


| Basic Information | |
|---|---|
| Family ID | F069767 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MFKKVLLAVVLALSFFSAIGLEGMAPPPQCNPCPWVN |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.66 % |
| % of genes near scaffold ends (potentially truncated) | 45.53 % |
| % of genes from short scaffolds (< 2000 bps) | 67.48 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.033 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (27.642 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.472 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 29.23% β-sheet: 0.00% Coil/Unstructured: 70.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13560 | HTH_31 | 4.07 |
| PF00800 | PDT | 4.07 |
| PF02441 | Flavoprotein | 4.07 |
| PF10263 | SprT-like | 3.25 |
| PF08545 | ACP_syn_III | 2.44 |
| PF04932 | Wzy_C | 1.63 |
| PF02190 | LON_substr_bdg | 0.81 |
| PF12844 | HTH_19 | 0.81 |
| PF13440 | Polysacc_synt_3 | 0.81 |
| PF13188 | PAS_8 | 0.81 |
| PF03551 | PadR | 0.81 |
| PF05235 | CHAD | 0.81 |
| PF12146 | Hydrolase_4 | 0.81 |
| PF13476 | AAA_23 | 0.81 |
| PF16916 | ZT_dimer | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 4.07 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.81 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.81 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.81 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.81 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.03 % |
| Unclassified | root | N/A | 47.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10215630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1258 | Open in IMG/M |
| 3300004152|Ga0062386_100876117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300004468|Ga0068977_1182087 | Not Available | 785 | Open in IMG/M |
| 3300004475|Ga0068969_1281852 | Not Available | 544 | Open in IMG/M |
| 3300005591|Ga0070761_10001016 | All Organisms → cellular organisms → Bacteria | 17650 | Open in IMG/M |
| 3300005591|Ga0070761_10033230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2884 | Open in IMG/M |
| 3300005712|Ga0070764_10682883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 631 | Open in IMG/M |
| 3300006052|Ga0075029_100220919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1189 | Open in IMG/M |
| 3300006893|Ga0073928_10016389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7969 | Open in IMG/M |
| 3300009552|Ga0116138_1028468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1684 | Open in IMG/M |
| 3300009623|Ga0116133_1021567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1594 | Open in IMG/M |
| 3300009665|Ga0116135_1004183 | All Organisms → cellular organisms → Bacteria | 5949 | Open in IMG/M |
| 3300009759|Ga0116101_1066619 | Not Available | 797 | Open in IMG/M |
| 3300010379|Ga0136449_100221500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3559 | Open in IMG/M |
| 3300010379|Ga0136449_100427722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2335 | Open in IMG/M |
| 3300011022|Ga0138536_131128 | Not Available | 551 | Open in IMG/M |
| 3300011039|Ga0138593_107703 | Not Available | 570 | Open in IMG/M |
| 3300011068|Ga0138599_1007255 | Not Available | 584 | Open in IMG/M |
| 3300011077|Ga0138572_1117517 | Not Available | 720 | Open in IMG/M |
| 3300011079|Ga0138569_1008746 | Not Available | 716 | Open in IMG/M |
| 3300011090|Ga0138579_1316618 | Not Available | 517 | Open in IMG/M |
| 3300011120|Ga0150983_14513456 | Not Available | 607 | Open in IMG/M |
| 3300011120|Ga0150983_14795618 | Not Available | 620 | Open in IMG/M |
| 3300014152|Ga0181533_1001321 | All Organisms → cellular organisms → Bacteria | 32202 | Open in IMG/M |
| 3300014156|Ga0181518_10000104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 90951 | Open in IMG/M |
| 3300014156|Ga0181518_10256484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300014162|Ga0181538_10006833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9740 | Open in IMG/M |
| 3300014168|Ga0181534_10007693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5896 | Open in IMG/M |
| 3300014493|Ga0182016_10036269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4062 | Open in IMG/M |
| 3300014495|Ga0182015_10181586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1415 | Open in IMG/M |
| 3300014838|Ga0182030_10094053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4202 | Open in IMG/M |
| 3300014838|Ga0182030_10550164 | Not Available | 1132 | Open in IMG/M |
| 3300016702|Ga0181511_1050331 | Not Available | 638 | Open in IMG/M |
| 3300016702|Ga0181511_1104503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1742 | Open in IMG/M |
| 3300016702|Ga0181511_1295874 | Not Available | 720 | Open in IMG/M |
| 3300016705|Ga0181507_1144613 | Not Available | 637 | Open in IMG/M |
| 3300016705|Ga0181507_1182801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1291 | Open in IMG/M |
| 3300016705|Ga0181507_1349491 | Not Available | 599 | Open in IMG/M |
| 3300016730|Ga0181515_1404035 | Not Available | 596 | Open in IMG/M |
| 3300016750|Ga0181505_10024321 | Not Available | 611 | Open in IMG/M |
| 3300017946|Ga0187879_10022641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3867 | Open in IMG/M |
| 3300017946|Ga0187879_10066098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2105 | Open in IMG/M |
| 3300017946|Ga0187879_10074131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1973 | Open in IMG/M |
| 3300017946|Ga0187879_10115553 | Not Available | 1532 | Open in IMG/M |
| 3300017948|Ga0187847_10008863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6791 | Open in IMG/M |
| 3300017948|Ga0187847_10010585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6100 | Open in IMG/M |
| 3300017970|Ga0187783_10151727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1707 | Open in IMG/M |
| 3300017975|Ga0187782_10070691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2548 | Open in IMG/M |
| 3300017975|Ga0187782_10302091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300017988|Ga0181520_10075172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3021 | Open in IMG/M |
| 3300018017|Ga0187872_10230264 | Not Available | 839 | Open in IMG/M |
| 3300018026|Ga0187857_10030009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2931 | Open in IMG/M |
| 3300018035|Ga0187875_10040203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2762 | Open in IMG/M |
| 3300018037|Ga0187883_10292467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300018038|Ga0187855_10087646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1890 | Open in IMG/M |
| 3300018043|Ga0187887_10612132 | Not Available | 643 | Open in IMG/M |
| 3300018043|Ga0187887_10903069 | Not Available | 523 | Open in IMG/M |
| 3300018047|Ga0187859_10057817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2048 | Open in IMG/M |
| 3300018086|Ga0187769_10081525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2299 | Open in IMG/M |
| 3300018086|Ga0187769_10861211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300019211|Ga0187799_1182898 | Not Available | 505 | Open in IMG/M |
| 3300019230|Ga0181501_1210145 | Not Available | 923 | Open in IMG/M |
| 3300019230|Ga0181501_1265016 | Not Available | 612 | Open in IMG/M |
| 3300019240|Ga0181510_1117953 | Not Available | 581 | Open in IMG/M |
| 3300019240|Ga0181510_1392597 | Not Available | 974 | Open in IMG/M |
| 3300019242|Ga0181502_1281930 | Not Available | 643 | Open in IMG/M |
| 3300019242|Ga0181502_1527736 | Not Available | 648 | Open in IMG/M |
| 3300019256|Ga0181508_1085609 | Not Available | 1103 | Open in IMG/M |
| 3300019256|Ga0181508_1367420 | Not Available | 591 | Open in IMG/M |
| 3300019258|Ga0181504_1052674 | Not Available | 817 | Open in IMG/M |
| 3300019258|Ga0181504_1413459 | Not Available | 675 | Open in IMG/M |
| 3300019268|Ga0181514_1456724 | Not Available | 516 | Open in IMG/M |
| 3300019270|Ga0181512_1232874 | Not Available | 625 | Open in IMG/M |
| 3300019275|Ga0187798_1131499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 743 | Open in IMG/M |
| 3300019275|Ga0187798_1340912 | Not Available | 558 | Open in IMG/M |
| 3300019278|Ga0187800_1295777 | Not Available | 535 | Open in IMG/M |
| 3300019278|Ga0187800_1435121 | Not Available | 501 | Open in IMG/M |
| 3300019278|Ga0187800_1546725 | Not Available | 538 | Open in IMG/M |
| 3300019284|Ga0187797_1329472 | Not Available | 565 | Open in IMG/M |
| 3300022499|Ga0242641_1031886 | Not Available | 581 | Open in IMG/M |
| 3300022513|Ga0242667_1032465 | Not Available | 601 | Open in IMG/M |
| 3300022522|Ga0242659_1068370 | Not Available | 658 | Open in IMG/M |
| 3300022522|Ga0242659_1112819 | Not Available | 549 | Open in IMG/M |
| 3300022524|Ga0224534_1007755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3605 | Open in IMG/M |
| 3300022709|Ga0222756_1085500 | Not Available | 521 | Open in IMG/M |
| 3300022716|Ga0242673_1051550 | Not Available | 695 | Open in IMG/M |
| 3300022716|Ga0242673_1100886 | Not Available | 558 | Open in IMG/M |
| 3300022717|Ga0242661_1113311 | Not Available | 579 | Open in IMG/M |
| 3300023088|Ga0224555_1004311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 13217 | Open in IMG/M |
| 3300025612|Ga0208691_1041562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300027853|Ga0209274_10001836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 10647 | Open in IMG/M |
| 3300027853|Ga0209274_10234865 | Not Available | 937 | Open in IMG/M |
| 3300027879|Ga0209169_10728062 | Not Available | 513 | Open in IMG/M |
| 3300027911|Ga0209698_10031947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4805 | Open in IMG/M |
| 3300029922|Ga0311363_10338557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1652 | Open in IMG/M |
| 3300030399|Ga0311353_10170471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2064 | Open in IMG/M |
| 3300030529|Ga0210284_1197274 | Not Available | 604 | Open in IMG/M |
| 3300030549|Ga0210257_10726899 | Not Available | 656 | Open in IMG/M |
| 3300030549|Ga0210257_10832967 | Not Available | 546 | Open in IMG/M |
| 3300030760|Ga0265762_1139107 | Not Available | 569 | Open in IMG/M |
| 3300030813|Ga0265750_1070433 | Not Available | 565 | Open in IMG/M |
| 3300031028|Ga0302180_10121417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1475 | Open in IMG/M |
| 3300031234|Ga0302325_10043391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9060 | Open in IMG/M |
| 3300031234|Ga0302325_10333654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2426 | Open in IMG/M |
| 3300031236|Ga0302324_100042325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8361 | Open in IMG/M |
| 3300031236|Ga0302324_100205008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3141 | Open in IMG/M |
| 3300031525|Ga0302326_10260296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2816 | Open in IMG/M |
| 3300031871|Ga0316036_119229 | Not Available | 506 | Open in IMG/M |
| 3300032160|Ga0311301_10029527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14338 | Open in IMG/M |
| 3300032160|Ga0311301_10065846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 7785 | Open in IMG/M |
| 3300032160|Ga0311301_11126623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300032515|Ga0348332_11146178 | Not Available | 697 | Open in IMG/M |
| 3300032515|Ga0348332_13261079 | Not Available | 540 | Open in IMG/M |
| 3300032515|Ga0348332_14450167 | Not Available | 718 | Open in IMG/M |
| 3300032770|Ga0335085_10000016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 660605 | Open in IMG/M |
| 3300032783|Ga0335079_10022938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 7143 | Open in IMG/M |
| 3300032783|Ga0335079_10034940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5773 | Open in IMG/M |
| 3300032783|Ga0335079_10189140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2290 | Open in IMG/M |
| 3300032805|Ga0335078_10064054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5396 | Open in IMG/M |
| 3300032892|Ga0335081_10023007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 10085 | Open in IMG/M |
| 3300032892|Ga0335081_10777289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300032893|Ga0335069_10440729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1521 | Open in IMG/M |
| 3300032893|Ga0335069_10842605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 27.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.32% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 5.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.06% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.44% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.63% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011022 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 14 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011039 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 20 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019211 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019230 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030529 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030549 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031871 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_102156302 | 3300001593 | Forest Soil | MFKKILLTVVLALSFFAAIGLEGSVPPPACVPCPWVN* |
| Ga0062386_1008761171 | 3300004152 | Bog Forest Soil | MFKKVLLAVVMALSFFAAIGVQASAPPPQCGLPNNPPCPWVN* |
| Ga0068977_11820872 | 3300004468 | Peatlands Soil | KEKNLMFKKVLLAVVLALSFFSAIGMQASIPPPTCGTGNNPPCPWVN* |
| Ga0068969_12818522 | 3300004475 | Peatlands Soil | MFKKVLLAVVLALSFFSAIGMQASIPPPTCGTGNNPPCPWVN* |
| Ga0070761_100010168 | 3300005591 | Soil | MIKKVLLALALALSCLSAIGVQASVPPPECGTGNNPPCPWVN* |
| Ga0070761_100332305 | 3300005591 | Soil | MFKKVLLVFVLALSFVSALSVSASVPPPQCDPCPWVN* |
| Ga0070764_106828832 | 3300005712 | Soil | MIKKVLLTAILALSFFSAIGLEGNAPPPSCDPCPWVN* |
| Ga0075029_1002209191 | 3300006052 | Watersheds | MFKKALLAVVLALSFFSAIGMEASIPPPTCNPCPWVN* |
| Ga0073928_100163896 | 3300006893 | Iron-Sulfur Acid Spring | MLKKSLLAAILALSFFAAIGAEAGIPPPACNPCPWVR* |
| Ga0116138_10284683 | 3300009552 | Peatland | MIKKVLLAAVLALSFFSAIGLEGSVPPPQCDPCPWVN* |
| Ga0116133_10215672 | 3300009623 | Peatland | MFKKVLLAFVLALTFLSAIGVQASVPPPSCNPCPWVN* |
| Ga0116135_10041836 | 3300009665 | Peatland | MLKKVLLTVILALSFFSAIGLEGSAPPPQCDPCPWVN* |
| Ga0116101_10666192 | 3300009759 | Peatland | LFKKILLTVVLALSFFSAISVEGSVGPPSCDPCPLVN* |
| Ga0136449_1002215004 | 3300010379 | Peatlands Soil | MFKKVLLAVVLALSFFSAIGLEGMAPPPQCNPCPWVN* |
| Ga0136449_1004277223 | 3300010379 | Peatlands Soil | MITLVIKEKNAMFKKVLLAAVLALSFFSAIGLEGSAPPPSCNPCPWVN* |
| Ga0138536_1311282 | 3300011022 | Peatlands Soil | LMFKKVLLAVVLALSFFSAIGLEGMAPPPQCNPCPWVN* |
| Ga0138593_1077031 | 3300011039 | Peatlands Soil | SRSKSLMFKKVLLAVVLALSFFSAIGLEGMAPPPQCNPCPWVN* |
| Ga0138599_10072551 | 3300011068 | Peatlands Soil | EKNLMFKKVLLAVVLALSFFSAIGMQASIPPPTCGTGNNPPCPWVN* |
| Ga0138572_11175172 | 3300011077 | Peatlands Soil | VSKEKNLMFKKVLLAVVLALSFFSAIGMQASIPPPTCGTGNNPPCPWVN* |
| Ga0138569_10087461 | 3300011079 | Peatlands Soil | SKEKNLMFKKVLLAVVLALSFFSAIGMQASIPPPTCGTGNNPPCPWVN* |
| Ga0138579_13166182 | 3300011090 | Peatlands Soil | GQSRSKSLMFKKVLLAVVLALSFFSAIGLEGMAPPPQCNPCPWVN* |
| Ga0150983_145134561 | 3300011120 | Forest Soil | RRKTLMFKKVLLVFVLALSFVSALSVSASVPPPQCDPCPWVN* |
| Ga0150983_147956182 | 3300011120 | Forest Soil | SRRKNLMIKKVLLTVVLALSFFSAIGLEGSAPPPQCDPCPWVN* |
| Ga0181533_10013218 | 3300014152 | Bog | MFKKVLLAVVLALSFFSAIGMQATIPPPSCNPCPWVN* |
| Ga0181518_1000010433 | 3300014156 | Bog | MLKKALLAALLALSFFAALGIQGHAPPPECDPCPWVN* |
| Ga0181518_102564841 | 3300014156 | Bog | MFKKVLLAVVLALSFLSAFGIEASAPPPTCNPCPWVN* |
| Ga0181538_1000683311 | 3300014162 | Bog | MFKKVLLAVVLALSFLSVIGVEASVPPPSCNPCPWVN* |
| Ga0181534_100076936 | 3300014168 | Bog | MFKKTLLAVVLALSFFAAIGADASQPPPTCDPCPWVN* |
| Ga0182016_100362692 | 3300014493 | Bog | MFKKVLLAAVLAISFFSAIGLEGSAPPPTCNPCPWVN* |
| Ga0182015_101815862 | 3300014495 | Palsa | MVKKVLLTLVLALSFVSAISSQASAPPPMCDPCPWVN* |
| Ga0182030_100940535 | 3300014838 | Bog | MFKKILLAVVLALSFLSVIGVEASVPPPTCNPCPWVN* |
| Ga0182030_105501642 | 3300014838 | Bog | MFKKVLLAVVVAISFFSVIGVQASAPPPTCAPCPWVN* |
| Ga0181511_10503312 | 3300016702 | Peatland | ARRKTLMLKKVLLTVVLALSFVAAIGLQGSIPPPECGLPGNPPCPWVN |
| Ga0181511_11045031 | 3300016702 | Peatland | KEKDPMFKKVLLAVVLALSFLSVIGVEASVPPPSCNPCPWVN |
| Ga0181511_12958741 | 3300016702 | Peatland | ARRKNLMIKKVLLAAVLALSFFSAIGLEGSVPPPQCDPCPWVN |
| Ga0181507_11446132 | 3300016705 | Peatland | KRPMVKRFLLAVVLAMTFMSVIGMQASVPPPQCDPCPWVN |
| Ga0181507_11828012 | 3300016705 | Peatland | MLKKVLLTVVLALSFVAAIGLQGSIPPPECGLPGNPPCPWVN |
| Ga0181507_13494911 | 3300016705 | Peatland | KHLMVKKVLLAVVLALSFFSAIGLEGSIPPPSCDPCPWVN |
| Ga0181515_14040351 | 3300016730 | Peatland | TPAATLMLKKVLLTVVLALSFVAAIGLQGSIPPPECGLPGNPPCPWVN |
| Ga0181505_100243211 | 3300016750 | Peatland | RSKDPMFKKVLLAVVLALSFFSAIGLEGSAPPPMCNPCPWVN |
| Ga0187879_100226414 | 3300017946 | Peatland | MLKKVLLTVVLALSFVAAIGMQGSIPPPECGLPGNPPCPWVN |
| Ga0187879_100660981 | 3300017946 | Peatland | MFKKVLLAFVLALTFLSAIGVQASVPPPSCNPCPWVN |
| Ga0187879_100741314 | 3300017946 | Peatland | MFKKVLLAVVLALSFFSAIGLQGNAPPPTCLPCPWVN |
| Ga0187879_101155533 | 3300017946 | Peatland | VKKVLLAVVLALSFFSAIGLEGSIPPPSCDPCPWVN |
| Ga0187847_100088634 | 3300017948 | Peatland | MMKKVLLAVVLAISFLTVIGVGSAPPPECGTDHNPPCPWVN |
| Ga0187847_100105854 | 3300017948 | Peatland | MIKKVLLAAVLALSFFSAIGLEGSVPPPQCDPCPWVN |
| Ga0187783_101517273 | 3300017970 | Tropical Peatland | MFKKALFAMILALSFFAAIGVEASVPPPTCAPCPWVN |
| Ga0187782_100706912 | 3300017975 | Tropical Peatland | MFKKALFAVVLALSFFAALGVEASVPPPTCAPCPWVN |
| Ga0187782_103020913 | 3300017975 | Tropical Peatland | MLKKALLALMLALSFLAAVGAEAGPPLPACNPCPWVN |
| Ga0181520_100751723 | 3300017988 | Bog | MFKKVLLAVVLALSFLSVIGVEASVPPPSCNPCPWVN |
| Ga0187872_102302642 | 3300018017 | Peatland | MIKKALLAVVLALSFFSAIGLEGSAPPPQCLPCPWVN |
| Ga0187857_100300095 | 3300018026 | Peatland | MLKKALLAALLALSFFAALGIQGHAPPPECDPCPWVN |
| Ga0187875_100402033 | 3300018035 | Peatland | MFKKVLLAIVLALSFLSVISVQATIPPPSCGPCPWVN |
| Ga0187883_102924672 | 3300018037 | Peatland | MVKKVLLAVVLALSFFSAIGLEGSIPPPSCDPCPWVN |
| Ga0187855_100876462 | 3300018038 | Peatland | MLKKALLAALLALSFFAAIGIQGSGPVPECDPCPWVN |
| Ga0187887_106121322 | 3300018043 | Peatland | MFKKVLMAVVMALTFLAAIGVQASAPPPTCGIGNNPPCPWVN |
| Ga0187887_109030691 | 3300018043 | Peatland | MFKKVLIAVVMALSFFAAVSVQASVPPPTCGGPGNPCPWVN |
| Ga0187859_100578173 | 3300018047 | Peatland | MFKKILLTVVLALSFFSAIGLEGSAPPPSCDPCPWVN |
| Ga0187769_100815251 | 3300018086 | Tropical Peatland | MFRKVLLAVVLALSFVAAISVQASIPPPQCGIGNNPPCPWVN |
| Ga0187769_108612111 | 3300018086 | Tropical Peatland | MLKKAVLAVLLALSFLAAVGAETPIPPPQCAPCPWVN |
| Ga0187799_11828981 | 3300019211 | Peatland | RSKNLMFKKLLLAVVLALSFFSAIGVQAAAPPPTCGPCPWVN |
| Ga0181501_12101451 | 3300019230 | Peatland | EKDPMFKKVLLAVVLALSFLSVIGVEASVPPPSCNPCPWVN |
| Ga0181501_12650162 | 3300019230 | Peatland | KDPMFKKVLLAFVLALTFLSAIGVQASVPPPSCNPCPWVN |
| Ga0181510_11179531 | 3300019240 | Peatland | NLMLKKVLLTVILALSFFSAIGLEGSAPPPQCDPCPWVN |
| Ga0181510_13925972 | 3300019240 | Peatland | ARRKKRMFKKILLTVVLALSFFSAISVEGSVGPPSCDPCPLVN |
| Ga0181502_12819302 | 3300019242 | Peatland | MFKKALLVFALALSFVSAMSVSASAPPPQCDPCPWVN |
| Ga0181502_15277362 | 3300019242 | Peatland | FKKVLLAFVLALTFLSAIGVQASVPPPSCNPCPWVN |
| Ga0181508_10856092 | 3300019256 | Peatland | VNKEKDPMFKKVLLAVVLALSFLSVIGVEASVPPPSCNPCPWVN |
| Ga0181508_13674201 | 3300019256 | Peatland | RKDPMFKKVLLAFVLALTFLSAIGVQASVPPPSCNPCPWVN |
| Ga0181504_10526742 | 3300019258 | Peatland | RKNLMIKKVLLAAVLALSFFSAIGLEGSVPPPQCDPCPWVN |
| Ga0181504_14134591 | 3300019258 | Peatland | KKRMFKKILLTVVLALSFFSAISVEGSVGPPSCDPCPLVN |
| Ga0181514_14567241 | 3300019268 | Peatland | KKPMFKKALLVFALALSFVSAMSVSASAPPPQCDPCPWVN |
| Ga0181512_12328742 | 3300019270 | Peatland | RIKNLMLKKVLLTVILALSFFSAIGLEGSAPPPQCDPCPWVN |
| Ga0187798_11314991 | 3300019275 | Peatland | KEKNLMFKKVLLAVVLALSFFAAVGMQATIPPPSCGPCPWVN |
| Ga0187798_13409122 | 3300019275 | Peatland | ARSKNLMFKKLLLAVVLALSFFSAIGVQAAAPPPTCGPCPWVN |
| Ga0187800_12957772 | 3300019278 | Peatland | RGGFTLMLKKLLLATVMVLSFLSAIGVEASVPPPSCNPCPWVN |
| Ga0187800_14351212 | 3300019278 | Peatland | MFKKALLVLMFALSFFAAVGAEATIPPPSCNPCPWVN |
| Ga0187800_15467251 | 3300019278 | Peatland | RRKNLMFKKVLLAVVLALSFFSAIGLQASLPPPTCGPCPWVN |
| Ga0187797_13294721 | 3300019284 | Peatland | ARRKGPMLRKVLLGLVFALAVFAAVGADAGAPPPTCYPCPWSN |
| Ga0242641_10318862 | 3300022499 | Soil | ARRKNPMIKKVLLAVVLALSFFSAIGLEGSAPPPQCDPCPWVN |
| Ga0242667_10324652 | 3300022513 | Soil | RKTLMFKKVLLVFVLALSFVSALSVSASVPPPQCDPCPWVN |
| Ga0242659_10683701 | 3300022522 | Soil | RRKNLMFKKVLLTVVLALSFFSAIGLEGSVPPPACDPCPWVN |
| Ga0242659_11128191 | 3300022522 | Soil | NKEKNVMFKKVLVAVVLALSFCAAIGVQAAAPPPQCGTGNNPPCPWVN |
| Ga0224534_10077555 | 3300022524 | Soil | MFKKILLAVVLALSFLSVIGVEASVPPPTCNPCPWVN |
| Ga0222756_10855001 | 3300022709 | Soil | EKHLMLKKVLLAVVLALSAFSAIGVQGSIPPPQCGIDKNPPCPW |
| Ga0242673_10515502 | 3300022716 | Soil | LSRRKNLMIKKVLLTVVLALSFFSAIGLEGSAPPPQCDPCPWVN |
| Ga0242673_11008862 | 3300022716 | Soil | ARRKNLMFKKVLLTVVLALSFFSAIGLEGSVPPPACDPCPWVN |
| Ga0242661_11133111 | 3300022717 | Soil | GEKHLMLKKVLLAVVLALSAFSAIGVQGSIPPPQCGIDKNPPCPW |
| Ga0224555_10043112 | 3300023088 | Soil | MFKKVLLAVVLALSFLSVIGVEASVPPPTCAPCPWVN |
| Ga0208691_10415623 | 3300025612 | Peatland | MLKKVLLTVILALSFFSAIGLEGSAPPPQCDPCPWVN |
| Ga0209274_100018366 | 3300027853 | Soil | MIKKVLLALALALSCLSAIGVQASVPPPECGTGNNPPCPWVN |
| Ga0209274_102348652 | 3300027853 | Soil | KKVLLVFVLALSFVSALSVSASVPPPQCDPCPWVN |
| Ga0209169_107280622 | 3300027879 | Soil | NLMFKKVLLTVVLALSFFSAIGLEGSVPPPACDPCPWVN |
| Ga0209698_100319475 | 3300027911 | Watersheds | MFKKALLAVVLALSFFSAIGMEASIPPPTCNPCPWVN |
| Ga0311363_103385573 | 3300029922 | Fen | MFKKVLLAVVVAISFFSVIGVQASAPPPTCAPCPWVN |
| Ga0311353_101704714 | 3300030399 | Palsa | MFRKALLAVVLALSFFAAVGAEAGAPPPTCLPCQWVN |
| Ga0210284_11972741 | 3300030529 | Soil | LTRRKTLMFRKALLAVVLALSFFAAVGAEAGAPPPTCLPCQWVN |
| Ga0210257_107268991 | 3300030549 | Soil | YQGEKNLMIKKVLLTVVLALSFFSAIGLEGSAPPPQCDPCPWVN |
| Ga0210257_108329673 | 3300030549 | Soil | RKDLMYKKVLMMVVLALSFFAAIGVQASAPPPECGTGNNPPCPWVN |
| Ga0265762_11391071 | 3300030760 | Soil | KTLMMKKVLLAVVLAISFLTVIGIGSAPPPTCGTDHNPPCPWVN |
| Ga0265750_10704332 | 3300030813 | Soil | MYKKVLMMVVLALSFFAAIGVQASAPPPECGTGNNPPCPWVN |
| Ga0302180_101214173 | 3300031028 | Palsa | MFKKVLLAVVLALSFFSAISVQASAPPPTCGGPGNPCPWVN |
| Ga0302325_100433913 | 3300031234 | Palsa | MIKKVLFAVVLALSFVSAISVQASVPPPQCDPCPWVN |
| Ga0302325_103336545 | 3300031234 | Palsa | MFKKVLLTVVLALSFFSAIALEGSAPPPMCDPCPWV |
| Ga0302324_1000423257 | 3300031236 | Palsa | MFKKVLLTVVLALSFFSAIALEGSAPPPMCDPCPWVN |
| Ga0302324_1002050081 | 3300031236 | Palsa | MSKKVLLAVVLALSFFSAIGVQASAPPPECLPCPWVN |
| Ga0302326_102602964 | 3300031525 | Palsa | MSKKILLAVVLALSFFSAVGVQASAPPPECLPCPWVN |
| Ga0316036_1192292 | 3300031871 | Soil | EKTQMIKKVLLTVVLALSFFSAIGLEGSAPPPQCDPCPWVN |
| Ga0311301_100295277 | 3300032160 | Peatlands Soil | MFKKVLLAVVLALSFFSAIGMQASIPPPTCGTGNNPPCPWVN |
| Ga0311301_100658464 | 3300032160 | Peatlands Soil | MFKKVLLAVVLALSFFSAIGLEGMAPPPQCNPCPWVN |
| Ga0311301_111266232 | 3300032160 | Peatlands Soil | MITLVIKEKNAMFKKVLLAAVLALSFFSAIGLEGSAPPPSCNPCPWVN |
| Ga0348332_111461782 | 3300032515 | Plant Litter | RKNLMFKKVLLTVVLALSFFSAIGLEGSVPPPACDPCPWVN |
| Ga0348332_132610791 | 3300032515 | Plant Litter | KNVMFKKVLVAVVLALSFCAAIGVQAAAPPPQCGTGNNPPCPWVN |
| Ga0348332_144501671 | 3300032515 | Plant Litter | QGEKTQMIKKVLLTVVLALSFFSAIGLEGSAPPPQCDPCPWVN |
| Ga0335085_10000016111 | 3300032770 | Soil | MIKKVLLAAILALSFFSAVSMEGIIPPPTCNPCPWVN |
| Ga0335079_100229385 | 3300032783 | Soil | MLKKVLLAVVLALSFFSAIGLEGHAPPPTCNPCPWVN |
| Ga0335079_100349402 | 3300032783 | Soil | MLKKALLAALLALSFFAAIGLQGHAPPPECDPCPWVN |
| Ga0335079_101891403 | 3300032783 | Soil | MFKKALLAVLMTLSFFAAIGAEASIPPPECNPCPWVN |
| Ga0335078_100640544 | 3300032805 | Soil | MLKKVLLAVALVLSFLSAIGAEATVPPPSCNPCPWVN |
| Ga0335081_100230077 | 3300032892 | Soil | MFKKVLLAVVLALSFFSAIGMQASIPPPSCGPCPWVN |
| Ga0335081_107772892 | 3300032892 | Soil | MLKKALLAALLALSFFAAVGVQGHAPVPECDPCPWVN |
| Ga0335069_104407292 | 3300032893 | Soil | MFKKTLLAVLLALSFFAAVGAEAAAPPTCNPCQWVK |
| Ga0335069_108426051 | 3300032893 | Soil | MMKKVLLAAILALSFLSAVGLEGITPPPTCGPCPWVNVN |
| ⦗Top⦘ |