


| Basic Information | |
|---|---|
| Family ID | F069467 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGRSQAEVARQL |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.68 % |
| % of genes near scaffold ends (potentially truncated) | 91.94 % |
| % of genes from short scaffolds (< 2000 bps) | 81.45 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.968 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.548 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.742 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (29.032 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13546 | DDE_5 | 10.48 |
| PF13565 | HTH_32 | 3.23 |
| PF13384 | HTH_23 | 3.23 |
| PF08281 | Sigma70_r4_2 | 2.42 |
| PF12680 | SnoaL_2 | 2.42 |
| PF04542 | Sigma70_r2 | 2.42 |
| PF01609 | DDE_Tnp_1 | 2.42 |
| PF00589 | Phage_integrase | 2.42 |
| PF04228 | Zn_peptidase | 1.61 |
| PF14355 | Abi_C | 1.61 |
| PF03992 | ABM | 1.61 |
| PF13551 | HTH_29 | 1.61 |
| PF08002 | DUF1697 | 1.61 |
| PF13191 | AAA_16 | 0.81 |
| PF13091 | PLDc_2 | 0.81 |
| PF03795 | YCII | 0.81 |
| PF13592 | HTH_33 | 0.81 |
| PF14022 | DUF4238 | 0.81 |
| PF08751 | TrwC | 0.81 |
| PF13472 | Lipase_GDSL_2 | 0.81 |
| PF01636 | APH | 0.81 |
| PF13302 | Acetyltransf_3 | 0.81 |
| PF00665 | rve | 0.81 |
| PF02371 | Transposase_20 | 0.81 |
| PF00872 | Transposase_mut | 0.81 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.81 |
| PF01408 | GFO_IDH_MocA | 0.81 |
| PF07505 | DUF5131 | 0.81 |
| PF05506 | PLipase_C_C | 0.81 |
| PF13560 | HTH_31 | 0.81 |
| PF14023 | DUF4239 | 0.81 |
| PF01965 | DJ-1_PfpI | 0.81 |
| PF13751 | DDE_Tnp_1_6 | 0.81 |
| PF01610 | DDE_Tnp_ISL3 | 0.81 |
| PF12161 | HsdM_N | 0.81 |
| PF13649 | Methyltransf_25 | 0.81 |
| PF01872 | RibD_C | 0.81 |
| PF02518 | HATPase_c | 0.81 |
| PF00391 | PEP-utilizers | 0.81 |
| PF00781 | DAGK_cat | 0.81 |
| PF07883 | Cupin_2 | 0.81 |
| PF13340 | DUF4096 | 0.81 |
| PF00202 | Aminotran_3 | 0.81 |
| PF00884 | Sulfatase | 0.81 |
| PF08378 | NERD | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.42 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.42 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.42 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.42 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.42 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.42 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.42 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.42 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.42 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.42 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.61 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 1.61 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 1.61 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.81 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.81 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.81 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.81 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.81 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.81 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.97 % |
| Unclassified | root | N/A | 29.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_103272073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1227 | Open in IMG/M |
| 3300000956|JGI10216J12902_103296380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1395 | Open in IMG/M |
| 3300000956|JGI10216J12902_112131524 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300000956|JGI10216J12902_121830115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 733 | Open in IMG/M |
| 3300001431|F14TB_100050210 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300005518|Ga0070699_101442799 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005562|Ga0058697_10191756 | Not Available | 920 | Open in IMG/M |
| 3300005985|Ga0081539_10073597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1822 | Open in IMG/M |
| 3300006058|Ga0075432_10019195 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300006576|Ga0074047_12069125 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006577|Ga0074050_11338792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300006581|Ga0074048_12182969 | Not Available | 531 | Open in IMG/M |
| 3300006847|Ga0075431_102122932 | Not Available | 516 | Open in IMG/M |
| 3300006871|Ga0075434_100291317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 1652 | Open in IMG/M |
| 3300006914|Ga0075436_100462701 | Not Available | 925 | Open in IMG/M |
| 3300009100|Ga0075418_11498399 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300009147|Ga0114129_13447218 | Not Available | 507 | Open in IMG/M |
| 3300009147|Ga0114129_13506044 | Not Available | 501 | Open in IMG/M |
| 3300009162|Ga0075423_10081969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3363 | Open in IMG/M |
| 3300009799|Ga0105075_1065792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300009804|Ga0105063_1003051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1541 | Open in IMG/M |
| 3300009809|Ga0105089_1007653 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300009809|Ga0105089_1007764 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300009815|Ga0105070_1094811 | Not Available | 585 | Open in IMG/M |
| 3300009817|Ga0105062_1049603 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300009820|Ga0105085_1005025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2196 | Open in IMG/M |
| 3300009822|Ga0105066_1113170 | Not Available | 605 | Open in IMG/M |
| 3300009823|Ga0105078_1032416 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300009836|Ga0105068_1007596 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300009840|Ga0126313_10021694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 4283 | Open in IMG/M |
| 3300009840|Ga0126313_10276337 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300009840|Ga0126313_11240265 | Not Available | 615 | Open in IMG/M |
| 3300010037|Ga0126304_11211808 | Not Available | 518 | Open in IMG/M |
| 3300010038|Ga0126315_10148438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1386 | Open in IMG/M |
| 3300010038|Ga0126315_10632863 | Not Available | 693 | Open in IMG/M |
| 3300010041|Ga0126312_10018996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4588 | Open in IMG/M |
| 3300010041|Ga0126312_10207668 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300010041|Ga0126312_10441094 | Not Available | 928 | Open in IMG/M |
| 3300010041|Ga0126312_10448271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 920 | Open in IMG/M |
| 3300010041|Ga0126312_10586217 | Not Available | 801 | Open in IMG/M |
| 3300010042|Ga0126314_10037995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3059 | Open in IMG/M |
| 3300010044|Ga0126310_10110918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1682 | Open in IMG/M |
| 3300010044|Ga0126310_11791096 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010166|Ga0126306_10049306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2911 | Open in IMG/M |
| 3300010301|Ga0134070_10326433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300010329|Ga0134111_10289220 | Not Available | 681 | Open in IMG/M |
| 3300010333|Ga0134080_10357333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 667 | Open in IMG/M |
| 3300011000|Ga0138513_100004559 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300012021|Ga0120192_10020671 | Not Available | 1034 | Open in IMG/M |
| 3300012201|Ga0137365_10118640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1989 | Open in IMG/M |
| 3300012204|Ga0137374_10099670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2744 | Open in IMG/M |
| 3300012204|Ga0137374_10347441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1197 | Open in IMG/M |
| 3300012204|Ga0137374_10408608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1077 | Open in IMG/M |
| 3300012204|Ga0137374_10501733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 942 | Open in IMG/M |
| 3300012204|Ga0137374_10535059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora mayteni | 904 | Open in IMG/M |
| 3300012204|Ga0137374_10720570 | Not Available | 747 | Open in IMG/M |
| 3300012209|Ga0137379_10519441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1098 | Open in IMG/M |
| 3300012349|Ga0137387_10232483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora rhizosphaerae | 1327 | Open in IMG/M |
| 3300012350|Ga0137372_10082399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2735 | Open in IMG/M |
| 3300012353|Ga0137367_10062182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2786 | Open in IMG/M |
| 3300012353|Ga0137367_10091747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2241 | Open in IMG/M |
| 3300012353|Ga0137367_10208579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1414 | Open in IMG/M |
| 3300012355|Ga0137369_10008801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10047 | Open in IMG/M |
| 3300012355|Ga0137369_10061934 | All Organisms → cellular organisms → Bacteria | 3208 | Open in IMG/M |
| 3300012355|Ga0137369_10207594 | Not Available | 1509 | Open in IMG/M |
| 3300012355|Ga0137369_10238384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1382 | Open in IMG/M |
| 3300012358|Ga0137368_10029279 | All Organisms → cellular organisms → Bacteria | 5023 | Open in IMG/M |
| 3300012358|Ga0137368_10138791 | Not Available | 1813 | Open in IMG/M |
| 3300012358|Ga0137368_10346476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 989 | Open in IMG/M |
| 3300012358|Ga0137368_10448145 | Not Available | 839 | Open in IMG/M |
| 3300012532|Ga0137373_10043797 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Anaerophaga → Anaerophaga thermohalophila | 4218 | Open in IMG/M |
| 3300012532|Ga0137373_10162270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1874 | Open in IMG/M |
| 3300014487|Ga0182000_10257149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
| 3300017657|Ga0134074_1037632 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300018056|Ga0184623_10176687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 985 | Open in IMG/M |
| 3300018076|Ga0184609_10011251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3343 | Open in IMG/M |
| 3300018076|Ga0184609_10015720 | Not Available | 2918 | Open in IMG/M |
| 3300018078|Ga0184612_10402604 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300018081|Ga0184625_10145105 | Not Available | 1239 | Open in IMG/M |
| 3300018466|Ga0190268_11188612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CB03238 | 631 | Open in IMG/M |
| 3300018476|Ga0190274_10404786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1325 | Open in IMG/M |
| 3300019377|Ga0190264_11295822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300027056|Ga0209879_1077599 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027209|Ga0209875_1014909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300027332|Ga0209861_1001862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3178 | Open in IMG/M |
| 3300027332|Ga0209861_1007715 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300027332|Ga0209861_1020073 | Not Available | 996 | Open in IMG/M |
| 3300027379|Ga0209842_1003892 | All Organisms → cellular organisms → Bacteria | 2981 | Open in IMG/M |
| 3300027490|Ga0209899_1011672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2005 | Open in IMG/M |
| 3300027718|Ga0209795_10195898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300027952|Ga0209889_1081985 | Not Available | 654 | Open in IMG/M |
| 3300027954|Ga0209859_1018426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
| 3300027961|Ga0209853_1128760 | Not Available | 626 | Open in IMG/M |
| 3300028711|Ga0307293_10234665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300028793|Ga0307299_10375668 | Not Available | 533 | Open in IMG/M |
| 3300028811|Ga0307292_10159466 | Not Available | 915 | Open in IMG/M |
| 3300028878|Ga0307278_10033453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 2346 | Open in IMG/M |
| 3300028878|Ga0307278_10082180 | Not Available | 1451 | Open in IMG/M |
| 3300028878|Ga0307278_10284718 | Not Available | 731 | Open in IMG/M |
| 3300028884|Ga0307308_10138322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1165 | Open in IMG/M |
| 3300028885|Ga0307304_10137266 | Not Available | 1009 | Open in IMG/M |
| 3300031548|Ga0307408_100871531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Salinibacterium | 822 | Open in IMG/M |
| 3300031548|Ga0307408_101298219 | Not Available | 682 | Open in IMG/M |
| 3300031731|Ga0307405_11000013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300031903|Ga0307407_10167081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1445 | Open in IMG/M |
| 3300031903|Ga0307407_10246140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1222 | Open in IMG/M |
| 3300031903|Ga0307407_10660058 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300031903|Ga0307407_11679319 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031911|Ga0307412_11250971 | Not Available | 666 | Open in IMG/M |
| 3300031995|Ga0307409_101285916 | Not Available | 756 | Open in IMG/M |
| 3300031995|Ga0307409_101939470 | Not Available | 618 | Open in IMG/M |
| 3300031995|Ga0307409_102180565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300031995|Ga0307409_102356579 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300032002|Ga0307416_100025760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 4319 | Open in IMG/M |
| 3300032002|Ga0307416_100179894 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300032002|Ga0307416_100187705 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300032004|Ga0307414_11622239 | Not Available | 603 | Open in IMG/M |
| 3300032004|Ga0307414_12328196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus obscurus → Geodermatophilus obscurus DSM 43160 | 500 | Open in IMG/M |
| 3300032005|Ga0307411_10220776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1470 | Open in IMG/M |
| 3300032005|Ga0307411_10431365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Ea1.12 | 1097 | Open in IMG/M |
| 3300032126|Ga0307415_100067104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2506 | Open in IMG/M |
| 3300032126|Ga0307415_100789234 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300032126|Ga0307415_101564031 | Not Available | 632 | Open in IMG/M |
| 3300033550|Ga0247829_11229514 | Not Available | 621 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 17.74% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 16.13% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 12.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.61% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.81% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1032720731 | 3300000956 | Soil | MRPIAYRRNARGLRDRQAFEAVRMRAGALFAAGHSQAEVARTLG |
| JGI10216J12902_1032963801 | 3300000956 | Soil | MRPTAYRRNARGPRDRQALEGVRMQAGALFAAGHPQ |
| JGI10216J12902_1121315242 | 3300000956 | Soil | MRPTAYRRNARGLRDRQAFERVRLEAGELFAAGRSQAEVAHQ |
| JGI10216J12902_1218301151 | 3300000956 | Soil | PTAYRRNARGLRDRQAFEGVRLRAGAVLPAGRSQAEVARQL* |
| F14TB_1000502105 | 3300001431 | Soil | MRPTVYRRNARGPGDRQAFERIRLQAGELFAAGRSQ |
| Ga0070699_1014427992 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPTAYRRNARGLRDRQAFERIRMQAGALFAAGHPQAEVAHQLGVARQNVSRWH |
| Ga0058697_101917561 | 3300005562 | Agave | MRPTIYRRNARGLRDRQAFEAIRMQAAALFAAGHSQAQVAHQL |
| Ga0081539_100735973 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MRPTAYRRNARGLRDRQAFEDVRMQAGQLFAAGHTQAQVSRQLGVARQNVSR |
| Ga0075432_100191951 | 3300006058 | Populus Rhizosphere | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGRSQAEVA |
| Ga0074047_120691251 | 3300006576 | Soil | MRPTAYRRNARGLRDRQAFERVRLQAGALFAAGRSQAEVALQL |
| Ga0074050_113387922 | 3300006577 | Soil | MRPTAYRRNARGLRDRQAFERVRLQAGALFAAGRSQAEVAREL |
| Ga0074048_121829691 | 3300006581 | Soil | MRPTAYRRNARGLRDRQAFERVRLQAGALFAAGRSQA |
| Ga0075431_1021229322 | 3300006847 | Populus Rhizosphere | MRPTAYRRNARGLGDRQAFEGVRMRAGALFAAGHSQAEV |
| Ga0075434_1002913171 | 3300006871 | Populus Rhizosphere | MRPTAYRRNARGPRDRQAFEQVRMQAGALFAAGHSQAEVARELGVARQ |
| Ga0075436_1004627011 | 3300006914 | Populus Rhizosphere | MRPTAYRRNARGPRDRQAFEGVRMQAGQLCAAGRTQAQVARSLGVARQNVSR |
| Ga0075418_114983991 | 3300009100 | Populus Rhizosphere | MRPTAYRRNARGLGDRQAFEGVRMRAGALFAAGHSQA |
| Ga0114129_134472182 | 3300009147 | Populus Rhizosphere | MRPTAYRRNARGLRDRQAFEGVRMQAGQLFAAGGSQAEVARTLGVARQKAAAGTP |
| Ga0114129_135060441 | 3300009147 | Populus Rhizosphere | MRPTAYRRNARGLRDRQAFEHVRMQAGELFATGRSQAEVARTLGVARQNASR |
| Ga0075423_100819696 | 3300009162 | Populus Rhizosphere | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHSQAEVARRLGVARQNV |
| Ga0105075_10657922 | 3300009799 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGRSQAEVARALGVARQNV |
| Ga0105063_10030513 | 3300009804 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHSQAQV |
| Ga0105089_10076534 | 3300009809 | Groundwater Sand | MIPTAYRRNARGLRDRQAFRGVRMQTGALFAAGHAH |
| Ga0105089_10077642 | 3300009809 | Groundwater Sand | MRPTAYRRNARGLGDRQAFEGVRMQAGALFAAGHS |
| Ga0105070_10948111 | 3300009815 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEHVRMQAGALFAAGRSQAEVAHQLGVARQNASR |
| Ga0105062_10496031 | 3300009817 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEHVRMQAGALFAAGRSQAEVAHQLG |
| Ga0105085_10050251 | 3300009820 | Groundwater Sand | MRPTAYRRNARGPRDRQAFEHVRMQAGALFADGRSQAEVAHQ |
| Ga0105066_11131702 | 3300009822 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEHVRMQAGALFAAGRSQAEVAHQLGV |
| Ga0105078_10324162 | 3300009823 | Groundwater Sand | MGPTAYRRNTRGLRDRQAFEHVRMQAGALFAAGRSQAEVAHQLGVARQNASR |
| Ga0105068_10075961 | 3300009836 | Groundwater Sand | MIPTAYRRNARGLRDRQAFRGVRMQTGALFAAGHAH* |
| Ga0126313_100216941 | 3300009840 | Serpentine Soil | MRPTAYRRNARGPRDRQAFEAVRLQAGALFAAGHTQAQVAHQL |
| Ga0126313_102763372 | 3300009840 | Serpentine Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGQLFAAGHAQAEVARKPAGGRS* |
| Ga0126313_112402652 | 3300009840 | Serpentine Soil | MRPTAYRRNARGLRDRQAFERVRLQAGELFAAGRSQAVVARQLF* |
| Ga0126304_112118081 | 3300010037 | Serpentine Soil | MRPTAYRRNARGLRDRQAFEAVRLQAGELFAAGRSQAEVAHQLGVARQNASR |
| Ga0126315_101484381 | 3300010038 | Serpentine Soil | MRPTAYRRNARGLGDRQAFEGVRMQAGALFAAGHSQAQ |
| Ga0126315_106328631 | 3300010038 | Serpentine Soil | MRPTAYRRNARGPRDRQAFEAVRLQAGALFAAGHTQAQVAHQLG |
| Ga0126312_100189966 | 3300010041 | Serpentine Soil | MRPTAYRRNARGLRDRQAFERIRMQAGELFAAGRSQAEVAHQLGVARQN |
| Ga0126312_102076681 | 3300010041 | Serpentine Soil | MRPTAYRRNARGPRDRQALEGVRLQAGALFAAGHTQAEVAHQLGVARQNVSR |
| Ga0126312_104410942 | 3300010041 | Serpentine Soil | MRPTAYRRNARGLRDRQAFEAVRMQAGALFAAGHTQAEVAR |
| Ga0126312_104482712 | 3300010041 | Serpentine Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFATGHTQAEVA |
| Ga0126312_105862172 | 3300010041 | Serpentine Soil | MRPTAYRRNARGLRDRQAFEHIRMQAGELFAAGRSQAQVAH |
| Ga0126314_100379953 | 3300010042 | Serpentine Soil | MRPTAYRRNARSLRDRQAFEQVRMQAGALFAIGRSQAEVAH* |
| Ga0126310_101109182 | 3300010044 | Serpentine Soil | MRPIAYRRNARGLRDRQAFERVRLQAGELFAAGRSQA |
| Ga0126310_117910961 | 3300010044 | Serpentine Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFATGHTQAEVARQLGVARQNVSR |
| Ga0126306_100493061 | 3300010166 | Serpentine Soil | MRPTAYRRNARGLRDRQAFERIRLQAGELFAAGRSQAEVARRLG |
| Ga0134070_103264331 | 3300010301 | Grasslands Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHSQAEVARQPG |
| Ga0134111_102892201 | 3300010329 | Grasslands Soil | MRPTAYRRNARGLRDREAFERIRLQAGELFDAGRSQAEVARE |
| Ga0134080_103573332 | 3300010333 | Grasslands Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGELFAAGHTQAE |
| Ga0138513_1000045594 | 3300011000 | Soil | MRPTAYRRNARGLRDRQAFERVRLQAGALFAAGRSQAQV |
| Ga0120192_100206712 | 3300012021 | Terrestrial | MRPTAYRRNARGLRDRQAFEHVRTQAGALFAAGRSQAQA |
| Ga0137365_101186402 | 3300012201 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHS* |
| Ga0137374_100996705 | 3300012204 | Vadose Zone Soil | MRPTAYRRNARGLRDRQALEGVRMQAGGLLAAGHAQAQVARQLGVA |
| Ga0137374_103474411 | 3300012204 | Vadose Zone Soil | MRPTAYRRNGRGPRDRQAFEGVRMQAGALFAAGHSQAWLWR* |
| Ga0137374_104086082 | 3300012204 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHAQAEV |
| Ga0137374_105017331 | 3300012204 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEHIRMQAGALFAAGHT |
| Ga0137374_105350592 | 3300012204 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEHVRMQAGELFAAGHAQ |
| Ga0137374_107205701 | 3300012204 | Vadose Zone Soil | TAYRRNARGLRDRQAFEGVRMQAGALFAAGHSQAEVACQLGVARQNVSRCHRA* |
| Ga0137379_105194412 | 3300012209 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEGVRMEAGALFAAGHTQAEV |
| Ga0137387_102324831 | 3300012349 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEHVRMQAGALFAAGRSQAEVARTLGVARQNVSR |
| Ga0137372_100823994 | 3300012350 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHSQAQITRTLGVA |
| Ga0137367_100621821 | 3300012353 | Vadose Zone Soil | MTDLTLSWQHGSMRPTAYRRNARGLRDRQAFEHVRLQAGALFAAGHSQAEVARTLGVARQNVSRWHA |
| Ga0137367_100917471 | 3300012353 | Vadose Zone Soil | MSWQHGGMRPTAYRHNARGLRDRQAFKHVRMQAGELFAAGRSQAEVAHQLGVARQNASR |
| Ga0137367_102085792 | 3300012353 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHTQAEVARTLGVA |
| Ga0137369_1000880112 | 3300012355 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEHIRMQAGGLFAAGHTQ |
| Ga0137369_100619343 | 3300012355 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHSQAEVARQLGVARQNVSRCDRA* |
| Ga0137369_102075942 | 3300012355 | Vadose Zone Soil | MGRMRPTAYRRNARGLRDRQAFEHIRMQAGALFAAGR |
| Ga0137369_102383843 | 3300012355 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFERVRLQAGELFAAVAPR |
| Ga0137368_100292791 | 3300012358 | Vadose Zone Soil | MRPTAYRRNDRGLRDRQAFEHVRMQAGELFAAGRSQA |
| Ga0137368_101387912 | 3300012358 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGELFAAGHS |
| Ga0137368_103464762 | 3300012358 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFERVRLQAGELFAAVAP |
| Ga0137368_104481451 | 3300012358 | Vadose Zone Soil | MRPTAYRRNARGLRDHQAFEGSRMQAGALFAAGHSQAEVACQLGVARQNVSRCDRA* |
| Ga0137373_100437973 | 3300012532 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGAMFAAGHSQAQVAHQLGVARQNVS |
| Ga0137373_101622703 | 3300012532 | Vadose Zone Soil | MRPTAYRRNARGLRDRQAFEHIRMQAGGLFAAGHTQTQVAHQLGV |
| Ga0182000_102571491 | 3300014487 | Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGRSQAEVARQL |
| Ga0134074_10376321 | 3300017657 | Grasslands Soil | MKPIAYRRNARGPRDRQAFEGVRMQAGALFAAGRSQAEVA |
| Ga0184623_101766871 | 3300018056 | Groundwater Sediment | MRPTAYRRNARGLRDRQAFEHVRMQAGALFAAGRSQA |
| Ga0184609_100112511 | 3300018076 | Groundwater Sediment | MRPTAYRRNARGLGDRQAFEHVRMQAGTLFAAGRSQAEVARTLGVARQNVSR |
| Ga0184609_100157203 | 3300018076 | Groundwater Sediment | MRPTAYRRNARGLHDRQAFEHVRMQAGALFAAGRSQA |
| Ga0184612_104026042 | 3300018078 | Groundwater Sediment | MRPTAYRRNARGLRDRQAFERVRLQAGALFAAGHSQAEVA |
| Ga0184625_101451051 | 3300018081 | Groundwater Sediment | MRPTAYRRNAPGLRDRQAFKGVRMQAGALFAAGHAQAEVARH |
| Ga0190268_111886122 | 3300018466 | Soil | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHSQAEVTRTLGVARQN |
| Ga0190274_104047862 | 3300018476 | Soil | MRPTAYRRNARGLRDRQALERVRLQAGELFAAGRSQAEVARQLGIARQNVSRQHAQRRWRATAMAA |
| Ga0190264_112958222 | 3300019377 | Soil | MRPTAYRRNARGPRDRQAFEHVRMQAGALFAAGRS |
| Ga0209879_10775991 | 3300027056 | Groundwater Sand | MRPTAYRRNARGLRDRQAFERVRMQAGELFAAGRSQAE |
| Ga0209875_10149093 | 3300027209 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHSQAQVARQL |
| Ga0209861_10018625 | 3300027332 | Groundwater Sand | MTGSGLSWQHGGMRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHSQAEVARTLGVARQ |
| Ga0209861_10077152 | 3300027332 | Groundwater Sand | MRPTAYRRNARGLGDRQAFEGVRMQAGALFAAGHSQA |
| Ga0209861_10200732 | 3300027332 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHTQAE |
| Ga0209842_10038921 | 3300027379 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEHVRMQAGALFAAGRSQAEVAHQLGVA |
| Ga0209899_10116725 | 3300027490 | Groundwater Sand | MRPTAYRRNARGLVDRQAFEGVRMQAGALFAAGHSQAEVARTLGVARQNVSRWHAR |
| Ga0209795_101958981 | 3300027718 | Agave | MRPTTYRRNARGPRDRQAFEGVRMQAGELFAAGHTQAEVARTLGVA |
| Ga0209889_10819851 | 3300027952 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEHVRMQAGALFAAGRSQAEVARALGVARQNVS |
| Ga0209859_10184262 | 3300027954 | Groundwater Sand | MRPTAYRRNARGLRDRQAFERIRLQAGELFAAGGSQ |
| Ga0209853_11287601 | 3300027961 | Groundwater Sand | MRPTAYRRNARGLRDRQAFEHVRMQAGALFAAGRSQAEVARALGVARQNVSR |
| Ga0307293_102346651 | 3300028711 | Soil | MRPTAYRRNAPGLRDRQAFKGVRMQAGALFAAGHAQAEVARHLGG |
| Ga0307299_103756681 | 3300028793 | Soil | MRPTAYRRNARGLRDRQAFEAIRLQAGALFADGHSQAEVARQLGVARQNVSR |
| Ga0307292_101594661 | 3300028811 | Soil | MRPTAYRSNARGLRDRQAFEGVRMQVGALFAAGHAQA |
| Ga0307278_100334534 | 3300028878 | Soil | MRPTAYRRNARGLGDRQAFERVRMQAGALFAAGRSQAQVAHQLGVARQNVSRWHA |
| Ga0307278_100821802 | 3300028878 | Soil | MRPTAYRRNARGPRDRQAFEHVRMQAGALFAAGRSQAEVARILGVAQRTARS |
| Ga0307278_102847181 | 3300028878 | Soil | MRPTAYRRNARGVRDRQALERVRLQAGALFAAGRSQAEVARELGV |
| Ga0307308_101383223 | 3300028884 | Soil | MRPTAYRRNARGLRDRQAFEHIRMQAGALFAAGRSQAEV |
| Ga0307304_101372661 | 3300028885 | Soil | MRPTAYRRNARGLVDRQAFEGVRMQAGALFAAGHTQAEVARTLG |
| Ga0307408_1008715311 | 3300031548 | Rhizosphere | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHTQAQVART |
| Ga0307408_1012982191 | 3300031548 | Rhizosphere | MRPTAYRRNARGLGDRQAFEGVRMQAGALFAAGHAQAQVARTLGVARQNVSRWHA |
| Ga0307405_110000132 | 3300031731 | Rhizosphere | MRPIAYRRNARGLRDRQAFERVRLQAGELFAAGRSQAE |
| Ga0307407_101670811 | 3300031903 | Rhizosphere | MRPIAYRRNARGLRDRQAFERVRLQAGELFAAGRSQAEVAASSAS |
| Ga0307407_102461401 | 3300031903 | Rhizosphere | MRPTAYRRNARGLRDRQAFEHIRMQAGALFAAGRSQA |
| Ga0307407_106600581 | 3300031903 | Rhizosphere | MRPTAYRRNARGLRDRQAFEHIRMQAGALFTAGRSQAEVARTLGVA |
| Ga0307407_116793191 | 3300031903 | Rhizosphere | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGRSQAEVARTLGVARQVVSRWH |
| Ga0307412_112509712 | 3300031911 | Rhizosphere | MRPTAYRRNARGLRDRQAFEGVRMQAGALFAAGHTQAEVARTLG |
| Ga0307409_1012859162 | 3300031995 | Rhizosphere | MRPTAYRRNARGLGDRQAFEAVRMQAGALFAAGHSQAEVARTL |
| Ga0307409_1019394702 | 3300031995 | Rhizosphere | MRPSAYRRNARGLRDRQAFEAVRMQAGALFAAGRSQAEV |
| Ga0307409_1021805651 | 3300031995 | Rhizosphere | MRPTAYRRNARGLRDRQAFEAVRLQAGALFAAGHTQAQVARQLGVA |
| Ga0307409_1023565791 | 3300031995 | Rhizosphere | MRPTAYRRNARGLRDRQAFEGVRMQAGELFTAGHAQAQVARTLGVARQNVSRWHAQ |
| Ga0307416_1000257601 | 3300032002 | Rhizosphere | MRPTAYRRNARGPRDRQAFEAVRLQAGALFAAGHTQAEVAHQLGVARQNVSRW |
| Ga0307416_1001798941 | 3300032002 | Rhizosphere | MSWQHGDMRPTAYRRNARGLRDRQAFEGVRMRAGALFAAGRYQAEVARTFGVARQNVSR |
| Ga0307416_1001877053 | 3300032002 | Rhizosphere | MRPTAYRRNARGLRDRQAFERIRLQAGELFAAGRSQAEVAR |
| Ga0307414_116222392 | 3300032004 | Rhizosphere | MSWQHGDMRPTAYRRNARGLRDRQAFEGVRMRAGALFAAGRYQAEVARTF |
| Ga0307414_123281961 | 3300032004 | Rhizosphere | MRPTAYRRNARGPRDRQAFEAVRRQAGALFAAGHTQAQVAHQLGVARQNVSRWHA |
| Ga0307411_102207763 | 3300032005 | Rhizosphere | MRPTADRRNARGLRDRQAFEAIRLQAGALFAAGHTQAEVARTLGVARQN |
| Ga0307411_104313651 | 3300032005 | Rhizosphere | MRPTAYRRNARGLLDRQAFEHIRMQAGQLFAAGRSQ |
| Ga0307415_1000671045 | 3300032126 | Rhizosphere | MRPTAYRRNARGLRDRQAFEGVRLQAGALFAAGHTQAEVARTLGV |
| Ga0307415_1007892341 | 3300032126 | Rhizosphere | MRPTAYRRNARGLRDRQAFEHIRMQAGQLFAAGHAQAKVAHQLGVAR |
| Ga0307415_1015640312 | 3300032126 | Rhizosphere | MRPSAYRRNARGLRDRQAFEAVRMQAGALFAAGRSQAEVARQL |
| Ga0247829_112295142 | 3300033550 | Soil | MRPTAYRRNARGLRDRQAFERVRLQAGALFAAGHSQAEVAHQLGVARQN |
| ⦗Top⦘ |