


| Basic Information | |
|---|---|
| Family ID | F069596 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 41 residues |
| Representative Sequence | EKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.31 % |
| % of genes from short scaffolds (< 2000 bps) | 90.24 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.724 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland (31.707 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.992 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.854 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00224 | PK | 4.88 |
| PF05592 | Bac_rhamnosid | 2.44 |
| PF00593 | TonB_dep_Rec | 2.44 |
| PF13380 | CoA_binding_2 | 1.63 |
| PF02881 | SRP54_N | 1.63 |
| PF01902 | Diphthami_syn_2 | 1.63 |
| PF13564 | DoxX_2 | 0.81 |
| PF00196 | GerE | 0.81 |
| PF00149 | Metallophos | 0.81 |
| PF13432 | TPR_16 | 0.81 |
| PF00310 | GATase_2 | 0.81 |
| PF16576 | HlyD_D23 | 0.81 |
| PF00027 | cNMP_binding | 0.81 |
| PF03601 | Cons_hypoth698 | 0.81 |
| PF13620 | CarboxypepD_reg | 0.81 |
| PF04480 | DUF559 | 0.81 |
| PF02978 | SRP_SPB | 0.81 |
| PF01694 | Rhomboid | 0.81 |
| PF01258 | zf-dskA_traR | 0.81 |
| PF01261 | AP_endonuc_2 | 0.81 |
| PF02887 | PK_C | 0.81 |
| PF00990 | GGDEF | 0.81 |
| PF13358 | DDE_3 | 0.81 |
| PF13374 | TPR_10 | 0.81 |
| PF13437 | HlyD_3 | 0.81 |
| PF13419 | HAD_2 | 0.81 |
| PF07685 | GATase_3 | 0.81 |
| PF06868 | DUF1257 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 5.69 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 2.44 |
| COG2102 | Diphthamide synthase (EF-2-diphthine--ammonia ligase) | Translation, ribosomal structure and biogenesis [J] | 1.63 |
| COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.81 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.72 % |
| All Organisms | root | All Organisms | 42.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005175|Ga0066673_10061732 | Not Available | 1921 | Open in IMG/M |
| 3300005569|Ga0066705_10718113 | Not Available | 601 | Open in IMG/M |
| 3300009518|Ga0116128_1137471 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300009518|Ga0116128_1197181 | Not Available | 566 | Open in IMG/M |
| 3300009519|Ga0116108_1220477 | Not Available | 555 | Open in IMG/M |
| 3300009547|Ga0116136_1078132 | Not Available | 882 | Open in IMG/M |
| 3300009548|Ga0116107_1065779 | Not Available | 1175 | Open in IMG/M |
| 3300009548|Ga0116107_1134518 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300009552|Ga0116138_1114750 | Not Available | 745 | Open in IMG/M |
| 3300009552|Ga0116138_1132341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300009552|Ga0116138_1187022 | Not Available | 572 | Open in IMG/M |
| 3300009616|Ga0116111_1003421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8766 | Open in IMG/M |
| 3300009618|Ga0116127_1055977 | Not Available | 1120 | Open in IMG/M |
| 3300009618|Ga0116127_1152392 | Not Available | 577 | Open in IMG/M |
| 3300009618|Ga0116127_1183278 | Not Available | 512 | Open in IMG/M |
| 3300009621|Ga0116116_1028458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1891 | Open in IMG/M |
| 3300009621|Ga0116116_1196253 | Not Available | 517 | Open in IMG/M |
| 3300009631|Ga0116115_1034300 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300009631|Ga0116115_1095768 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300009636|Ga0116112_1018206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2453 | Open in IMG/M |
| 3300009636|Ga0116112_1076613 | Not Available | 956 | Open in IMG/M |
| 3300009640|Ga0116126_1213706 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009646|Ga0116132_1252385 | Not Available | 537 | Open in IMG/M |
| 3300009760|Ga0116131_1162397 | Not Available | 637 | Open in IMG/M |
| 3300009760|Ga0116131_1164527 | Not Available | 632 | Open in IMG/M |
| 3300009762|Ga0116130_1264978 | Not Available | 547 | Open in IMG/M |
| 3300010339|Ga0074046_10070796 | Not Available | 2276 | Open in IMG/M |
| 3300010379|Ga0136449_101476619 | Not Available | 1043 | Open in IMG/M |
| 3300012209|Ga0137379_10170274 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
| 3300014151|Ga0181539_1115737 | Not Available | 1107 | Open in IMG/M |
| 3300014151|Ga0181539_1176850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300014152|Ga0181533_1230295 | Not Available | 700 | Open in IMG/M |
| 3300014154|Ga0134075_10091093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium ADurb.Bin222 | 1284 | Open in IMG/M |
| 3300014155|Ga0181524_10060016 | Not Available | 2337 | Open in IMG/M |
| 3300014156|Ga0181518_10202893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1030 | Open in IMG/M |
| 3300014158|Ga0181521_10512326 | Not Available | 572 | Open in IMG/M |
| 3300014160|Ga0181517_10326047 | Not Available | 802 | Open in IMG/M |
| 3300014492|Ga0182013_10176335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1314 | Open in IMG/M |
| 3300017925|Ga0187856_1091664 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300017929|Ga0187849_1106028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300017929|Ga0187849_1116718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1112 | Open in IMG/M |
| 3300017929|Ga0187849_1124962 | Not Available | 1062 | Open in IMG/M |
| 3300017929|Ga0187849_1168164 | Not Available | 873 | Open in IMG/M |
| 3300017929|Ga0187849_1340206 | Not Available | 555 | Open in IMG/M |
| 3300017931|Ga0187877_1213748 | Not Available | 753 | Open in IMG/M |
| 3300017938|Ga0187854_10378484 | Not Available | 596 | Open in IMG/M |
| 3300017938|Ga0187854_10380769 | Not Available | 593 | Open in IMG/M |
| 3300017938|Ga0187854_10458922 | Not Available | 531 | Open in IMG/M |
| 3300017940|Ga0187853_10292095 | Not Available | 739 | Open in IMG/M |
| 3300017940|Ga0187853_10433327 | Not Available | 579 | Open in IMG/M |
| 3300017943|Ga0187819_10405011 | Not Available | 784 | Open in IMG/M |
| 3300017975|Ga0187782_11447514 | Not Available | 541 | Open in IMG/M |
| 3300017998|Ga0187870_1032585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 2395 | Open in IMG/M |
| 3300017998|Ga0187870_1138079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300018003|Ga0187876_1118514 | Not Available | 958 | Open in IMG/M |
| 3300018004|Ga0187865_1043584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1847 | Open in IMG/M |
| 3300018005|Ga0187878_1146160 | Not Available | 920 | Open in IMG/M |
| 3300018006|Ga0187804_10330527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 667 | Open in IMG/M |
| 3300018018|Ga0187886_1288706 | Not Available | 613 | Open in IMG/M |
| 3300018018|Ga0187886_1332775 | Not Available | 562 | Open in IMG/M |
| 3300018022|Ga0187864_10430785 | Not Available | 563 | Open in IMG/M |
| 3300018023|Ga0187889_10169771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
| 3300018024|Ga0187881_10103667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1282 | Open in IMG/M |
| 3300018024|Ga0187881_10259180 | Not Available | 727 | Open in IMG/M |
| 3300018024|Ga0187881_10356740 | Not Available | 602 | Open in IMG/M |
| 3300018025|Ga0187885_10080125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1614 | Open in IMG/M |
| 3300018026|Ga0187857_10365561 | Not Available | 653 | Open in IMG/M |
| 3300018030|Ga0187869_10538632 | Not Available | 554 | Open in IMG/M |
| 3300018035|Ga0187875_10164747 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300018038|Ga0187855_10736724 | Not Available | 574 | Open in IMG/M |
| 3300018040|Ga0187862_10370009 | Not Available | 886 | Open in IMG/M |
| 3300018040|Ga0187862_10583306 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300018057|Ga0187858_10812058 | Not Available | 553 | Open in IMG/M |
| 3300018062|Ga0187784_10065794 | All Organisms → cellular organisms → Bacteria | 2939 | Open in IMG/M |
| 3300018062|Ga0187784_11515287 | Not Available | 531 | Open in IMG/M |
| 3300018062|Ga0187784_11565571 | Not Available | 522 | Open in IMG/M |
| 3300018086|Ga0187769_10476625 | Not Available | 941 | Open in IMG/M |
| 3300018086|Ga0187769_11322810 | Not Available | 545 | Open in IMG/M |
| 3300018086|Ga0187769_11488730 | Not Available | 512 | Open in IMG/M |
| 3300018088|Ga0187771_10429812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1115 | Open in IMG/M |
| 3300018088|Ga0187771_11248052 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300018090|Ga0187770_10795134 | Not Available | 757 | Open in IMG/M |
| 3300019082|Ga0187852_1095186 | Not Available | 1317 | Open in IMG/M |
| 3300019082|Ga0187852_1137395 | Not Available | 1046 | Open in IMG/M |
| 3300019082|Ga0187852_1182516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300019273|Ga0187794_1538153 | Not Available | 553 | Open in IMG/M |
| 3300019284|Ga0187797_1237914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 906 | Open in IMG/M |
| 3300021559|Ga0210409_11137867 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300025409|Ga0208321_1026843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300025419|Ga0208036_1009578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2329 | Open in IMG/M |
| 3300025432|Ga0208821_1054756 | Not Available | 712 | Open in IMG/M |
| 3300025439|Ga0208323_1021104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300025444|Ga0208189_1076108 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300025453|Ga0208455_1112166 | Not Available | 508 | Open in IMG/M |
| 3300025459|Ga0208689_1006863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4203 | Open in IMG/M |
| 3300025459|Ga0208689_1102195 | Not Available | 506 | Open in IMG/M |
| 3300025460|Ga0208562_1076711 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300025469|Ga0208687_1122351 | Not Available | 515 | Open in IMG/M |
| 3300025480|Ga0208688_1078578 | Not Available | 659 | Open in IMG/M |
| 3300025501|Ga0208563_1018957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1874 | Open in IMG/M |
| 3300025501|Ga0208563_1114725 | Not Available | 511 | Open in IMG/M |
| 3300025576|Ga0208820_1058474 | Not Available | 1048 | Open in IMG/M |
| 3300025812|Ga0208457_1022628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
| 3300027905|Ga0209415_10476448 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300029817|Ga0247275_1056195 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300029817|Ga0247275_1120887 | Not Available | 678 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1260897 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300031670|Ga0307374_10222607 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300031962|Ga0307479_11211899 | Not Available | 718 | Open in IMG/M |
| 3300031997|Ga0315278_11746462 | Not Available | 590 | Open in IMG/M |
| 3300032118|Ga0315277_11360677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 618 | Open in IMG/M |
| 3300032828|Ga0335080_11429238 | Not Available | 687 | Open in IMG/M |
| 3300033402|Ga0326728_10079750 | All Organisms → cellular organisms → Bacteria | 4215 | Open in IMG/M |
| 3300033402|Ga0326728_10240964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1740 | Open in IMG/M |
| 3300033402|Ga0326728_10439048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1092 | Open in IMG/M |
| 3300033977|Ga0314861_0003619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14474 | Open in IMG/M |
| 3300033977|Ga0314861_0059659 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300033977|Ga0314861_0087464 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300033977|Ga0314861_0322710 | Not Available | 691 | Open in IMG/M |
| 3300033977|Ga0314861_0388932 | Not Available | 612 | Open in IMG/M |
| 3300033977|Ga0314861_0419601 | Not Available | 583 | Open in IMG/M |
| 3300033982|Ga0371487_0099733 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300034091|Ga0326724_0114635 | Not Available | 1737 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 31.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 28.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.13% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 6.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.69% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.06% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025409 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300031604 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066673_100617321 | 3300005175 | Soil | LRLGERKTVLKLTAILEYFANVVGRRVSQVRVGNLTPSDFLLEL* |
| Ga0066705_107181132 | 3300005569 | Soil | KSAILRLTAILQHFANILGERVSHVRFGNLTASEYLLGL* |
| Ga0116128_11374712 | 3300009518 | Peatland | RRLLKVGEKKAVLKLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL* |
| Ga0116128_11971811 | 3300009518 | Peatland | LITRHWLRVREKPAILKLTSILQYFANVVGQRVNTVRFANLTASSYLLDL* |
| Ga0116108_12204771 | 3300009519 | Peatland | GEKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL* |
| Ga0116136_10781321 | 3300009547 | Peatland | KKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL* |
| Ga0116107_10657791 | 3300009548 | Peatland | KAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL* |
| Ga0116107_11345182 | 3300009548 | Peatland | LLKVGEKKAVLKLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL* |
| Ga0116138_11147501 | 3300009552 | Peatland | HWLRVREKPAILKPTPILQYFANVVGQRVDSVRFATLTASDYVLDL* |
| Ga0116138_11323412 | 3300009552 | Peatland | WLRVGEKPAILKLTAILQYFANVVGQRVDSVRFANLTAADCVLGL* |
| Ga0116138_11870222 | 3300009552 | Peatland | RRLLKVGEKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL* |
| Ga0116111_100342111 | 3300009616 | Peatland | EKPAILKLTSILQYFANVVGQRVNTVRFANLTASSYLLDL* |
| Ga0116127_10559772 | 3300009618 | Peatland | RHWLRVREEPAILKLTAVLQYFANVVGQRVSTVRFANLTAADYLLEL* |
| Ga0116127_11523921 | 3300009618 | Peatland | LRLASGVGSEWGEKPAILKLTAILQYFANVVGQRVNTVRFANLTAADYLLDL* |
| Ga0116127_11832781 | 3300009618 | Peatland | EKPAILKLTAILQYFANVVGQRVDSVRFANLTAADCVLGL* |
| Ga0116116_10284581 | 3300009621 | Peatland | ILKLTAILQYFANVVGQRVDSVRFANLTAADCVLGL* |
| Ga0116116_11962531 | 3300009621 | Peatland | SGVGSEWGEKPAILKLTAILQYFANVVGQRVNTVRFANLTTADYLLDL* |
| Ga0116115_10343001 | 3300009631 | Peatland | RLLRVGEKKAALRLTSVLQYFANVVGQRVNTIRFGNLTATDYLFLNS* |
| Ga0116115_10957682 | 3300009631 | Peatland | RRLLKVGEKKATLRLTSVLQYFANVVGQRVDTERFGNLPAADYLFLNS* |
| Ga0116112_10182061 | 3300009636 | Peatland | KPAILKLTSILQYFANVVGQRVNTVRFANLTAADYVPAL* |
| Ga0116112_10766131 | 3300009636 | Peatland | ILKLTAILQYFANVVGQRVDTVRFANLAAADYLPAL* |
| Ga0116126_12137062 | 3300009640 | Peatland | LRLREKPAVLELAAILQYFANIVGKRMSSVRLGNLTASDYLLSL* |
| Ga0116132_12523851 | 3300009646 | Peatland | RLLKVGEKKAVLKLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL* |
| Ga0116131_11623972 | 3300009760 | Peatland | PAILKLTAILQYFANVVGQRVDTVRFANLTAADYLLEL* |
| Ga0116131_11645271 | 3300009760 | Peatland | KLSERPAVLKLAKILEYFANVVGERVNTVRFGNLTASDYLLNL* |
| Ga0116130_12649781 | 3300009762 | Peatland | KAALRLTSVLQYFANVVGQRVNEAGFGNPTAASCLVNR* |
| Ga0074046_100707961 | 3300010339 | Bog Forest Soil | LKLTSILEYFANVVGERVNTVRFGNLTASDYLLNL* |
| Ga0136449_1014766192 | 3300010379 | Peatlands Soil | VILRLTSVLQYFANVVGQRVEAVKFGNLAAAEFPLSF* |
| Ga0137379_101702742 | 3300012209 | Vadose Zone Soil | VDEKPAILKLTAILQYFANMVGQRLNTFHFANLTASG* |
| Ga0181539_11157372 | 3300014151 | Bog | ITRHWLRVREEPAILKLTAVLQYFANVVGQRVSTVRFANLTAADYLLEL* |
| Ga0181539_11768501 | 3300014151 | Bog | LKLTTILQYFANVVGQRVNTVRFANLTAADYLLEL* |
| Ga0181533_12302951 | 3300014152 | Bog | LRENSALLKLTTILQYFANVVGDRVNTVRFGNVTASDYLLNI* |
| Ga0134075_100910932 | 3300014154 | Grasslands Soil | FRLSEKKAVLKLTAILEYFANVVGQRVSQYRFGNLAPSDYLLEL* |
| Ga0181524_100600161 | 3300014155 | Bog | WLRVREEPAILKLTAILQYFANVLGQRVDTVRFTNLTAADYLLGL* |
| Ga0181518_102028933 | 3300014156 | Bog | HWLRLREKPAVLELAAILQYFANIVGKRVDSVSFGNLTAPEYLLSL* |
| Ga0181521_105123261 | 3300014158 | Bog | TLRVGEKKAVLRMTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL* |
| Ga0181517_103260471 | 3300014160 | Bog | LIIRRWLRVGEEPAILKLTAILQYLANVVGQRVNTVRFANQPAAA* |
| Ga0182013_101763351 | 3300014492 | Bog | LKMTAILEYFANVVGERADAMRFGNLTASDYLLNL* |
| Ga0187856_10916641 | 3300017925 | Peatland | PAILKLTAILKYFANVVGERVNTVRFGNLTASDYLLNL |
| Ga0187849_11060281 | 3300017929 | Peatland | ILKLTAILQYFANVVGQRVDTVRFANLAAADYLPAL |
| Ga0187849_11167183 | 3300017929 | Peatland | AVLELAAILQYFANIVGKRMSSVRLGNLTASDYLLSL |
| Ga0187849_11249621 | 3300017929 | Peatland | KAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0187849_11681642 | 3300017929 | Peatland | RLLKVGEKKAVLKLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0187849_13402061 | 3300017929 | Peatland | GEKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0187877_12137481 | 3300017931 | Peatland | AILKLTAILQYFANVVGQRVDTVRFANMAASDYLLDP |
| Ga0187854_103784842 | 3300017938 | Peatland | LRENSALLKLTTILQYFANVVGDRVNTVRFGNVTASDYLLNI |
| Ga0187854_103807691 | 3300017938 | Peatland | AILKLTTILQYFANVVGQRVNTVRFANLTAADYLLEL |
| Ga0187854_104589221 | 3300017938 | Peatland | ILKLTAILQYFANVVGQRVNTVRFANLTAADYLLDL |
| Ga0187853_102920951 | 3300017940 | Peatland | KPAILKLTAVLQYFANVVGQRVDTVRFANLAASDYLLDS |
| Ga0187853_104333271 | 3300017940 | Peatland | HLLKLREGTAVLRLTAVLQYFANVVGQRVNMVRFGNLTAADYLMNL |
| Ga0187819_104050113 | 3300017943 | Freshwater Sediment | LLRLRDNKAILKLTSVLQYFANVVGQRVHAVKFGNLAADYLINF |
| Ga0187782_114475141 | 3300017975 | Tropical Peatland | LKLTAILEYFANVVGERVNTVRFGNLTASDYLLNL |
| Ga0187870_10325851 | 3300017998 | Peatland | PAILKLTSILQYFANVVGQRVNTVRFANLTAADYVPAL |
| Ga0187870_11380791 | 3300017998 | Peatland | PAILKLTSILQYFANVVGQRVNTVRFANLTASSYLLDL |
| Ga0187876_11185141 | 3300018003 | Peatland | WLRVREEPAILKLTAVLQYFANVVGQRVSTVRFANLTAADYLLEL |
| Ga0187865_10435843 | 3300018004 | Peatland | WLRVGEKPAILKLTAILQYFANVVGQRVDSVRFANLTAADCVLGL |
| Ga0187878_11461603 | 3300018005 | Peatland | LLKVGEKKAILRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0187804_103305271 | 3300018006 | Freshwater Sediment | RLLGLGEKKAILKVTSVLQYFANVVGQRVNTIRAGNMMAPDYLSLNS |
| Ga0187886_12887061 | 3300018018 | Peatland | ESAAVLRLTAVLQYFANVVGQRVNTVRFGNLTAADYLMNL |
| Ga0187886_13327751 | 3300018018 | Peatland | RRLLKVGEKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0187864_104307852 | 3300018022 | Peatland | LKLTTILQYFANVVGQRVNTVRFANLTAADYLLEL |
| Ga0187889_101697712 | 3300018023 | Peatland | LASGVGSEWGEKPAILKLTAILQYFANVVGQRVNSVRFANLTAADYVLGL |
| Ga0187881_101036671 | 3300018024 | Peatland | LREKPAILKLTAILQYFANVVGQRVNVLRFDNLAAAEHLLNL |
| Ga0187881_102591801 | 3300018024 | Peatland | SAILKLTAILQYFANVVGQRVDTVRFANMAASDYLLDP |
| Ga0187881_103567401 | 3300018024 | Peatland | KKAILRVTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0187885_100801253 | 3300018025 | Peatland | REKPAVLELAAILQYFANIVGKRMNSVRFGNLSAYDYLLSL |
| Ga0187857_103655611 | 3300018026 | Peatland | PAILKLTAILQYFANVVGQRVNTVQFANLTASDYLLNP |
| Ga0187869_105386321 | 3300018030 | Peatland | LKVGEKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYILNL |
| Ga0187875_101647473 | 3300018035 | Peatland | LRENSAPLKLTTILQYFANVVGDRVNTVRFGNVTASDYLLNI |
| Ga0187855_107367242 | 3300018038 | Peatland | RETPVVLKLTAILEYFANVVGERVNTVRFGNLTASDYLLNL |
| Ga0187862_103700093 | 3300018040 | Peatland | AVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0187862_105833061 | 3300018040 | Peatland | KAILRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0187858_108120581 | 3300018057 | Peatland | GVGSEWGEKPAILKLTAILQYFANVVGQRVNTVRFANLTAADYLLDL |
| Ga0187784_100657941 | 3300018062 | Tropical Peatland | LKLTSVLQYFANVVGQRVNAGRFDNLTASDYLLDF |
| Ga0187784_115152871 | 3300018062 | Tropical Peatland | GENGAILKLTSVLHYFGNVVGQRVTTVGFGNLTTDYLVNF |
| Ga0187784_115655711 | 3300018062 | Tropical Peatland | TPAALKLTTILQYFANVVGERVNTVRFGNLTASDYLLNL |
| Ga0187769_104766253 | 3300018086 | Tropical Peatland | LKLTSVLQYFANVVGQRVNAVKFGNLTAADYLLNL |
| Ga0187769_113228102 | 3300018086 | Tropical Peatland | RHWLRFNEKQAILSLTSVLQYFANVVGEGVDAVRFGNLTATDYLLNL |
| Ga0187769_114887302 | 3300018086 | Tropical Peatland | RFNEKQAILSLTSVLQYFANVVGEGVDAVRFGNLTATDYLLSR |
| Ga0187771_104298123 | 3300018088 | Tropical Peatland | GEKKAALKVTSVLQYFANVVGQRVNKARAGNMIAADYLSLTS |
| Ga0187771_112480522 | 3300018088 | Tropical Peatland | PVLKLTAILQYFANVVGQRVNTVRFGNLTASDYLLGL |
| Ga0187770_107951341 | 3300018090 | Tropical Peatland | LKVGEKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0187852_10951861 | 3300019082 | Peatland | SLITRHWLRVREEPAILKLTTILQYFANVVGQRVNTVSFASQTAADYLLEI |
| Ga0187852_11373952 | 3300019082 | Peatland | VLELASILQYFANTVGKRIASARFGNLSDSAYLLNL |
| Ga0187852_11825161 | 3300019082 | Peatland | LRVGEKSAILKLTTILQYFANVVGQRVNTVRFANLTAADYLLEL |
| Ga0187794_15381532 | 3300019273 | Peatland | AALKLTSILEYFANVVGERVNMVRFGNLTASDYLLNL |
| Ga0187797_12379141 | 3300019284 | Peatland | GEKKAALKVASVLRYFANVVGQRVDTVRAGNPVALDYLSLNS |
| Ga0210409_111378671 | 3300021559 | Soil | ILKLAAILQYFANVVGERVNMVRFGNLTTSDYLLSL |
| Ga0208321_10268432 | 3300025409 | Peatland | ALEKLTAILQYFANVVGQRVNLVRLGNLAPSDYLLNL |
| Ga0208036_10095784 | 3300025419 | Peatland | VGEKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0208821_10547562 | 3300025432 | Peatland | LKLTAVLQYFANVVGQRVSTVRFANLTAADYLLEL |
| Ga0208323_10211042 | 3300025439 | Peatland | VGSEWGEKPAILKLTAILQYFANVVGQRVNTVRFANLTAADYVPAL |
| Ga0208189_10761081 | 3300025444 | Peatland | KKATLRLTSVLQYFANVVGQHVDTERFGNLPAADYLFLNS |
| Ga0208455_11121662 | 3300025453 | Peatland | ENTAILRLTAVLQYFANVVGQRVNAVKFGNLTAADYLLNL |
| Ga0208689_10068635 | 3300025459 | Peatland | GGEKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0208689_11021952 | 3300025459 | Peatland | RVGEKPAILKLTSILQYFANVVGQRVNTVRFANLTAADYVPAL |
| Ga0208562_10767112 | 3300025460 | Peatland | RRLLKVGEKKAVLKLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0208687_11223511 | 3300025469 | Peatland | HWLRVGEKPAILKLTSILQYFANVVGQRVDSVRFANLTAADCVLGL |
| Ga0208688_10785781 | 3300025480 | Peatland | SERPAVLKLAKILEYFANVVGERVNTVRFGNLTASDYLLNL |
| Ga0208563_10189574 | 3300025501 | Peatland | EKKAVLRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0208563_11147252 | 3300025501 | Peatland | RHWLRVREEPAILKLTTILQYFANVVGQRVNTVRFANLTAADYLLDL |
| Ga0208820_10584741 | 3300025576 | Peatland | PAILKLTAILQYFTNVVGQRVNTVRFANLTAADYLLEL |
| Ga0208457_10226283 | 3300025812 | Peatland | ILKLTAILQYFANVVGQRVDSVRFANLTAADCVLGL |
| Ga0209415_104764481 | 3300027905 | Peatlands Soil | GEKRAILRMTSVLQYFSNVVGQRMDTVGFGNVAAADYLPNL |
| Ga0247275_10561951 | 3300029817 | Soil | AVRRLLKVGEKKATLRLTSVLQYFANVVGERMSIVAFGNLPAAD |
| Ga0247275_11208871 | 3300029817 | Soil | LLKLGENAAILRLTAVLQYFANVVGQRVNAVKFGNLTAADYLLNL |
| (restricted) Ga0315309_12608972 | 3300031604 | Sediment | PAILMLTMILEYFANVVGQRVNLIRFGNLSGADYLINL |
| Ga0307374_102226071 | 3300031670 | Soil | GEKVFMLKLTSILQYFGNVLGERVSQIRFGNMTASEYLLSL |
| Ga0307479_112118991 | 3300031962 | Hardwood Forest Soil | VARHLLHLGEKPAILKLAAILQYFANVVGERVNMVRFGNLTTSDYLLSL |
| Ga0315278_117464621 | 3300031997 | Sediment | TLCHLLKLRESAAILRLTAVLQYFANVVGQRVNTVRFGNLTAADYLMNL |
| Ga0315277_113606771 | 3300032118 | Sediment | ALKLTAVLEYFANVVGQRVDMVRFANLSASEYLLRV |
| Ga0335080_114292382 | 3300032828 | Soil | RRLLKVGEKKATLRLASVLHYFANVVGQRVNMEGFGNLQADYLVNL |
| Ga0326728_100797505 | 3300033402 | Peat Soil | RLLKLGEKKAILRLTSVLQYFANVVGQRVNIVTFGNLTAADYLLNL |
| Ga0326728_102409641 | 3300033402 | Peat Soil | TLKLTAILEYFANVVGERVNTVRFGNLTASDYLLNL |
| Ga0326728_104390481 | 3300033402 | Peat Soil | KVGEKKAILRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0314861_0003619_3_113 | 3300033977 | Peatland | ILRLTSVLQYFANVVGQRVNTVRFGNLTAADYLLNL |
| Ga0314861_0059659_1959_2075 | 3300033977 | Peatland | KAILKLTSVLQYFANVVGQRVNAAKFGNLTASDYLLHL |
| Ga0314861_0087464_28_156 | 3300033977 | Peatland | VDENKAILKLTSVLQYFANVVGQRVNAAKFGNLTASDYLLQF |
| Ga0314861_0322710_572_691 | 3300033977 | Peatland | KKAILRLTSVLQYFANVVGQRVDIMTFGSLTAADYLLNR |
| Ga0314861_0388932_89_217 | 3300033977 | Peatland | MGEKKAILKLTSVLQYFANVVGQRVDTVRFGNLTAADYLLNL |
| Ga0314861_0419601_466_582 | 3300033977 | Peatland | SAVLKLTAILQYFANVVGERVNTVRFGNLTASDYLLNL |
| Ga0371487_0099733_1326_1460 | 3300033982 | Peat Soil | VSEKPAILKLTAILQYFANVVGQRVDTVRFANLTAADYALMSVT |
| Ga0326724_0114635_3_125 | 3300034091 | Peat Soil | ETPAALKLTAILQYFANVVGERVNTVRFGNLVASDYLLNL |
| ⦗Top⦘ |