNRMILGILP |
| Ga0075421_1015634321 | 3300006845 | Populus Rhizosphere | MLFLKDTPISQILPMREMIGAIEETLKEVALGRGHELPRRRIHHPNRMIFG |
| Ga0075431_1015677241 | 3300006847 | Populus Rhizosphere | MLFIKDTPVDQILSMQEMIEAIEDALKELRLERGFDLPRRRIHHPNRMI |
| Ga0075431_1021569901 | 3300006847 | Populus Rhizosphere | MLFIKNTPVDQILSRTEMIEAIEEALKELRLGRGFDLPRRRIHHPNRMIFGLLPGSV |
| Ga0075433_101194234 | 3300006852 | Populus Rhizosphere | MLYLKNTPIDQILSMNEMMNVIEDALKALAEGRGFDLPRRRIHHPDGM |
| Ga0075434_1009919651 | 3300006871 | Populus Rhizosphere | MLYLKDTPINQILSMNEMIEAVEDTLKEVALGRGFELP |
| Ga0075426_107561841 | 3300006903 | Populus Rhizosphere | MLYIKDTPIDQIVSMPEMIDAIEEALKALATGIGFDLPR |
| Ga0075424_1028293981 | 3300006904 | Populus Rhizosphere | MLYLKNTPIDQILSMNEMMNVIEDALKALAEGRGFDLPRRRIHHPDGMIFGLLPGSVH |
| Ga0079218_109763762 | 3300007004 | Agricultural Soil | MLFVKNTPVDEILTMKEMIEVVEAALKELALGRGFDLPRRRIHHPNGM |
| Ga0105107_101511283 | 3300009087 | Freshwater Sediment | MLFLKDTPIRQILSINETIEVIEDTLKEIALGRGFELPRRRIHHPNRMIFGLLPGS |
| Ga0075418_116102521 | 3300009100 | Populus Rhizosphere | MLYLKDTPINQILTMNEMIEAVEDTLKEVALGRGFELPRRRIHHPNRMIF |
| Ga0114129_116014261 | 3300009147 | Populus Rhizosphere | MLFLKNTPINQILSFHEMIETIEDTLKELAAGRGFDLPRRRIHHPNQMIF |
| Ga0075423_121628342 | 3300009162 | Populus Rhizosphere | MLYLKDTPINQILSMNDMIEAVEDTLKEVALGRGFELPRRRIHHPNRMIFGLLPGSVHGA |
| Ga0105241_122567062 | 3300009174 | Corn Rhizosphere | MLFLKNTPINQILSMNEMIEVIEDTLKEVALGRGFELPRRRIHHPNRMIFGVLPGSVHGAMG |
| Ga0114945_100702014 | 3300009444 | Thermal Springs | LHAVNEMLYLKNTPVDQILAMSEMIETIEDALKEMAQGRGFDLPRRRIHHRNR |
| Ga0114945_101873775 | 3300009444 | Thermal Springs | MLLLKKTSIDTILSMAEIIEAVEESLKEMALGRGFDLPRRRI |
| Ga0105340_10565023 | 3300009610 | Soil | MAPEGNKAMLFLKNTPIDRILSMAEMIDVIEDTLKEVASGRGFELPRGAFTIPIG* |
| Ga0126384_105338671 | 3300010046 | Tropical Forest Soil | MLFLKNTPIDQIVSMDEIIVAIEDALKEMALGRGFDLPRRR |
| Ga0126376_119324881 | 3300010359 | Tropical Forest Soil | MLFLKNTPIDQIVSMDEIIVAIEDALKEMALGRGF |
| Ga0126378_113706962 | 3300010361 | Tropical Forest Soil | MLFLKDTPISEILSMHEMIGAIEETLKEAALGRGHELPRRRIHHPNRMIFG |
| Ga0126377_101266164 | 3300010362 | Tropical Forest Soil | MLFLKDTPIDQILSMNEMIEAIEDTLKEMALGRGFDLPRR |
| Ga0134125_100292011 | 3300010371 | Terrestrial Soil | MLFLKDTPIHQILSMNDMIGAIEETLKEVALGRGHELPRRRIHHPNRMIFG |
| Ga0126383_123173001 | 3300010398 | Tropical Forest Soil | MLFLKNTPIDQILSMDEIIVAIEDALKEMALGRGFDLP |
| Ga0134121_128554912 | 3300010401 | Terrestrial Soil | MLFLKDTPIHQILSMNEMIGAIEETLKEVALGRGHELPRRRIHHPNRMIF |
| Ga0134123_100285501 | 3300010403 | Terrestrial Soil | MLYLKDTPINQILSMNEMIEAVEDTLKEVALGRGFELPRRRIHHPNRMIF |
| Ga0134123_117597771 | 3300010403 | Terrestrial Soil | MLFLKDTPIHQILPMNEMIGAIEETLKEVALGRGHELPRRRIHHPN |
| Ga0137424_11156032 | 3300011412 | Soil | MLFLKNTPINQILSMAEMIVAIEDTLKEVAVGRGFELPRRRIHHPNRMILG |
| Ga0137426_10075324 | 3300011435 | Soil | MLFLKNTPINQILSMPDMIEAIEDTLKEIALGRGFELP |
| Ga0137320_11449602 | 3300012172 | Soil | MLFLKNTPINQILSMPDMIEAIEDTLKEIALGRGFELPRRR |
| Ga0137334_11581921 | 3300012179 | Soil | MLFLKNTPINQILSMAEMIEAIEGTLKEVAVGRGFELPRRRIHHPNRMILGILPGSVHGV |
| Ga0137374_112471481 | 3300012204 | Vadose Zone Soil | MLFLKNTPINQILSLHEMIETIEDTLKELAAGRGFDL |
| Ga0137386_110488671 | 3300012351 | Vadose Zone Soil | MLFLKNTPINQILSLHEMIETIEDTLKELAAGRGFDLPRRRIHHPNQ |
| Ga0137367_102380111 | 3300012353 | Vadose Zone Soil | MLFLKNTPINQILSLHEMIETIEDTLKELAAGRGFDLP |
| Ga0137394_103585793 | 3300012922 | Vadose Zone Soil | MLYLKDTPINQILSMNEMIEAVEDTLKEVALGRGFELPRR |
| Ga0137394_104321271 | 3300012922 | Vadose Zone Soil | MLFLKNTPISQILSINEMIDAIEDTLKEIALGHGFELPRRR |
| Ga0137419_103960141 | 3300012925 | Vadose Zone Soil | MLFLKNTPISQILSINEMIDAIEDTLKEIALGNGFELPRRR |
| Ga0137416_119784661 | 3300012927 | Vadose Zone Soil | MLFLKNTPLDQIVSMDEMIVTIEDALKEMAFGRGFDLPRRRIHHPNRMIFGLLPG |
| Ga0137416_121145432 | 3300012927 | Vadose Zone Soil | MLFLKNTPISQILSINEMIDAIEDTLKEIALGHGFELPR |
| Ga0137407_106467091 | 3300012930 | Vadose Zone Soil | MLFLKNTPLDQIVSMDEIIVAIEDALKEMALGRGFDLPRRRI |
| Ga0126375_114513822 | 3300012948 | Tropical Forest Soil | MLFLKNTPIDQILSFNEMIEAIEDALKEIAAGRGF |
| Ga0157373_102027611 | 3300013100 | Corn Rhizosphere | MLFLKDTPIHQILSMNEMIGAIEETLKEVALGRGHELPRRRIHHPNR |
| Ga0075325_11670631 | 3300014270 | Natural And Restored Wetlands | MLFVKNTPINQILSMAEMIEVIEDTLKEVALGRGFDLPRRRIHHPNRM |
| Ga0075321_10698091 | 3300014300 | Natural And Restored Wetlands | VLFLKDTPIRQILSINEMIEVIEDTLKEIALGRGFELPRRRIHHPN |
| Ga0075331_10102081 | 3300014310 | Natural And Restored Wetlands | MLFVKNTPINQILSMAEMIEVIEDTLKEVALGRGFDLPRRRIHHPNRMIFGLLPGS |
| Ga0075322_11949172 | 3300014311 | Natural And Restored Wetlands | VLFLKDTPIRQILSINETIEVIEDTLKEIALGRGFELPRR |
| Ga0173483_106410421 | 3300015077 | Soil | MLFIKNTPVDQILSMMEMIEAIEEALKELRLGRGFDLPRRRIHHPNRMIFGVLPG |
| Ga0182006_11280011 | 3300015261 | Rhizosphere | MLFLKDTPIHQILSMNEMIGAIEETLKEVALGRGHELPRRRIHHP |
| Ga0134089_100832811 | 3300015358 | Grasslands Soil | MLFLKNTPINQILSLHEMIETIEDTLKELAAGRGFDLPRRRIHHPN |
| Ga0132256_1017000651 | 3300015372 | Arabidopsis Rhizosphere | MLFLKDTPIHQILPMNEMIGAIEETLKEVALGRGHELPR |
| Ga0132257_1009267173 | 3300015373 | Arabidopsis Rhizosphere | MLFLKDTPIHQILPMNEMIGAIEETLKEVALGRGHELP |
| Ga0132255_1005971321 | 3300015374 | Arabidopsis Rhizosphere | MLYLKDTPINQILSMNEMIEAVEDTLKEVALGRGFELPRRRIHHPNRMIFGLLPGSVHGA |
| Ga0132255_1029482981 | 3300015374 | Arabidopsis Rhizosphere | MLFLKNTPINQILSMAEMIEAIEDTLKEVAVGRGFELPRRRIHHPNRMILGILP |
| Ga0132255_1060513381 | 3300015374 | Arabidopsis Rhizosphere | MLYLKDTPINQILSMNEMIDAVEDTLKEVALGRGFELPRRRIHHPNRMIFGLLPGSVHGA |
| Ga0182034_100383415 | 3300016371 | Soil | MLFLKNTPLDQIVSMDEMIVTIEDALKEMAFGRGF |
| Ga0184608_105185382 | 3300018028 | Groundwater Sediment | MLFLQNTPINQILSLNEMIETIEDTLREIAQGRGFEIPRQRIDDAPWWNCIL |
| Ga0187787_100061411 | 3300018029 | Tropical Peatland | MLFLKNKPIDQILSMNEMIDAIEDTLKEIASGRGFELPRRRIHHPNRMILGILPG |
| Ga0187788_100544771 | 3300018032 | Tropical Peatland | MLFLKNKPIDQILSMNEMIDAIEDTLKEIASGRGFELPRRRI |
| Ga0184620_101827232 | 3300018051 | Groundwater Sediment | MLFLKNTPINQILSMAEMIVAIEGTLKEVAVGRGFELPRRRIHHPNRMILGILPGSVHG |
| Ga0184638_12622191 | 3300018052 | Groundwater Sediment | MLFLKNTPIDQIVSMDEMIVAIEDALKEMALGRGFDLPRRRIHHPNRMIFGLLP |
| Ga0184623_103191902 | 3300018056 | Groundwater Sediment | MLFLKNTPINQILSMNEMIETIEDTLKEIALGRGFDLPR |
| Ga0184637_101142221 | 3300018063 | Groundwater Sediment | MLFLKNTPINQILSMAEMIDAIEDTLKETAAGRGFELPRRRIHH |
| Ga0187773_100141435 | 3300018064 | Tropical Peatland | MLFLKNKPIDQILSMNEMIDAIEDTLKEIASGRGFELPRRRIHHPNRMILGILPGSV |
| Ga0187773_112384111 | 3300018064 | Tropical Peatland | MLFLKNTPVNQILSMNEMIGAIEDALKEMALGTGFDLPRRRIHHPNRMIFGVLPGSVHGA |
| Ga0184633_102644552 | 3300018077 | Groundwater Sediment | MLFLKNTPINQILSMNEMIETIEDTLKEIALGRGFDLPRRR |
| Ga0184612_106062481 | 3300018078 | Groundwater Sediment | MLFLKNTPINQILSMAEMIEAIEDTLKEVAAGRGF |
| Ga0190265_109090312 | 3300018422 | Soil | MLFLQNTPIHRIISLNEMIEAIEDTLREIAQGRGFEIPRQR |
| Ga0190269_113424362 | 3300018465 | Soil | MLFLKNTPIDQIVSMDEMIVAIEDALKEMALGRGFDLPRRRIHHPNRMIFGLLPGSV |
| Ga0190274_108490142 | 3300018476 | Soil | MAPEGNKAMLFLKNTPIDRILSMAEMIDVIEDTLKEVASGRGFELPRGAFTIPIG |
| Ga0066669_107084762 | 3300018482 | Grasslands Soil | MLFLKNTPISQILSINEMIDAIEDTLKEIGLGHGFEVPRR |
| Ga0163153_101294744 | 3300020186 | Freshwater Microbial Mat | MDPEVNQAMLFLKNTPIDQILSMGEMIDAIEDTLKEIASGRGFELPRRRIHHPN |
| Ga0224452_12289992 | 3300022534 | Groundwater Sediment | MLFLKNTPINQILSMNEMIETIEDTLKEIALGRGFDLP |
| Ga0212128_100781211 | 3300022563 | Thermal Springs | MLYLKNTPVDQILAMSEMIETIEDALKEMAQGRGFDLPRRRIHHRNRMIFG |
| Ga0222622_105727111 | 3300022756 | Groundwater Sediment | MLYLKDTSINQILSMNEMIEAVEDTLKEVALGRGFELPRRRIHHPNRMI |
| Ga0247794_100879512 | 3300024055 | Soil | MLFLKDTPIHQILSMNEMIGAIEETLKEVALGRGHELPRRRIHHPNRMIFGLLPGSVHGV |
| Ga0209002_103854862 | 3300025289 | Soil | MLFVKNTPINQILSMTEMIEVIEDTLKEVALGRGFDLPRR |
| Ga0207650_102974813 | 3300025925 | Switchgrass Rhizosphere | MLFLKDTPIHQILPMNEMIGAIEETLKEVALGRGHELPRRRIHHPNRMLFGLL |
| Ga0207669_115227252 | 3300025937 | Miscanthus Rhizosphere | MLFIKNTPVDQILSMMEMIEAIEEALKELRLGRGFDLPRRRIHHPNRM |
| Ga0207640_100450905 | 3300025981 | Corn Rhizosphere | MLFLKDTPIHQILSMNEMIGAIEETLKEVALGRGHELPRRR |
| Ga0208002_10006805 | 3300026029 | Natural And Restored Wetlands | MLFVKNTPINQILSMAEMIEVIEDTLKEVALGRGFDLPRRRIHHPNRMIFGL |
| Ga0207678_102909543 | 3300026067 | Corn Rhizosphere | MLFLKDTPIHQILPMNEMIGAIEETLKEVALGRGHELPRRRIHHPNRMIFGLLPG |
| Ga0209152_100247281 | 3300026325 | Soil | MLFLKNTPINHILSIHEMIESIEDALKEIALGRGFDLPR |
| Ga0209378_10474981 | 3300026528 | Soil | MLFLKNTPINHILSIHEMIESIEDALKEIALGRGFDLPRRRIHHPNKMI |
| Ga0209806_12419431 | 3300026529 | Soil | MLFLKNTPISQILSINEMIDAIEDTLKEIALGHGFELPRRRIHHPNRMIFGLLPGSVH |
| Ga0209970_10066824 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MLFLKDTPICQILSINEMIEVIEETLKEVALGRGFELPRRRIHHPSRMIFG |
| Ga0256866_12263871 | 3300027650 | Soil | MLFLKNTPINQILSMNEMIEVIEGTLKEVALGRGFDL |
| Ga0209726_101351833 | 3300027815 | Groundwater | MLFLKNTPIDQILSLNEMIETIEDTLKEIASGRGFELPRRR |
| Ga0209814_104210292 | 3300027873 | Populus Rhizosphere | MLYLKDTPINQILSMNEMIEAVEDTLKEVALGRGFELPRRRIHHPNRMIFG |
| Ga0209382_102891061 | 3300027909 | Populus Rhizosphere | MLFLKNTPINQILSMAEMIEAIEDTLKEIALGRGFELPRRRIHHPNRMILGILPGSVH |
| Ga0307469_101103214 | 3300031720 | Hardwood Forest Soil | MLFLKNTPIDQIVSMDEIIVAIEDALKEMALGRGFDLPRRRIHHPNRMIFGLLPGSVHGVMGA |
| Ga0310893_105207901 | 3300031892 | Soil | MLFLKDTPIHQILSMNEMIGAIEETLKEVALGRGHELPRRRIHHPNRMIFGLLPG |
| Ga0310916_113644431 | 3300031942 | Soil | MLFLKNTPLDQIVSMDEMIVTIEDALKEMAFGRGFDLPRRRIHHPNRMIFGLLP |
| Ga0307409_1022526732 | 3300031995 | Rhizosphere | MLFIKNTPVGQILSMTEMIEAIEEALKELRLGRGFDLPRRRIHHPNRMIF |
| Ga0307414_109589512 | 3300032004 | Rhizosphere | VLFIKDTPVDQILSMKEMIEAIEDALKELRLERGFDLPRRRIHHPNRMIF |
| Ga0310899_101372661 | 3300032017 | Soil | MLFLKDTPIHQILSMNEMIGAIEETLKEVALGRGHELPRRRIHHPNRMIFGLL |
| Ga0310895_107570991 | 3300032122 | Soil | MLFIKNAPVDQILSMMEMIEAIEEALKELRLGRGFDLPRRRI |
| Ga0310895_107600952 | 3300032122 | Soil | MLFLKDTPIHQILSMNEMIGAIEETLKEVALGRGHELP |
| Ga0306920_1000328259 | 3300032261 | Soil | MLFLKDTPISEILSMHEMIGAIEETLKEAALGRGHELPRR |
| Ga0335084_102475651 | 3300033004 | Soil | MLYLKNTPIDRILSMNEMIEAIEDALKALAEGRGFDLPRRRIHHPNRMIFGLLPGSVHGAMG |
| Ga0310810_108029562 | 3300033412 | Soil | MLFLKDTPIHQILPMNEMIGAIEETLKEVALGRGHELPRRRIHH |
| Ga0364927_0075359_761_913 | 3300034148 | Sediment | MAPEGNKAMLFLKNTPIDRILSMAEMIDVIEDTLKEVASGRGFELPRGAFT |
| ⦗Top⦘ |