


| Basic Information | |
|---|---|
| Family ID | F069485 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MASGLRVPHKQAAHMAAPTEGQNIKKALANGEPSTHGAKRTLG |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.29 % |
| % of genes near scaffold ends (potentially truncated) | 56.45 % |
| % of genes from short scaffolds (< 2000 bps) | 86.29 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.710 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (10.484 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.387 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.387 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 0.00% Coil/Unstructured: 95.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 63.71 |
| PF00589 | Phage_integrase | 1.61 |
| PF02534 | T4SS-DNA_transf | 1.61 |
| PF07568 | HisKA_2 | 0.81 |
| PF01145 | Band_7 | 0.81 |
| PF05598 | DUF772 | 0.81 |
| PF00765 | Autoind_synth | 0.81 |
| PF07364 | DUF1485 | 0.81 |
| PF05901 | Excalibur | 0.81 |
| PF07995 | GSDH | 0.81 |
| PF00813 | FliP | 0.81 |
| PF13546 | DDE_5 | 0.81 |
| PF07589 | PEP-CTERM | 0.81 |
| PF02321 | OEP | 0.81 |
| PF02133 | Transp_cyt_pur | 0.81 |
| PF00246 | Peptidase_M14 | 0.81 |
| PF01548 | DEDD_Tnp_IS110 | 0.81 |
| PF07310 | PAS_5 | 0.81 |
| PF07519 | Tannase | 0.81 |
| PF12412 | DUF3667 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 64.52 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.61 |
| COG3505 | Type IV secretory pathway, VirD4 component, TraG/TraD family ATPase | Intracellular trafficking, secretion, and vesicular transport [U] | 1.61 |
| COG3916 | N-acyl-homoserine lactone synthase LasI (autoinducer biosynthesis) | Signal transduction mechanisms [T] | 1.61 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.81 |
| COG5388 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
| COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.71 % |
| All Organisms | root | All Organisms | 36.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001372|YBBDRAFT_1066121 | Not Available | 586 | Open in IMG/M |
| 3300001414|JGI20174J14864_1002675 | Not Available | 973 | Open in IMG/M |
| 3300001664|P5cmW16_1066908 | Not Available | 591 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101529256 | Not Available | 563 | Open in IMG/M |
| 3300003369|JGI24140J50213_10054873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium medicae | 1402 | Open in IMG/M |
| 3300004003|Ga0055445_10214044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300004082|Ga0062384_101482747 | Not Available | 502 | Open in IMG/M |
| 3300005541|Ga0070733_10383774 | Not Available | 934 | Open in IMG/M |
| 3300005543|Ga0070672_100256874 | Not Available | 1473 | Open in IMG/M |
| 3300005591|Ga0070761_11118854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → Phenylobacterium zucineum | 501 | Open in IMG/M |
| 3300005602|Ga0070762_10313513 | Not Available | 991 | Open in IMG/M |
| 3300005610|Ga0070763_10095758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → unclassified Rhizobiaceae → Rhizobiaceae bacterium | 1490 | Open in IMG/M |
| 3300005900|Ga0075272_1068374 | Not Available | 665 | Open in IMG/M |
| 3300005921|Ga0070766_10866526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300005921|Ga0070766_11083643 | Not Available | 553 | Open in IMG/M |
| 3300005944|Ga0066788_10021383 | Not Available | 1432 | Open in IMG/M |
| 3300005949|Ga0066791_10017118 | Not Available | 1487 | Open in IMG/M |
| 3300006174|Ga0075014_100854476 | Not Available | 542 | Open in IMG/M |
| 3300006174|Ga0075014_101023604 | Not Available | 502 | Open in IMG/M |
| 3300006176|Ga0070765_100769983 | Not Available | 909 | Open in IMG/M |
| 3300006176|Ga0070765_101620088 | Not Available | 608 | Open in IMG/M |
| 3300006638|Ga0075522_10105946 | Not Available | 1515 | Open in IMG/M |
| 3300006638|Ga0075522_10308568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300009137|Ga0066709_104142548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300009175|Ga0073936_10053386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3709 | Open in IMG/M |
| 3300009175|Ga0073936_10126644 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300009628|Ga0116125_1062386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas nasdae | 961 | Open in IMG/M |
| 3300009635|Ga0116117_1014762 | Not Available | 1993 | Open in IMG/M |
| 3300009650|Ga0105857_1062917 | Not Available | 976 | Open in IMG/M |
| 3300009651|Ga0105859_1008647 | All Organisms → cellular organisms → Bacteria | 2636 | Open in IMG/M |
| 3300009662|Ga0105856_1039002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → Defluviicoccus vanus | 1336 | Open in IMG/M |
| 3300010343|Ga0074044_10150382 | Not Available | 1558 | Open in IMG/M |
| 3300010396|Ga0134126_10000221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 74263 | Open in IMG/M |
| 3300012008|Ga0120174_1045134 | Not Available | 1241 | Open in IMG/M |
| 3300012990|Ga0159060_1038270 | Not Available | 1247 | Open in IMG/M |
| 3300012990|Ga0159060_1046950 | Not Available | 1125 | Open in IMG/M |
| 3300014168|Ga0181534_10371496 | Not Available | 785 | Open in IMG/M |
| 3300014495|Ga0182015_10053223 | Not Available | 2949 | Open in IMG/M |
| 3300014501|Ga0182024_10011942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17310 | Open in IMG/M |
| 3300014501|Ga0182024_10094776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4375 | Open in IMG/M |
| 3300014501|Ga0182024_10181455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2907 | Open in IMG/M |
| 3300014501|Ga0182024_10336796 | Not Available | 1977 | Open in IMG/M |
| 3300014501|Ga0182024_10525773 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300014501|Ga0182024_10754352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300014657|Ga0181522_10289838 | Not Available | 971 | Open in IMG/M |
| 3300015167|Ga0167661_1058660 | Not Available | 718 | Open in IMG/M |
| 3300015190|Ga0167651_1032740 | Not Available | 1123 | Open in IMG/M |
| 3300015194|Ga0167666_1028555 | Not Available | 1481 | Open in IMG/M |
| 3300015195|Ga0167658_1115326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
| 3300018034|Ga0187863_10099197 | Not Available | 1633 | Open in IMG/M |
| 3300018034|Ga0187863_10129924 | Not Available | 1407 | Open in IMG/M |
| 3300018037|Ga0187883_10090226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium medicae | 1598 | Open in IMG/M |
| 3300018038|Ga0187855_10143985 | Not Available | 1424 | Open in IMG/M |
| 3300018043|Ga0187887_10639803 | Not Available | 628 | Open in IMG/M |
| 3300018047|Ga0187859_10296620 | Not Available | 874 | Open in IMG/M |
| 3300020027|Ga0193752_1092027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1251 | Open in IMG/M |
| 3300020583|Ga0210401_10329730 | Not Available | 1387 | Open in IMG/M |
| 3300021404|Ga0210389_11485851 | Not Available | 515 | Open in IMG/M |
| 3300021407|Ga0210383_10075072 | All Organisms → cellular organisms → Bacteria | 2827 | Open in IMG/M |
| 3300021433|Ga0210391_10230360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → unclassified Rhizobiaceae → Rhizobiaceae bacterium | 1455 | Open in IMG/M |
| 3300021475|Ga0210392_10114074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1799 | Open in IMG/M |
| 3300021475|Ga0210392_10206795 | Not Available | 1372 | Open in IMG/M |
| 3300021475|Ga0210392_10815154 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300021479|Ga0210410_10998243 | Not Available | 726 | Open in IMG/M |
| 3300021976|Ga0193742_1080184 | Not Available | 1227 | Open in IMG/M |
| 3300022555|Ga0212088_10022492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8311 | Open in IMG/M |
| 3300022555|Ga0212088_10032043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6326 | Open in IMG/M |
| 3300025304|Ga0209257_1118329 | Not Available | 623 | Open in IMG/M |
| 3300025406|Ga0208035_1053343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 624 | Open in IMG/M |
| 3300025457|Ga0208850_1060546 | Not Available | 621 | Open in IMG/M |
| 3300025482|Ga0208715_1016090 | Not Available | 1460 | Open in IMG/M |
| 3300025494|Ga0207928_1018238 | Not Available | 1364 | Open in IMG/M |
| 3300025504|Ga0208356_1050824 | Not Available | 826 | Open in IMG/M |
| 3300025509|Ga0208848_1010919 | Not Available | 1902 | Open in IMG/M |
| 3300025544|Ga0208078_1023696 | Not Available | 1378 | Open in IMG/M |
| 3300025627|Ga0208220_1038996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1437 | Open in IMG/M |
| 3300025634|Ga0208589_1031153 | Not Available | 1449 | Open in IMG/M |
| 3300025878|Ga0209584_10057719 | Not Available | 1387 | Open in IMG/M |
| 3300025931|Ga0207644_10195040 | Not Available | 1594 | Open in IMG/M |
| 3300025940|Ga0207691_10397906 | Not Available | 1175 | Open in IMG/M |
| 3300026216|Ga0209903_1013232 | Not Available | 1445 | Open in IMG/M |
| 3300026220|Ga0209855_1062089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300026222|Ga0209862_1044232 | Not Available | 822 | Open in IMG/M |
| 3300026274|Ga0209888_1080233 | Not Available | 589 | Open in IMG/M |
| 3300026276|Ga0209847_1027765 | Not Available | 1167 | Open in IMG/M |
| 3300026281|Ga0209863_10172061 | Not Available | 631 | Open in IMG/M |
| 3300027031|Ga0208986_1035500 | Not Available | 540 | Open in IMG/M |
| 3300027567|Ga0209115_1025786 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300027692|Ga0209530_1208031 | Not Available | 538 | Open in IMG/M |
| 3300027803|Ga0209910_10033009 | Not Available | 567 | Open in IMG/M |
| 3300028379|Ga0268266_10313625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1466 | Open in IMG/M |
| 3300028577|Ga0265318_10013809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3402 | Open in IMG/M |
| 3300028779|Ga0302266_10067694 | Not Available | 1534 | Open in IMG/M |
| 3300028909|Ga0302200_10333623 | Not Available | 719 | Open in IMG/M |
| 3300029903|Ga0247271_104029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2848 | Open in IMG/M |
| 3300029922|Ga0311363_10174569 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
| 3300029922|Ga0311363_10214019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2311 | Open in IMG/M |
| 3300030041|Ga0302274_10069940 | Not Available | 1977 | Open in IMG/M |
| 3300030045|Ga0302282_1262271 | Not Available | 635 | Open in IMG/M |
| 3300030842|Ga0075404_11362904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300031128|Ga0170823_13345328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 937 | Open in IMG/M |
| 3300031231|Ga0170824_104606714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3420 | Open in IMG/M |
| 3300031231|Ga0170824_105766753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 522 | Open in IMG/M |
| 3300031231|Ga0170824_125529913 | Not Available | 985 | Open in IMG/M |
| 3300031240|Ga0265320_10090793 | Not Available | 1415 | Open in IMG/M |
| 3300031250|Ga0265331_10036730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2404 | Open in IMG/M |
| 3300031446|Ga0170820_12097894 | Not Available | 1369 | Open in IMG/M |
| 3300031474|Ga0170818_111056684 | Not Available | 545 | Open in IMG/M |
| 3300031525|Ga0302326_12713790 | Not Available | 615 | Open in IMG/M |
| 3300031595|Ga0265313_10077060 | Not Available | 1522 | Open in IMG/M |
| 3300031616|Ga0307508_10645902 | Not Available | 663 | Open in IMG/M |
| 3300031715|Ga0307476_10968460 | Not Available | 627 | Open in IMG/M |
| 3300031718|Ga0307474_10516113 | Not Available | 938 | Open in IMG/M |
| 3300031718|Ga0307474_11201896 | Not Available | 599 | Open in IMG/M |
| 3300031823|Ga0307478_10252850 | Not Available | 1432 | Open in IMG/M |
| 3300031884|Ga0316220_1217451 | Not Available | 654 | Open in IMG/M |
| 3300032061|Ga0315540_10094143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1381 | Open in IMG/M |
| 3300032133|Ga0316583_10055884 | Not Available | 1387 | Open in IMG/M |
| 3300032560|Ga0316223_1120403 | Not Available | 904 | Open in IMG/M |
| 3300032561|Ga0316222_1319532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 504 | Open in IMG/M |
| 3300032562|Ga0316226_1148103 | Not Available | 1032 | Open in IMG/M |
| 3300032722|Ga0316231_1394094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 515 | Open in IMG/M |
| 3300032954|Ga0335083_11211659 | Not Available | 585 | Open in IMG/M |
| 3300033475|Ga0310811_10002976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 21277 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.26% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.84% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 4.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 4.03% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 3.23% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.23% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.23% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.42% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.42% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.81% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.81% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.81% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 0.81% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300001414 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300004003 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015194 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout) | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026216 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes) | Environmental | Open in IMG/M |
| 3300026220 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes) | Environmental | Open in IMG/M |
| 3300026222 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes) | Environmental | Open in IMG/M |
| 3300026274 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 (SPAdes) | Environmental | Open in IMG/M |
| 3300026276 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030842 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Host-Associated | Open in IMG/M |
| 3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| YBBDRAFT_10661211 | 3300001372 | Marine Estuarine | MASGLCVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRTLGGPDMN |
| JGI20174J14864_10026751 | 3300001414 | Arctic Peat Soil | MASGLCVPHQQAAHMAAPTEGQNIKNTLANGEPSTHGA |
| P5cmW16_10669082 | 3300001664 | Permafrost | MASGLCVPHQQAAHMAAPTEDSIKNTLANGEPSTHGAKRT |
| JGIcombinedJ26739_1015292562 | 3300002245 | Forest Soil | MASGRCVPHKQAAHMAAPTEGQNIKKTLANGEPSTHDPK |
| JGI24140J50213_100548731 | 3300003369 | Arctic Peat Soil | MASGLCVPHKQAAHMAAPTEGQKIKKALAKGEPSTHGAKXTL |
| Ga0055445_102140441 | 3300004003 | Natural And Restored Wetlands | ASGRRVPHQQVEHMAAPTDAQCFKKALANGEPSTHGASPTCAAR* |
| Ga0062384_1014827471 | 3300004082 | Bog Forest Soil | MASGLCVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKQSWPSSI* |
| Ga0070733_103837741 | 3300005541 | Surface Soil | MASGQRVPHKQAAHMAAPTEGQIIKKALANGEPSTHGAKQTLVDVCF* |
| Ga0070672_1002568741 | 3300005543 | Miscanthus Rhizosphere | VLLIGTVLAEGIMASGFCVPQQQAAHMAAPTEGQNIRKPLANGEPSTHDPKR |
| Ga0070761_111188542 | 3300005591 | Soil | MASGLRVPHKQAEHMAAPTEAQSINKTLANGEPSTHGA* |
| Ga0070762_103135132 | 3300005602 | Soil | MASGLCVPHQQAAHMAAPTEGQNIKKDLANGEPSTHGAKRTLAE* |
| Ga0070763_100957581 | 3300005610 | Soil | MASGLCVPHQQAAHMAAPTEGQNIKKDLANGEPSTHGAKRTFKLRG* |
| Ga0075272_10683742 | 3300005900 | Rice Paddy Soil | MASGLRVPHKQAAHMAAPTEGQSIKKALANGEPSTHGAKRTIKTDLE* |
| Ga0070766_108665262 | 3300005921 | Soil | MASGLCVPHQQAAHMAAPTEGQNIKKDLANGEPSTHGAKQTFRCRRRESR* |
| Ga0070766_110836432 | 3300005921 | Soil | MASGLCVPHKQAAHMAAPTEGQNIKKTLANGEPST |
| Ga0066788_100213831 | 3300005944 | Soil | MASGLRVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGA |
| Ga0066791_100171182 | 3300005949 | Soil | MASGLCVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRTLASGCACAQRSARAR |
| Ga0075014_1008544761 | 3300006174 | Watersheds | MASGLYVPHKQAAHMAAPTEAQNIKNALANGEPSTHGA |
| Ga0075014_1010236042 | 3300006174 | Watersheds | MASGLCVPHKQAAHMAAPTEAQNIKNALANGEPSTHGAKRT |
| Ga0070765_1007699832 | 3300006176 | Soil | MASGQCVPHQQAAHMAAPTEGQNIKKDLANGEPSTHGAKR |
| Ga0070765_1016200882 | 3300006176 | Soil | MASGLCVPHQQAAHMAAPTEGQNIKKDLANGEPSTHGAKR |
| Ga0075522_101059462 | 3300006638 | Arctic Peat Soil | MASGLCVPHKQAAHMAAPTEGQNIKKALANGEPSTHGAKRTLGGSGSNVRL* |
| Ga0075522_103085682 | 3300006638 | Arctic Peat Soil | MASGLRVPHKQAAHMAAPTEGQNIKKALANGEPSTHGAKRTLG* |
| Ga0066709_1041425482 | 3300009137 | Grasslands Soil | MASGLCVPHKQAAHMAAPTEGQNIKKTLAKGEPSTHGAKRSLD* |
| Ga0073936_100533864 | 3300009175 | Freshwater Lake Hypolimnion | MASGLRVPQKQAAHMAAPTEGQNIKKALAKGEPSTHGAK |
| Ga0073936_101266445 | 3300009175 | Freshwater Lake Hypolimnion | IMASGLRVPQKQAAHMAAPTEGQNIKKALAKGEPSTHGAKRTLDR* |
| Ga0116125_10623863 | 3300009628 | Peatland | MASGQCVPHQQAAHMAAPTEGQNIKKILANGEPSTHGAKRTWAE* |
| Ga0116117_10147623 | 3300009635 | Peatland | MASGLCVPHQQAAHMAAPTEGQNIKKDLANGEPSTHGAKRTLGDRGE* |
| Ga0105857_10629172 | 3300009650 | Permafrost Soil | MASGLCVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRTLADFSELD* |
| Ga0105859_10086474 | 3300009651 | Permafrost Soil | MASGLCVPHQQAAHMAAPTEGQNINKTLANGEPSTHGA* |
| Ga0105856_10390021 | 3300009662 | Permafrost Soil | LCVPHKQAAHMAAPTEGQNINKTLANGEPSTHGA* |
| Ga0074044_101503822 | 3300010343 | Bog Forest Soil | MASGQCVPHQQAAHMAAPTEGQNIKKNLANGEPSTHGAKRTLADRDE* |
| Ga0134126_1000022161 | 3300010396 | Terrestrial Soil | MASGSRVPHQQAAHMAAPTEKAEQQKSLAKVEPSTHGGFC* |
| Ga0120174_10451342 | 3300012008 | Permafrost | MASGLCVPHKQAAHMAAPTEGQNIKKALANGEPSTHGAKQTIRLTGAE* |
| Ga0159060_10382702 | 3300012990 | Hydrocarbon Resource Environments | MASGLCVPHKQAAHMAAPTEGQNIRKALANGEPSTHGA |
| Ga0159060_10469502 | 3300012990 | Hydrocarbon Resource Environments | MASGPCVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGA |
| Ga0181534_103714962 | 3300014168 | Bog | MASGQCVPHQQAAHMAAPTEGQNIKKNLANGEPSTHGAKRTLAE* |
| Ga0182015_100532232 | 3300014495 | Palsa | MASGLCVPHQQAAHMAAPTEGLNIKKALATGEPSTHDPKRGATA* |
| Ga0182024_1001194216 | 3300014501 | Permafrost | EGIMASGLCVPHKQAAHMAAPTEGQSIKNTLANGEPSTHGA* |
| Ga0182024_100947763 | 3300014501 | Permafrost | CVPHQQAAHMAAPTEGQNIKKTLANGEPSTHGAKRTFAGLR* |
| Ga0182024_101814553 | 3300014501 | Permafrost | MASGLCVPHQQAAHMAAPTEGQNIKKAVAKGEPSTHGAERTLG* |
| Ga0182024_103367964 | 3300014501 | Permafrost | MASGLCVPHQQAAHMAAPTEGQNIKKTLANGELSTHGAKRPGRKTGSILM* |
| Ga0182024_105257732 | 3300014501 | Permafrost | MASGRCVPHKQAAHMAAPTEGHNIKKTLANGEPSTHDPKRTFPAALMSQT* |
| Ga0182024_107543521 | 3300014501 | Permafrost | GIMASGLCVPHQQAAHMAAPTEGQNIKKTLANGEPSTHGAKRTFAIRCGTAGPL* |
| Ga0181522_102898381 | 3300014657 | Bog | MASGQCVPHQQAAHMAAPTEGQNIKKNLANGEPSTHGAKRTLSE* |
| Ga0167661_10586601 | 3300015167 | Glacier Forefield Soil | MASGLRVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKRT |
| Ga0167651_10327402 | 3300015190 | Glacier Forefield Soil | MASGLCEPHKQAAHMAAPTEGQNIKKALAKGEPSTHGA |
| Ga0167666_10285552 | 3300015194 | Glacier Forefield Soil | MASGLRVPHKQAAHMAAPTEGQNINKTLAKGEPSTHGAKRTWG |
| Ga0167658_11153261 | 3300015195 | Glacier Forefield Soil | MASGLCEPHKQAAHMAAPTEGQNINKTLAKGEPSTHGAKQTLG* |
| Ga0187863_100991971 | 3300018034 | Peatland | MASGQCVPHQQAAHMAAPTEGQNIKKDLANGEPSTHGAKRTL |
| Ga0187863_101299241 | 3300018034 | Peatland | AEGIMASGLCVPHKQAAHMAAPTEGQNIKKVLANGEPSTHGA |
| Ga0187883_100902261 | 3300018037 | Peatland | MASGQCVPHQQAAHMAAPTEGQNIKKNLANGEPSTHGAKRTLSESRLPTPAA |
| Ga0187855_101439852 | 3300018038 | Peatland | MASGQCVPHQQAAHMAAPTEGQNIKKILANGEPSTHGAKRTWAE |
| Ga0187887_106398032 | 3300018043 | Peatland | MASGQCVPHQQAAHMAAPTEGQNIKKNLANGEPSTHGAKRTLAE |
| Ga0187859_102966201 | 3300018047 | Peatland | MASGQCVPHQQAAHMAAPTEGQNIKKILANGEPSTHGAKRT |
| Ga0193752_10920273 | 3300020027 | Soil | MASGHCVPHQQAAHMAAPTRRKHRIKETLAKGEPSTHDPT |
| Ga0210401_103297302 | 3300020583 | Soil | MASGLCVPHKQAAHMAAPTEGQSIKNTLANGEPSTHGAKMG |
| Ga0210389_114858512 | 3300021404 | Soil | MASGLCVPHKQAEHMAAPTEGQSIKNTLANGEPSTHGAKRTLGASGANDRF |
| Ga0210383_100750722 | 3300021407 | Soil | MASGLCVPHQQAAHMAAPTEGQNIKKALARGEPSTHDPKRTFELAGVRPFFCIL |
| Ga0210391_102303601 | 3300021433 | Soil | MASGLCVPHQQAAHMAAPTEGQNIKKDLANGEPSTHGAKRTFVQ |
| Ga0210392_101140742 | 3300021475 | Soil | MASGLCVPHQQAAHMAAPTEGQNIKNALANGEPSTHGAKQTLAK |
| Ga0210392_102067951 | 3300021475 | Soil | MASGLCVPHKQAEHMAAPTEGQSIKNTLANGEPSTHGAKRPSAG |
| Ga0210392_108151541 | 3300021475 | Soil | PTESRPHMAAPTEGQSIKNTLANGEPSTHGAKQTLGW |
| Ga0210410_109982431 | 3300021479 | Soil | MASGLCVPHQQAAHMTAPTEGQNIKKNLANGEPSTHGAKRTLGRA |
| Ga0193742_10801841 | 3300021976 | Soil | MASGLCVPHKQAAHMAAPTEGQNIKNTLANGEPSTH |
| Ga0212088_100224921 | 3300022555 | Freshwater Lake Hypolimnion | AEGIMASGLRVPQKQAAHMAAPTEGQNIKKALAKGEPSTHGVKRTFT |
| Ga0212088_100320436 | 3300022555 | Freshwater Lake Hypolimnion | MASGLRVPQKQAAHMAAPTEGQNIKKALAKGEPSTHGAKQTLGSAG |
| Ga0209257_11183291 | 3300025304 | Arabidopsis Root | MASGPCVPHQQAAHMAAPTRLKHRIKKTLAKGEPSTHDPKRAL |
| Ga0208035_10533432 | 3300025406 | Peatland | GIMASGLCVPHQQAAHMAAPTEGQNIKKNLANGEPSTHGAKRTSAE |
| Ga0208850_10605461 | 3300025457 | Arctic Peat Soil | MASGLCVPHQQAAHMATPTEGQNIKNTLANGEPSTHGAKRTLGWSGANDRF |
| Ga0208715_10160902 | 3300025482 | Arctic Peat Soil | MASGLCVPHQQAAHMAAPTEGQNIKNTLANGEPSTHGAKQTLG |
| Ga0207928_10182381 | 3300025494 | Arctic Peat Soil | MASGLCVPHQQAAHMAAPTEGQNIKNTLANGEPSTHGAK |
| Ga0208356_10508242 | 3300025504 | Arctic Peat Soil | MASGLCVPHKQAAHMAAPTEGQNIKKTVANGEPSTHGAKRTLS |
| Ga0208848_10109194 | 3300025509 | Arctic Peat Soil | MASGLCVPHQQAAHMAAPTEGQNIKNTLANGEPSTHGAKQPFGGPG |
| Ga0208078_10236961 | 3300025544 | Arctic Peat Soil | MASGLRVPHKQAAHMAAPTEGQNIKNALANGEPSTHGAKRTLGRP |
| Ga0208220_10389962 | 3300025627 | Arctic Peat Soil | MASGYCVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKQT |
| Ga0208589_10311531 | 3300025634 | Arctic Peat Soil | MASGLCVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKQT |
| Ga0209584_100577192 | 3300025878 | Arctic Peat Soil | MASGLCVPHKQAAHMAAPTEGQKIKKALAKGEPSTHGAKQTLPLLQAP |
| Ga0207644_101950401 | 3300025931 | Switchgrass Rhizosphere | MASGFCVPQQQAAHMAAPTEGQNIRKPLANGEPSTHGAKRTMT |
| Ga0207691_103979062 | 3300025940 | Miscanthus Rhizosphere | MASGFCVPQQQAAHMAAPTEGQNIKNTLANGEPSTHGAKRT |
| Ga0209903_10132321 | 3300026216 | Soil | MASGLCVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRTLAD |
| Ga0209855_10620892 | 3300026220 | Permafrost Soil | MASGLCVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRTFADAQY |
| Ga0209862_10442322 | 3300026222 | Permafrost Soil | MASGLCVPHQQAAHMAAPTEGQNIKNTLANGEPSTHGAKRTLADFSELD |
| Ga0209888_10802331 | 3300026274 | Permafrost Soil | MASGLCVPHQQAAHMAAPTEGQNIKKTLANGEPSTHGAKPTFTPNS |
| Ga0209847_10277651 | 3300026276 | Permafrost Soil | MASGLCVPHKQAAHMAAPTEGQNIKNTLANESRPHM |
| Ga0209863_101720611 | 3300026281 | Prmafrost Soil | MASGLRVPHKQAAHMAAPTEGQNIKKALANGEPSTHGAQQPLGRPGLNGRS |
| Ga0208986_10355001 | 3300027031 | Forest Soil | MASGPCVPHQQAAHMAAPTRRKHRMKETLAKGEPSTHDP |
| Ga0209115_10257862 | 3300027567 | Forest Soil | MASGLRVPHKQAEHMAAPTEGQNIKKTLANGEPSTHGAKRTLG |
| Ga0209530_12080311 | 3300027692 | Forest Soil | MASGLCVPHQQAAHMAAPTEGQNIKKDLANGEPSTH |
| Ga0209910_100330092 | 3300027803 | Thawing Permafrost | MASGLCVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGA |
| Ga0268266_103136252 | 3300028379 | Switchgrass Rhizosphere | MASGFCVPQQQAAHMAAPTEGQNIRKPLANGEPST |
| Ga0265318_100138091 | 3300028577 | Rhizosphere | MASGHRVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKRTLG |
| Ga0302266_100676942 | 3300028779 | Bog | MASGLCVPHKQAAHMAATTEGQNIKKALAKGEPSTHGATRTFPTIRLKAS |
| Ga0302200_103336232 | 3300028909 | Bog | MASGLCVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKRTLD |
| Ga0247271_1040291 | 3300029903 | Soil | MASGLCVPHQQAAHMAAPTEGQNIKKALANGEPST |
| Ga0311363_101745693 | 3300029922 | Fen | MASGHRVPHQQAAHMAAPTEGQNINKTLANGEPST |
| Ga0311363_102140191 | 3300029922 | Fen | VPHKQAAHMAATTEGQNIKKALAKGEPSTHGATRTLG |
| Ga0302274_100699402 | 3300030041 | Bog | MASGLCVPHKQAAHMAATTEGQNIKKALAKGEPSTHGAKQPLR |
| Ga0302282_12622712 | 3300030045 | Fen | MASGLCVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKQPLR |
| Ga0075404_113629042 | 3300030842 | Soil | MASGLCVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKRTSTVLVIQSSTRR |
| Ga0170823_133453281 | 3300031128 | Forest Soil | SVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRTLAG |
| Ga0170824_1046067144 | 3300031231 | Forest Soil | ASGLSVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRTWLNDRF |
| Ga0170824_1057667532 | 3300031231 | Forest Soil | VPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKRT |
| Ga0170824_1255299132 | 3300031231 | Forest Soil | GLSVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRSSGGLAVNVSF |
| Ga0265320_100907931 | 3300031240 | Rhizosphere | MASGHRVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKRTCQLLQV |
| Ga0265331_100367302 | 3300031250 | Rhizosphere | MASGHRVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKRTLRP |
| Ga0170820_120978942 | 3300031446 | Forest Soil | MASGLSVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRTWLNDRF |
| Ga0170818_1110566841 | 3300031474 | Forest Soil | MASGLSVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKRT |
| Ga0302326_127137902 | 3300031525 | Palsa | MASGQCVPHQQAAHMAAPTEGQNIKKILANGEPSTHGAKRTLAE |
| Ga0265313_100770601 | 3300031595 | Rhizosphere | MASGHRVPHKQAAHMAAPTEGQNIKKALAKGEPSTHGAKRTLGRSGLNGRF |
| Ga0307508_106459021 | 3300031616 | Ectomycorrhiza | MASGPFVPHKQAAHMAAPTEGQNIKKALANGEPSTHGAKRTLG |
| Ga0307476_109684601 | 3300031715 | Hardwood Forest Soil | MASGLCVPRKQAAHMAAPTEGQNIKNTLANGEPSTHGAKQTLG |
| Ga0307474_105161131 | 3300031718 | Hardwood Forest Soil | GIMASGLCVPRKQAAHMAAPTEGQNIKNTLANGEPSTHGAKQTLG |
| Ga0307474_112018961 | 3300031718 | Hardwood Forest Soil | MASGLCVPHQQAAHMAAPTEGQNIKNALANGEPSTHGAKRTLSKPGRNGRF |
| Ga0307478_102528502 | 3300031823 | Hardwood Forest Soil | MASGPCVPHQQAEHMAAPTEGQNIKKTLANGEPSTHDPKRTFAV |
| Ga0316220_12174511 | 3300031884 | Freshwater | MASGLCVPHQQAAHMAAPTEGQNIKKTLANGEPSTHGAKRALRRRH |
| Ga0315540_100941431 | 3300032061 | Salt Marsh Sediment | MASGSCAPHQQVEHMAAPTDAQCIKKTLANGEPSTHGAQRRFA |
| Ga0316583_100558842 | 3300032133 | Rhizosphere | MASGPCAPHQQVEHMAAPTDVQCIKKTLASGEPSTHGASRHFAAAKN |
| Ga0316223_11204032 | 3300032560 | Freshwater | MASGLCVPHQQAAHMAAPTEGQNIKKTLANGEPSTHGARRMAR |
| Ga0316222_13195322 | 3300032561 | Freshwater | MASGLFVPHQQAAHMAAPTEGQNIKKTLANGEPSTHVPHQ |
| Ga0316226_11481031 | 3300032562 | Freshwater | MASGLCVPHQQAAHMAAPTEGQNIKKDLAKGEPSTHGAKQSFD |
| Ga0316231_13940942 | 3300032722 | Freshwater | MASGLCVPHQQAAHMAAPTEGQNIKKTLANGEPSTHGAKRTFVSGQS |
| Ga0335083_112116591 | 3300032954 | Soil | IMASGLCVPHQQAAHMAAPTRRKHPSKKTLAKGEPSTHGA |
| Ga0310811_100029762 | 3300033475 | Soil | MTSGLGVPHKQAAHMAAPTEGQNIKNTLANGEPSTHGAKQTWKASAARRGRQAGDE |
| ⦗Top⦘ |