


| Basic Information | |
|---|---|
| Family ID | F069490 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 46 residues |
| Representative Sequence | KHKSQVAKPGREWDFEKFMRKRHRDVGKKGGYQYAESFKRITV |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 98.39 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.581 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.452 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.452 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13472 | Lipase_GDSL_2 | 46.77 |
| PF00180 | Iso_dh | 20.16 |
| PF02012 | BNR | 1.61 |
| PF00584 | SecE | 1.61 |
| PF07366 | SnoaL | 1.61 |
| PF02585 | PIG-L | 0.81 |
| PF02812 | ELFV_dehydrog_N | 0.81 |
| PF01494 | FAD_binding_3 | 0.81 |
| PF00471 | Ribosomal_L33 | 0.81 |
| PF02887 | PK_C | 0.81 |
| PF00208 | ELFV_dehydrog | 0.81 |
| PF00440 | TetR_N | 0.81 |
| PF00459 | Inositol_P | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 1.61 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.61 |
| COG0690 | Preprotein translocase subunit SecE | Intracellular trafficking, secretion, and vesicular transport [U] | 1.61 |
| COG2443 | Preprotein translocase subunit Sss1 | Intracellular trafficking, secretion, and vesicular transport [U] | 1.61 |
| COG0267 | Ribosomal protein L33 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.81 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.81 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.81 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.81 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.39 % |
| Unclassified | root | N/A | 1.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090004|P1_DRAFT_NODE_191699_len_2378_cov_8_973927 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
| 2140918006|ConsensusfromContig53584 | Not Available | 834 | Open in IMG/M |
| 3300000880|AL20A1W_1214316 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300001154|JGI12636J13339_1046554 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300001359|A3035W6_1015787 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300001536|A1565W1_10303519 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005167|Ga0066672_10651203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 680 | Open in IMG/M |
| 3300005172|Ga0066683_10174320 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300005174|Ga0066680_10916998 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005179|Ga0066684_10157999 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300005179|Ga0066684_10350049 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005181|Ga0066678_10241490 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300005436|Ga0070713_102081458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300005445|Ga0070708_100637106 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005454|Ga0066687_10059925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1807 | Open in IMG/M |
| 3300005467|Ga0070706_100308527 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300005468|Ga0070707_102190575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300005471|Ga0070698_100110747 | All Organisms → cellular organisms → Bacteria | 2710 | Open in IMG/M |
| 3300005471|Ga0070698_100569289 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300005518|Ga0070699_101753792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300005536|Ga0070697_101061444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 721 | Open in IMG/M |
| 3300005536|Ga0070697_101439203 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005540|Ga0066697_10567697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 634 | Open in IMG/M |
| 3300005542|Ga0070732_10596286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 671 | Open in IMG/M |
| 3300005557|Ga0066704_10393904 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300005566|Ga0066693_10196541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 780 | Open in IMG/M |
| 3300005568|Ga0066703_10173600 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300005569|Ga0066705_10476442 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005575|Ga0066702_10349939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 899 | Open in IMG/M |
| 3300005575|Ga0066702_10936529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300005587|Ga0066654_10635387 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006032|Ga0066696_10048923 | All Organisms → cellular organisms → Bacteria | 2363 | Open in IMG/M |
| 3300006174|Ga0075014_101026911 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006755|Ga0079222_12657459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300006854|Ga0075425_101591977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 736 | Open in IMG/M |
| 3300006903|Ga0075426_10705694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 756 | Open in IMG/M |
| 3300006914|Ga0075436_100591424 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300007076|Ga0075435_101356821 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300009029|Ga0066793_10030267 | All Organisms → cellular organisms → Bacteria | 3005 | Open in IMG/M |
| 3300009029|Ga0066793_10110667 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300009089|Ga0099828_11808592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300009089|Ga0099828_11985547 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009090|Ga0099827_10974803 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009090|Ga0099827_11001000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 725 | Open in IMG/M |
| 3300009137|Ga0066709_101851852 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300009137|Ga0066709_104219125 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010335|Ga0134063_10006782 | All Organisms → cellular organisms → Bacteria | 4330 | Open in IMG/M |
| 3300010358|Ga0126370_11297778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 682 | Open in IMG/M |
| 3300010358|Ga0126370_12061144 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010361|Ga0126378_11482661 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300010880|Ga0126350_10453007 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300011120|Ga0150983_10645086 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300011269|Ga0137392_10365572 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300011269|Ga0137392_10500295 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300012004|Ga0120134_1047374 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300012008|Ga0120174_1076235 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300012189|Ga0137388_10223045 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300012189|Ga0137388_11013393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 766 | Open in IMG/M |
| 3300012198|Ga0137364_10104240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2001 | Open in IMG/M |
| 3300012199|Ga0137383_10321918 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300012199|Ga0137383_10532451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 860 | Open in IMG/M |
| 3300012203|Ga0137399_10052192 | All Organisms → cellular organisms → Bacteria | 2977 | Open in IMG/M |
| 3300012205|Ga0137362_10589529 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300012206|Ga0137380_10860644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 780 | Open in IMG/M |
| 3300012206|Ga0137380_10866413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 777 | Open in IMG/M |
| 3300012207|Ga0137381_11271096 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012208|Ga0137376_10550506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1000 | Open in IMG/M |
| 3300012351|Ga0137386_10572000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 813 | Open in IMG/M |
| 3300012360|Ga0137375_10824509 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300012918|Ga0137396_10331091 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300012927|Ga0137416_10020568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4207 | Open in IMG/M |
| 3300012929|Ga0137404_11519956 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012971|Ga0126369_13002586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300012975|Ga0134110_10049640 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300012976|Ga0134076_10341282 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300013770|Ga0120123_1017133 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300014154|Ga0134075_10031289 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
| 3300014154|Ga0134075_10164734 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300014829|Ga0120104_1072215 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300015359|Ga0134085_10179766 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300015359|Ga0134085_10282977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 726 | Open in IMG/M |
| 3300017656|Ga0134112_10083616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1187 | Open in IMG/M |
| 3300018431|Ga0066655_10196776 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300018468|Ga0066662_12024082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
| 3300021178|Ga0210408_10627236 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300021559|Ga0210409_11062988 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300024323|Ga0247666_1116200 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300025910|Ga0207684_10366306 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300025922|Ga0207646_10135939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2213 | Open in IMG/M |
| 3300025922|Ga0207646_10259255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1571 | Open in IMG/M |
| 3300025922|Ga0207646_10343187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1349 | Open in IMG/M |
| 3300025928|Ga0207700_11761196 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300025929|Ga0207664_10389360 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300026296|Ga0209235_1014695 | All Organisms → cellular organisms → Bacteria | 4283 | Open in IMG/M |
| 3300026298|Ga0209236_1182068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 826 | Open in IMG/M |
| 3300026307|Ga0209469_1041200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1495 | Open in IMG/M |
| 3300026307|Ga0209469_1119559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 654 | Open in IMG/M |
| 3300026309|Ga0209055_1232835 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300026313|Ga0209761_1340450 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026318|Ga0209471_1032634 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
| 3300026330|Ga0209473_1075222 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300026523|Ga0209808_1113459 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300026527|Ga0209059_1314759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300026536|Ga0209058_1236030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 662 | Open in IMG/M |
| 3300027587|Ga0209220_1168672 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027635|Ga0209625_1017141 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300027655|Ga0209388_1015851 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300027655|Ga0209388_1175010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300027725|Ga0209178_1125000 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300027857|Ga0209166_10280208 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300027862|Ga0209701_10363965 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300027875|Ga0209283_10307544 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300027875|Ga0209283_10809280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300027882|Ga0209590_10350167 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300028047|Ga0209526_10670446 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300028716|Ga0307311_10272043 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300028792|Ga0307504_10116674 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300028828|Ga0307312_10429858 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300031670|Ga0307374_10084225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2894 | Open in IMG/M |
| 3300031715|Ga0307476_11064365 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031820|Ga0307473_11425048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
| 3300031962|Ga0307479_12043181 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032180|Ga0307471_100529688 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300033233|Ga0334722_10726793 | Not Available | 704 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.45% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.61% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P1_DRAFT_01147530 | 2088090004 | Soil | LKKHKSQVAKPGAEWDFEKFMRKRHRDVGKKAGYAYAESFKRIKV |
| P1_C_01133940 | 2140918006 | Soil | HKSQVSKPGRVWDFEKFMRKRHREVGKKGGYRYAESFKRITV |
| AL20A1W_12143163 | 3300000880 | Permafrost | DLKMQSLKKHKSQVAKPGAEWDYEKFMRKRHREVGKKAGYTYAESFKRIKV* |
| JGI12636J13339_10465541 | 3300001154 | Forest Soil | KPGQEWDFEKFMRKRHREVGKRGGYRYAXSFKRITV* |
| A3035W6_10157871 | 3300001359 | Permafrost | ALKKHKSQVAKPGREWDFEKFMRKRHREVGKKAGYRYAESFKRITV* |
| A1565W1_103035192 | 3300001536 | Permafrost | KKHKSQVAKPGAEWDYEKFMRKRHREVGKKAGYTYAESFKRIKV* |
| Ga0066672_106512032 | 3300005167 | Soil | TLDLKLAALKKHRSQVAKPGQEWDVDKWVRKRHRDIGKKGGYQYAESFKRIKV* |
| Ga0066683_101743203 | 3300005172 | Soil | LDRKIAALSKHKSQIAKPGREWDVAKFMRKRHRDIGKKGGYRFAESFKRITV* |
| Ga0066680_109169981 | 3300005174 | Soil | MDALKKHKSQVSKPGREWDFEKFMRKRHRDIGKRAGYQYAESFKRITV* |
| Ga0066684_101579992 | 3300005179 | Soil | ALKKHKSQVAKPGREWDYEKLLRKRHAEIGKKGGFRYAESFKRIKV* |
| Ga0066684_103500493 | 3300005179 | Soil | SQVSKPGREWDFEKFMRKRHRDVGKRGGYQYAESFKRITV* |
| Ga0066678_102414903 | 3300005181 | Soil | LRKHKSQVSKPGREWDFEKFMRKRHRDVGKRAGYQYAESFKRITV* |
| Ga0070713_1020814581 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SQVSKPGMEWDVDKWIRKRSRDIGERGGYRYAESFKRITV* |
| Ga0070708_1006371061 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SQVAKPGREWDFEKFMRKRSREIGKKAGYRYAESFKRITV* |
| Ga0066687_100599251 | 3300005454 | Soil | DRKIEALRKHKSQVAKPGREWDFEKFMRKRHRDVGKKGGYQYAESFKRITV* |
| Ga0070706_1003085271 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PTLERKIEALRKHRSQVAKPGRTWDFEKFMRKRHHDVGKKAGYKYAESFKRITV* |
| Ga0070707_1021905751 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SQVAKPGNEWDIEKWIRKRSREIGKKNGYRYAESFKRIKV* |
| Ga0070698_1001107471 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SQVAKPGREWDIEKWMRKRHRDVGRRGGYRYAESFKRITV* |
| Ga0070698_1005692893 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | HKSQVAKPGREWDFEKFMRKRSREIGKKAGYRYAESFKRITV* |
| Ga0070699_1017537921 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KSQVAKPGQEWDIDKWVRKRHRDIGKKGGYRYAESFKRIKV* |
| Ga0070697_1010614441 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ALRKHKSQVAKPGREWDFEKFMRKRHGEVGKRGGYKYAESFKRITV* |
| Ga0070697_1014392032 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EALRKHKSQIAKPGREWDFEKFMRKRHRDVGKRAGYRFAESFKRITV* |
| Ga0066697_105676971 | 3300005540 | Soil | GREWDFEKFMRKRHRDVGKKAGYQYAESFKRITV* |
| Ga0070732_105962863 | 3300005542 | Surface Soil | KIKALHKHKSQVAKPGREWDVDKWMRKRHAEVGKRGGYRFAESFKRITV* |
| Ga0066704_103939041 | 3300005557 | Soil | LKKHKSQIAKPGQEWDFEKFMRKRHREIGKKAGFRYAESFKRITV* |
| Ga0066693_101965412 | 3300005566 | Soil | RKIEALRKHKSQVSKPGREWDFEKFMRKRHRDVGKRAGYQYAESFKRITV* |
| Ga0066703_101736001 | 3300005568 | Soil | LKLAALKKHKSQVAKPGQEWDVDKWIRKRHRDIGKKGGYTYAESFKRIKV* |
| Ga0066705_104764422 | 3300005569 | Soil | TPTLEKKIEALRKHKSQIAKPGREWDFEKFMRKRHRDVGKRGGYQYAESFKRITV* |
| Ga0066702_103499392 | 3300005575 | Soil | KHKSQVAKPGREWDFEKFMRKRHRDVGKKGGYQYAESFKRITV* |
| Ga0066702_109365292 | 3300005575 | Soil | QVAKPGQEWDVDKWMRKRHRDIGKKGGYTYAESFKRITV* |
| Ga0066654_106353872 | 3300005587 | Soil | GREWDYEKLLRKRHAEIGKKGGFRYAESFKRIKV* |
| Ga0066696_100489231 | 3300006032 | Soil | PGREWDVEKFMRKRHRDVGKKGGYQYAESFKRITV* |
| Ga0075014_1010269112 | 3300006174 | Watersheds | KPGQEWDFEKFMRKRHADVGKRGGFRYGESFKRIKV* |
| Ga0079222_126574591 | 3300006755 | Agricultural Soil | KSQIAKPGREWDFEKFMRKRHRDVGKRAGYRFAESFKRITV* |
| Ga0075425_1015919772 | 3300006854 | Populus Rhizosphere | SQVAKPGREWDFEKFMRKRHRDVGKKAGYQYAESFKRITV* |
| Ga0075426_107056941 | 3300006903 | Populus Rhizosphere | LVDITPTLDRKIEALSKHKSQIAKPGREWDVAKFMRKRHRDIGKKGGYRFAESFKRITV* |
| Ga0075436_1005914242 | 3300006914 | Populus Rhizosphere | DLKLAALKKHKSQVAKPGREWDYEKMLRKRHAQIGKKGGFRYAESFKRIKV* |
| Ga0075435_1013568212 | 3300007076 | Populus Rhizosphere | LKKHKSQVSKPGNEWDVEKWIRKRSRDIGKKGGYRYAESFKRIKV* |
| Ga0066793_100302676 | 3300009029 | Prmafrost Soil | STLDLKIAALREHKSQVSKPGRVWDFEKFMRKRHREVGKRGGYRYAESFKRITV* |
| Ga0066793_101106671 | 3300009029 | Prmafrost Soil | MQSLKKHKSQLAKPGAEWDFEKFMRKRHRDVGKKAGYMYAESFKRIKV* |
| Ga0099828_118085921 | 3300009089 | Vadose Zone Soil | LAALHKHKSQVAKPGQEWDIDKWVRKRHRDIGKKGGYQYAESFKRIKV* |
| Ga0099828_119855471 | 3300009089 | Vadose Zone Soil | PGREWDFEKFMRKRHREVGKKAGYRYAESFKRITV* |
| Ga0099827_109748031 | 3300009090 | Vadose Zone Soil | DQKIAALHKHKSQVAKPGNEWDIDKWIRKRHREVGKKAGYRYAESFKRITV* |
| Ga0099827_110010002 | 3300009090 | Vadose Zone Soil | AKPGQEWDIDKWVRKRHRDIGKKGGYQYAESFKRIKV* |
| Ga0066709_1018518522 | 3300009137 | Grasslands Soil | AKPDREWDFEKFMRKRHREIGKKAGFRYAESFKRITV* |
| Ga0066709_1042191251 | 3300009137 | Grasslands Soil | AAVKKHKSQVAKPGREWDYEKLLRKRPPEIGNKGGFRYAESFKRIKV* |
| Ga0134063_100067823 | 3300010335 | Grasslands Soil | VSKPGREWDFEKFMRKRHRDVGKRGGYQYAESFKRITV* |
| Ga0126370_112977782 | 3300010358 | Tropical Forest Soil | LHKHQSQVAKPGQEWNFEKFMRKRSSDIGKKAGYKYAESFKRIKV* |
| Ga0126370_120611441 | 3300010358 | Tropical Forest Soil | IEALRKHKSQVAKPGQEWDFEKWMRKRGRDIGKKAGYQYAESFKRIKV* |
| Ga0126378_114826611 | 3300010361 | Tropical Forest Soil | KSQVAKPGQEWDFEKWMRKRGRDIGKKAGYQYAESFKRIKV* |
| Ga0126350_104530071 | 3300010880 | Boreal Forest Soil | HKSQVAKPGNEWDYEKMLRKRHAEIGKKGGFKYAESFKRLTV* |
| Ga0150983_106450861 | 3300011120 | Forest Soil | KSQVAKPGREWDFEKFMRKRHREVGKKAGYRYAESFKRITV* |
| Ga0137392_103655723 | 3300011269 | Vadose Zone Soil | PTFDLKMEALKKHKSQVAKPGREWDFEKFLRKRSREIGKKAGYRYAESFKRITV* |
| Ga0137392_105002951 | 3300011269 | Vadose Zone Soil | LRKHKSQVAKPGQEWDFEKFMRKRLREVGKKAGYRYAESFKRITV* |
| Ga0120134_10473741 | 3300012004 | Permafrost | RKPKSQVAKPGREWDFEKFMRKRHGEVGKKAGYRYAESFKRITV* |
| Ga0120174_10762351 | 3300012008 | Permafrost | AKPGAEWDFEKFMRKRHRDVGKKAGYAYAESFKRIKV* |
| Ga0137388_102230453 | 3300012189 | Vadose Zone Soil | AKPGQEWDFEKFMRKRHREVGKKAGYRYAESFKRITV* |
| Ga0137388_110133931 | 3300012189 | Vadose Zone Soil | DRKIEALRKHKSQVSKPGRTWDFEKFMRKRHRDVGKKAGYQYAESFKRITV* |
| Ga0137364_101042401 | 3300012198 | Vadose Zone Soil | KSQLAKPGREWDVEKFMRKRHRDVGKKGGYQYAESFKRITV* |
| Ga0137383_103219181 | 3300012199 | Vadose Zone Soil | ALKKHKSQIAKPGQEWDFEKFMRKRHREIGKKAGFRYAESFKRITV* |
| Ga0137383_105324511 | 3300012199 | Vadose Zone Soil | QEVDRVHITPTLDRKIEALRKHKSQLAKPGREWDVEKFMRKRHRDVGKKGGYQYAESFKRITV* |
| Ga0137399_100521921 | 3300012203 | Vadose Zone Soil | KSQVSKPGREWDFEKFMRKRHGEVGKRGGYKYAESFKRITV* |
| Ga0137362_105895291 | 3300012205 | Vadose Zone Soil | KTLDLKLAALHKHKSQVAKPGQEWDIDKWVRKRHRDIGKKGGFQYAESFKRIKV* |
| Ga0137380_108606441 | 3300012206 | Vadose Zone Soil | LKLAALKKHKSQVAKPGQEWDVDKWVRKRHRDIGKKGGYQYAESFKRIKV* |
| Ga0137380_108664131 | 3300012206 | Vadose Zone Soil | QVAKPGQEWDVDKWVRKRHRDIGKKGGYQYAESFKRIKV* |
| Ga0137381_112710962 | 3300012207 | Vadose Zone Soil | LKKHKSQVAKPGREWDFEKFMRKRHREVGKKAGYTYAESFKRIKV* |
| Ga0137376_105505063 | 3300012208 | Vadose Zone Soil | EALRKHKSQLAKPGREWDVEKFMRKRHRDVGKKGGYQYAESFKRITV* |
| Ga0137386_105720001 | 3300012351 | Vadose Zone Soil | KPGQEWDVDKWVRKRHRDIGKKGGYQYAESFKRIKV* |
| Ga0137375_108245091 | 3300012360 | Vadose Zone Soil | KKHKSQVAQPGREWDIEKWMRKRHRQVGKKGGFRYAESFKRITV* |
| Ga0137396_103310911 | 3300012918 | Vadose Zone Soil | ALKKHKSQIAKPGREWDFEKFMRKRHREIGKKAGFRYAESFKRITV* |
| Ga0137416_100205681 | 3300012927 | Vadose Zone Soil | SSTLDQKITALRKHKSQVSKPGREWDFEKFMRKRHGEVGKRGGYKYAESFKRITV* |
| Ga0137404_115199561 | 3300012929 | Vadose Zone Soil | KHKSQVSKPGQEWDFEKFMRKRHREVGKKGGYRYAESFKRITV* |
| Ga0126369_130025861 | 3300012971 | Tropical Forest Soil | TLDLKLEALKKHKSQVSKPGMEWDVDKWVRKRHRDIGKKGGYRYAESFKRITV* |
| Ga0134110_100496401 | 3300012975 | Grasslands Soil | KPGQEWDVDKWIRKRHRDIGKKSGYTYAESFKRIKV* |
| Ga0134076_103412821 | 3300012976 | Grasslands Soil | LKFEALKKHKSQVAKPGQEWDYEKFMRKRHRDLGKKAGFRYAEAFNRITV* |
| Ga0120123_10171331 | 3300013770 | Permafrost | MQSWKKHKSQVAKPGAEWDYEKFMRKRHREVGKKAGYTYAESFKRIKV* |
| Ga0134075_100312891 | 3300014154 | Grasslands Soil | PGREWDFEKFMRKRHRDVGKKAGYQYAESFKRITV* |
| Ga0134075_101647341 | 3300014154 | Grasslands Soil | DLKLAALHKHKSQVAKPGQEWDIDKWVRKRHRDIGKKGGYQYAESFKRIKV* |
| Ga0120104_10722151 | 3300014829 | Permafrost | SKPGQVWDFEKFMRKRHREVGKKGGYRYAESFKRITV* |
| Ga0134085_101797663 | 3300015359 | Grasslands Soil | AKPGREWDFEKFMRKRHRDVGKKAGYQYAESFKRITV* |
| Ga0134085_102829771 | 3300015359 | Grasslands Soil | IEALRKHKSQVSKPGREWDFEKFMRKRHRDVGKKGGYQYAESFKRITV* |
| Ga0134112_100836161 | 3300017656 | Grasslands Soil | LRKHKSQLAKPGREWDVEKFMRKRHRDVGKKGGYQYAESFKRITV |
| Ga0066655_101967761 | 3300018431 | Grasslands Soil | KSQVSKPGREWDFEKFMRKRHRDVGKKGGYQYAESFKRITV |
| Ga0066662_120240822 | 3300018468 | Grasslands Soil | YLVDITPTLDRKVEALRKHKSQGSKPGREWDFEKFMRRRHRDVGKRGGYQYAESFKRITV |
| Ga0210408_106272362 | 3300021178 | Soil | KMQALKKHKSQVAKPGQEWDFEKFMRRRHREVGKKAGYTYAESFKRIKV |
| Ga0210409_110629883 | 3300021559 | Soil | LKKHKSQVAKPGREWDFEKFMRKRHREVGKKAGYRYAESFKRITV |
| Ga0247666_11162002 | 3300024323 | Soil | HKSQIAKPGREWDFEKFMRKRHREVGKRGGFRYAESFKRITV |
| Ga0207684_103663063 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VAKPGREWDFEKFMRKRHRDVGKKAGYQYAESFKRITV |
| Ga0207646_101359391 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TPTLDRKIEALRKHRSQVAKPGQEWDFERFMRKRHRDVGRKAGYRYAESFKRITV |
| Ga0207646_102592551 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KHKSQIAKPGRVWDFEKFMRKRHRDVGKRAGYRFAESFKRITV |
| Ga0207646_103431874 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ALRKHKSQIAKPGRVWDFEKFMRKRHRDVGKRAGYRFAESFKRITV |
| Ga0207700_117611961 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | QVAKPGREWDYEKMLRKRHAQIGKKGGFKYAESFKRIKV |
| Ga0207664_103893604 | 3300025929 | Agricultural Soil | FAALKKHKSQVAKPGREWDYEKVLRKRHAEIGKKGGFRYAESFKRIKV |
| Ga0209235_10146951 | 3300026296 | Grasslands Soil | GDITPTLDRKIEALRKHKSQLAKPGREWDVEKFMRKRHRDVGKKGGYQYAESFKRITV |
| Ga0209236_11820682 | 3300026298 | Grasslands Soil | STLDRKMDALKKHKSQVSKPGREWDFEKFMRKRHRDIGKRAGYQYAESFKRITV |
| Ga0209469_10412002 | 3300026307 | Soil | ITPTLDRKIEALRKHKSQLAKPGREWDVEKFMRKRHRDVGKKGGYQYAESFKRITV |
| Ga0209469_11195591 | 3300026307 | Soil | KTLELKLAALKKHKSQVAKPGQEWDVDKWVRKRHRDIGKKGGYQYAESFKRIKV |
| Ga0209055_12328352 | 3300026309 | Soil | TLDRKIEALRKHKSQVSKPGREWDFEKFMRKRHRDVGKRAGYQYAESFKRITV |
| Ga0209761_13404501 | 3300026313 | Grasslands Soil | ITPTLERKIEALRKHKSQLAKPGREWDVEKFMRKRHRDVGKKGGYQYAESFKRITV |
| Ga0209471_10326341 | 3300026318 | Soil | KHKSQVSKPGREWDFEKFMRKRHRDVGKRAGYQYAESFKRITV |
| Ga0209473_10752221 | 3300026330 | Soil | TLDRKMDALKKHKSQVSKPGREWDFEKFMRKRHRDIGKRAGYQYAESFKRITV |
| Ga0209808_11134593 | 3300026523 | Soil | SKTLDLKLAALKKHRSQVAKPGQEWDVDKWVRKRHRDIGKKGGYQYAESFKRIKV |
| Ga0209059_13147591 | 3300026527 | Soil | QVAKPGQEWDVDKWMRKRHRDIGKKGGYTYAESFKRITV |
| Ga0209058_12360301 | 3300026536 | Soil | CKHKSHVSKPGREWDFEKFMRKRHRDVGKKGGYQYAESFKRITV |
| Ga0209220_11686722 | 3300027587 | Forest Soil | KIAALKKHKSQVAKPGRTWDFEKFMRKRHREVGKKAGYKYAESFKRITV |
| Ga0209625_10171411 | 3300027635 | Forest Soil | RDKIAALKKHKSQVAKPGQAWDFEKFMRKRHGEVGKKGGYRYAESFKRITV |
| Ga0209388_10158513 | 3300027655 | Vadose Zone Soil | PGQEWDFEKFMRKRHREVGKKAGYRYAESFKRITV |
| Ga0209388_11750102 | 3300027655 | Vadose Zone Soil | LHKHKSQVAKPGQEWDIDKWVRKRHRDIGKKGGFQYAESFKRIKV |
| Ga0209178_11250001 | 3300027725 | Agricultural Soil | LDKKFEALRKHKSQIAKPGREWDFEKFMRKRHRDVGKRAGYRFAESFKRITV |
| Ga0209166_102802081 | 3300027857 | Surface Soil | KLTALKKHKSQVAKPGAEWDVDKWIRKRSRDIGKKGGYRYAESFKRIKV |
| Ga0209701_103639652 | 3300027862 | Vadose Zone Soil | KTLDRKIDALKKHKSQVSKPGRTWDFEKFMRKRHRDIGKKAGYQYAESFKRITV |
| Ga0209283_103075443 | 3300027875 | Vadose Zone Soil | HKSQVAKPGREWDFEKFMRKRHREVGKKAGYRYAESFKRITV |
| Ga0209283_108092801 | 3300027875 | Vadose Zone Soil | LHKHKSQVAKPGQEWDIDKWVRKRHRDIGKKGGYQYAESFKRIKV |
| Ga0209590_103501672 | 3300027882 | Vadose Zone Soil | KIAALHKHKSQVAKPGNEWDIDKWIRKRHREVGKKAGYRYAESFKRITV |
| Ga0209526_106704462 | 3300028047 | Forest Soil | KPGREWDFEKFMRKRHREVGKKAGFRYAESFKRITI |
| Ga0307311_102720431 | 3300028716 | Soil | ISSTLDLKMDALKKHKSQVAKPGREWNYEKFMRKRHRDLGKKAGYAYAESFKSIKV |
| Ga0307504_101166743 | 3300028792 | Soil | HKSQVAKPGQEWDIDKWVRKRHRDIGKKGGYQYAESFKRIKV |
| Ga0307312_104298581 | 3300028828 | Soil | STLDQKITALRKHRSQVSKPGREWDFEKFMRKRHGEVGKRGGYKYAESFKRITV |
| Ga0307374_100842256 | 3300031670 | Soil | DRKIQALRKHKSQVAKPGREWDFEKFMRKRHSEVGKRGGYRYAESFKRITV |
| Ga0307476_110643652 | 3300031715 | Hardwood Forest Soil | KPGREWDFEKFMRKRHREVGKKAGYRYAESFKRITV |
| Ga0307473_114250482 | 3300031820 | Hardwood Forest Soil | EALRKHKSQVSKPGREWDLEKFMRKRHRDVGKKGGYQYAESFKRITV |
| Ga0307479_120431812 | 3300031962 | Hardwood Forest Soil | LDKKIEALRKHKSQIAKPGREWDFEKFMRKRHRDVGKRGGYRYAESFKRITV |
| Ga0307471_1005296883 | 3300032180 | Hardwood Forest Soil | LDKKMESLKKHKSQVAKPGQEWNFEKFMRKRHREVGKKAGYTYAESFKRIKV |
| Ga0334722_107267932 | 3300033233 | Sediment | SQVAKPGRVWDFEKFMRKRHADIGKRAGYRFAESFKRLTV |
| ⦗Top⦘ |