


| Basic Information | |
|---|---|
| Family ID | F069419 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MGKKKTKKQSAKATLAEVIKEMAKPRVASSAREQ |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 37.90 % |
| % of genes near scaffold ends (potentially truncated) | 32.26 % |
| % of genes from short scaffolds (< 2000 bps) | 79.84 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.032 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (11.290 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.968 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.77% β-sheet: 0.00% Coil/Unstructured: 53.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13545 | HTH_Crp_2 | 41.13 |
| PF00072 | Response_reg | 4.03 |
| PF05532 | CsbD | 1.61 |
| PF13620 | CarboxypepD_reg | 1.61 |
| PF04264 | YceI | 1.61 |
| PF02065 | Melibiase | 0.81 |
| PF13432 | TPR_16 | 0.81 |
| PF00118 | Cpn60_TCP1 | 0.81 |
| PF00027 | cNMP_binding | 0.81 |
| PF00011 | HSP20 | 0.81 |
| PF01165 | Ribosomal_S21 | 0.81 |
| PF01435 | Peptidase_M48 | 0.81 |
| PF02954 | HTH_8 | 0.81 |
| PF00589 | Phage_integrase | 0.81 |
| PF01337 | Barstar | 0.81 |
| PF03631 | Virul_fac_BrkB | 0.81 |
| PF07676 | PD40 | 0.81 |
| PF00691 | OmpA | 0.81 |
| PF00753 | Lactamase_B | 0.81 |
| PF01915 | Glyco_hydro_3_C | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 1.61 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 1.61 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.81 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.81 |
| COG2732 | Barstar, RNAse (barnase) inhibitor | Transcription [K] | 0.81 |
| COG3345 | Alpha-galactosidase | Carbohydrate transport and metabolism [G] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.03 % |
| Unclassified | root | N/A | 20.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100673844 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101176228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101857596 | Not Available | 504 | Open in IMG/M |
| 3300004104|Ga0058891_1579349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300004475|Ga0068969_1487022 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300004479|Ga0062595_100977876 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005328|Ga0070676_11247226 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005455|Ga0070663_100452819 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005537|Ga0070730_10073341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 2411 | Open in IMG/M |
| 3300005537|Ga0070730_10128146 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300005538|Ga0070731_10503837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 806 | Open in IMG/M |
| 3300005541|Ga0070733_10347030 | Not Available | 984 | Open in IMG/M |
| 3300005542|Ga0070732_10086173 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300005557|Ga0066704_10829759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300005578|Ga0068854_100407022 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005591|Ga0070761_10010787 | All Organisms → cellular organisms → Bacteria | 5148 | Open in IMG/M |
| 3300005610|Ga0070763_10092418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1514 | Open in IMG/M |
| 3300005712|Ga0070764_10434949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300005993|Ga0080027_10322338 | Not Available | 616 | Open in IMG/M |
| 3300005995|Ga0066790_10062199 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300006059|Ga0075017_100007096 | All Organisms → cellular organisms → Bacteria | 7096 | Open in IMG/M |
| 3300006059|Ga0075017_101323114 | Not Available | 566 | Open in IMG/M |
| 3300006102|Ga0075015_100043151 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300006163|Ga0070715_10016819 | All Organisms → cellular organisms → Bacteria | 2757 | Open in IMG/M |
| 3300006893|Ga0073928_10083338 | Not Available | 2733 | Open in IMG/M |
| 3300006893|Ga0073928_10145250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1920 | Open in IMG/M |
| 3300006893|Ga0073928_10477244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300007982|Ga0102924_1212041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300009038|Ga0099829_11130921 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300009176|Ga0105242_12327725 | Not Available | 582 | Open in IMG/M |
| 3300009518|Ga0116128_1008715 | All Organisms → cellular organisms → Bacteria | 3684 | Open in IMG/M |
| 3300009522|Ga0116218_1138754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
| 3300009522|Ga0116218_1425312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 592 | Open in IMG/M |
| 3300009523|Ga0116221_1509696 | Not Available | 527 | Open in IMG/M |
| 3300009551|Ga0105238_10303942 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300009698|Ga0116216_10199792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300009700|Ga0116217_10038251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 3583 | Open in IMG/M |
| 3300009764|Ga0116134_1061970 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300009839|Ga0116223_10050922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2704 | Open in IMG/M |
| 3300010343|Ga0074044_10011108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6824 | Open in IMG/M |
| 3300011070|Ga0138567_1042203 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300011075|Ga0138555_1057030 | Not Available | 672 | Open in IMG/M |
| 3300011269|Ga0137392_10606833 | Not Available | 908 | Open in IMG/M |
| 3300011998|Ga0120114_1023529 | Not Available | 1274 | Open in IMG/M |
| 3300012189|Ga0137388_10072059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2882 | Open in IMG/M |
| 3300012202|Ga0137363_11440173 | Not Available | 579 | Open in IMG/M |
| 3300014496|Ga0182011_10626872 | Not Available | 682 | Open in IMG/M |
| 3300014501|Ga0182024_10097762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4290 | Open in IMG/M |
| 3300014501|Ga0182024_12896655 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300014838|Ga0182030_10983119 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300014968|Ga0157379_10475178 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300017822|Ga0187802_10053416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1479 | Open in IMG/M |
| 3300017822|Ga0187802_10405095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 540 | Open in IMG/M |
| 3300017928|Ga0187806_1088819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300017932|Ga0187814_10225294 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300017933|Ga0187801_10386677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300017937|Ga0187809_10253350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300017943|Ga0187819_10634171 | Not Available | 605 | Open in IMG/M |
| 3300018004|Ga0187865_1126729 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300018019|Ga0187874_10255941 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300018030|Ga0187869_10531253 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300018034|Ga0187863_10027642 | All Organisms → cellular organisms → Bacteria | 3386 | Open in IMG/M |
| 3300018035|Ga0187875_10534387 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300018040|Ga0187862_10726180 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300019879|Ga0193723_1153904 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300019890|Ga0193728_1110913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
| 3300020004|Ga0193755_1116250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300020010|Ga0193749_1014535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1538 | Open in IMG/M |
| 3300020018|Ga0193721_1120175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300020579|Ga0210407_10978375 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300020579|Ga0210407_11481119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 501 | Open in IMG/M |
| 3300020583|Ga0210401_10002442 | All Organisms → cellular organisms → Bacteria | 20607 | Open in IMG/M |
| 3300021170|Ga0210400_10009431 | All Organisms → cellular organisms → Bacteria | 7904 | Open in IMG/M |
| 3300021402|Ga0210385_10502415 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300021405|Ga0210387_11650991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300021432|Ga0210384_10648353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300021478|Ga0210402_10001260 | All Organisms → cellular organisms → Bacteria | 26219 | Open in IMG/M |
| 3300021479|Ga0210410_10273177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1517 | Open in IMG/M |
| 3300022881|Ga0224545_1054486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300023255|Ga0224547_1001138 | All Organisms → cellular organisms → Bacteria | 3287 | Open in IMG/M |
| 3300025432|Ga0208821_1063281 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025473|Ga0208190_1086595 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300025899|Ga0207642_10003203 | All Organisms → cellular organisms → Bacteria | 5132 | Open in IMG/M |
| 3300025905|Ga0207685_10003616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3790 | Open in IMG/M |
| 3300025919|Ga0207657_11100490 | Not Available | 607 | Open in IMG/M |
| 3300025945|Ga0207679_10221005 | Not Available | 1594 | Open in IMG/M |
| 3300026291|Ga0209890_10262854 | Not Available | 532 | Open in IMG/M |
| 3300026294|Ga0209839_10035992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1852 | Open in IMG/M |
| 3300026294|Ga0209839_10207915 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300026552|Ga0209577_10558112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300026786|Ga0207497_102797 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300027047|Ga0208730_1026403 | Not Available | 667 | Open in IMG/M |
| 3300027605|Ga0209329_1043843 | Not Available | 947 | Open in IMG/M |
| 3300027610|Ga0209528_1103315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300027645|Ga0209117_1018037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2302 | Open in IMG/M |
| 3300027676|Ga0209333_1138256 | Not Available | 657 | Open in IMG/M |
| 3300027684|Ga0209626_1149985 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300027684|Ga0209626_1210691 | Not Available | 515 | Open in IMG/M |
| 3300027857|Ga0209166_10051223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 2411 | Open in IMG/M |
| 3300027884|Ga0209275_10673612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300027889|Ga0209380_10412390 | Not Available | 792 | Open in IMG/M |
| 3300027905|Ga0209415_10325709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
| 3300027908|Ga0209006_10750256 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300027911|Ga0209698_10113874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2249 | Open in IMG/M |
| 3300028023|Ga0265357_1008180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| 3300028047|Ga0209526_10698696 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300028047|Ga0209526_10955102 | Not Available | 516 | Open in IMG/M |
| 3300028666|Ga0265336_10080465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300029944|Ga0311352_10030905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5070 | Open in IMG/M |
| 3300029944|Ga0311352_11164588 | Not Available | 587 | Open in IMG/M |
| 3300030602|Ga0210254_10646991 | Not Available | 518 | Open in IMG/M |
| 3300030659|Ga0316363_10098472 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300030906|Ga0302314_11825883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300030991|Ga0073994_12427475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 518 | Open in IMG/M |
| 3300031040|Ga0265754_1009590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300031231|Ga0170824_106750114 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031261|Ga0302140_10759330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 699 | Open in IMG/M |
| 3300031918|Ga0311367_11521735 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300031962|Ga0307479_10950131 | Not Available | 830 | Open in IMG/M |
| 3300032160|Ga0311301_10216899 | All Organisms → cellular organisms → Bacteria | 3237 | Open in IMG/M |
| 3300032160|Ga0311301_10549310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1689 | Open in IMG/M |
| 3300032180|Ga0307471_101408496 | Not Available | 857 | Open in IMG/M |
| 3300033888|Ga0334792_024954 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300033888|Ga0334792_057426 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 11.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.84% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.23% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.23% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.23% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.61% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.81% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300011070 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026786 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1006738442 | 3300002245 | Forest Soil | RSTIDGRMAKRKPQKQSASETLAEVIKEMAKPRVVMSGTRTGK* |
| JGIcombinedJ26739_1011762282 | 3300002245 | Forest Soil | MAKKKTPRHSAKVTLTAKATLAQIIKEMAKPRVAKSARGGL* |
| JGIcombinedJ26739_1018575961 | 3300002245 | Forest Soil | MGKRKTKKQSAKATLPEVIKEMADPRVARSAREQSS |
| Ga0058891_15793491 | 3300004104 | Forest Soil | EKPQKQSAKATLAAKETLAEVIKEMAKPRVAESARGGGL* |
| Ga0068969_14870221 | 3300004475 | Peatlands Soil | PGLVKSWCMGKRKTRKQSAKATLAEVVKEMAKPRVATSARE* |
| Ga0062595_1009778762 | 3300004479 | Soil | MNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL* |
| Ga0070676_112472262 | 3300005328 | Miscanthus Rhizosphere | MDKRKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL* |
| Ga0070663_1004528192 | 3300005455 | Corn Rhizosphere | NKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL* |
| Ga0070730_100733415 | 3300005537 | Surface Soil | MIANMSKKKIKKQSPKATLAEVTREMAKPRVAESARQP* |
| Ga0070730_101281461 | 3300005537 | Surface Soil | MGIMGKKNAKKQSAKATLAAITKEMAMPRVTRSAREQ* |
| Ga0070731_105038371 | 3300005538 | Surface Soil | MGAWVKEKTREQSPKATLAEVVKEMAKPRVVMSARE |
| Ga0070733_103470302 | 3300005541 | Surface Soil | VTSWGLWGKKKTKKQSAKAILAEVIKEMAKPRVARSAKE* |
| Ga0070732_100861735 | 3300005542 | Surface Soil | MGKKKTKKQSAKATLAEVIKEMAKPRVARSAREHSHLWN* |
| Ga0066704_108297592 | 3300005557 | Soil | MAKRKTQKKSAKATLAEVIKEMAKPRVAMSARGGS* |
| Ga0068854_1004070222 | 3300005578 | Corn Rhizosphere | MNKGETKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL* |
| Ga0070761_100107875 | 3300005591 | Soil | MDKRKTKAKKLLAKVTLAEVIKEMAKPRVAASAR* |
| Ga0070763_100924182 | 3300005610 | Soil | MAKKKTQKKSAKATLAEVIKEMAKERVAMSARGGL* |
| Ga0070764_104349491 | 3300005712 | Soil | MAKKKTPKKSAKATLAEVIKEMAKERVAMSARGGL* |
| Ga0080027_103223382 | 3300005993 | Prmafrost Soil | MGTMRKKKTKKQSAKETLAEVIKEMAKPRVASSARE* |
| Ga0066790_100621991 | 3300005995 | Soil | SHRTTGKKKSKKQSAKETLAEVMKEMAKPRVAMSAREQGV* |
| Ga0075017_1000070963 | 3300006059 | Watersheds | MAKRKTQKKSAKSTLAEVIKEMAKPRVAMSARDGS* |
| Ga0075017_1013231142 | 3300006059 | Watersheds | VYVGKTKVKKQSAKATLAEVIKEMAKPRVVASAK* |
| Ga0075015_1000431512 | 3300006102 | Watersheds | MAKRKTQKKSAKSTLAEVIKEMAKPRVAMSARGGS* |
| Ga0070715_100168193 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKRKAAKQSAKATLAEVLKVMAKPRVAVSARGGS* |
| Ga0073928_100833387 | 3300006893 | Iron-Sulfur Acid Spring | MAKGKTQKQSAKATLAEVIKEMAKPRVAKSAREHSPQRSK* |
| Ga0073928_101452504 | 3300006893 | Iron-Sulfur Acid Spring | METMNKKKTKKQSAKATLAEVTKEMAKPRVASSAR* |
| Ga0073928_104772442 | 3300006893 | Iron-Sulfur Acid Spring | MGKRKPKKQSAEATLAEVVKEMAKPRVVRSAREQ* |
| Ga0102924_12120413 | 3300007982 | Iron-Sulfur Acid Spring | MAKRKTQKQSAKATLAEVIKEMAKKRVAMSARGGS* |
| Ga0099829_111309211 | 3300009038 | Vadose Zone Soil | MGKKKTKKQSAKTTLAEVIKEMAKPRVVSSARGQ* |
| Ga0105242_123277251 | 3300009176 | Miscanthus Rhizosphere | MNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRR |
| Ga0116128_10087152 | 3300009518 | Peatland | MGKKKTKKQSAKATLAEVIKEMAKPRVASSAREQ* |
| Ga0116218_11387542 | 3300009522 | Peatlands Soil | MKSWVMGKRKTKKQLAKATLAEVVKEMAKPRVVMSAKG* |
| Ga0116218_14253122 | 3300009522 | Peatlands Soil | MAKRKTQKKSAKATLAEVIKEMAKPRVAMSARGGL* |
| Ga0116221_15096962 | 3300009523 | Peatlands Soil | MKSWVMGKRKTKKQLAKAALAEVVKEMAKPRVVMSAKG* |
| Ga0105238_103039421 | 3300009551 | Corn Rhizosphere | MNKGKTKKQSAKATLAEVIKEMAKPRVAKSAKERMVRRQL* |
| Ga0116216_101997921 | 3300009698 | Peatlands Soil | SWVCMAKRKTPKQSAKATLAEVIKEMAKPRVAMSARGGL* |
| Ga0116217_100382511 | 3300009700 | Peatlands Soil | MAKKKTQEKSAKATLAEVIKEMAKKRVAMSARGGL* |
| Ga0116134_10619701 | 3300009764 | Peatland | MIAKTGCMRERKTRKLSGKATLAEVIKEMARPRGAESARE* |
| Ga0116223_100509222 | 3300009839 | Peatlands Soil | MGKRKTKTKEQQDKATLAEVRKEMAKPRVAMSARE* |
| Ga0074044_100111084 | 3300010343 | Bog Forest Soil | MKSWVMSKRKTKKQLAKATLAEVVKEMAKPRVVMSAKE* |
| Ga0138567_10422032 | 3300011070 | Peatlands Soil | CMGKRKTRKQSAKATLAEVIKEMAKPRVATSARE* |
| Ga0138555_10570301 | 3300011075 | Peatlands Soil | VDLPGLVKSWGMGKRKTRKQSAKATLAEVIKEMAKPRVATSARE* |
| Ga0137392_106068331 | 3300011269 | Vadose Zone Soil | MGNMGKKKTKKQSAKTTLAEVIKEMAKPRVATSARE* |
| Ga0120114_10235294 | 3300011998 | Permafrost | MGAMRKKKTKKQSPEETLAEVIKEMAKPRVASSARE* |
| Ga0137388_100720592 | 3300012189 | Vadose Zone Soil | MGNMGKKKTKKQSAKTTLAEVVKEMAKPRVVSSARGQ* |
| Ga0137363_114401732 | 3300012202 | Vadose Zone Soil | VTSSTVDKKKTKEQSLKATLAEVTKEMAKPRVAMSARR* |
| Ga0182011_106268721 | 3300014496 | Fen | KSWVMGKRKTKKQSDKATLAEVVKEMAKPRVATSARE* |
| Ga0182024_100977623 | 3300014501 | Permafrost | MKLSHRTRGKKKSKKQSAKATLAEVVKEMAKPRVAMSARE* |
| Ga0182024_128966552 | 3300014501 | Permafrost | DAPGLVKSWGMGKRKTKKQSDKATLAEVIKEMAKPRVATSARE* |
| Ga0182030_109831192 | 3300014838 | Bog | MHEIIGTMGKKITKKKSAKATLAEVIKEMAKPRVATSARE* |
| Ga0157379_104751781 | 3300014968 | Switchgrass Rhizosphere | KTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL* |
| Ga0187802_100534162 | 3300017822 | Freshwater Sediment | MKSWVMGKRKTKKQLAKATLAEVVKEMAKPRVVMSAKE |
| Ga0187802_104050952 | 3300017822 | Freshwater Sediment | MAKKTPQKKSAKATLAEVIKEMAKERVAMSARGGL |
| Ga0187806_10888192 | 3300017928 | Freshwater Sediment | MAKKKTQKKSAKATLAEVIKEMAKERVAMSARGGL |
| Ga0187814_102252941 | 3300017932 | Freshwater Sediment | DAPGLVKSSGMGKRKTRKESAKATLAEVIKEMAKPRVVMSAKE |
| Ga0187801_103866772 | 3300017933 | Freshwater Sediment | MAKKKPQKKSAKATLAEVIKEMAKERVAMSARGGL |
| Ga0187809_102533502 | 3300017937 | Freshwater Sediment | MAKRKTQKKSAKATLAEVIREMAKERVAMSARGGL |
| Ga0187819_106341711 | 3300017943 | Freshwater Sediment | MKSWVMSKRKTKKQSAKATLAEVVKEMAKPRVVMSAKG |
| Ga0187865_11267291 | 3300018004 | Peatland | LVKSWVMGKRKTKKQSDKATLAEVVKEMAKPRVATSARE |
| Ga0187874_102559413 | 3300018019 | Peatland | GYMGKRKAKKQSAKATLAEVIKEMAKPRVATSARE |
| Ga0187869_105312532 | 3300018030 | Peatland | SWRMGKRKTKKQSAKVTLAEVIKEMAKPRVASSARE |
| Ga0187863_100276426 | 3300018034 | Peatland | MKASHGTIRKKKTKKQSAKATLAEVIKEMAKPRVAMSARE |
| Ga0187875_105343871 | 3300018035 | Peatland | MHEIIGTMGKKITKKKSAKATLAEVIKEMAKPRVATSARE |
| Ga0187862_107261801 | 3300018040 | Peatland | RSREIIAIMSKKKTKKQSDKETLAEVIKEMAKPRVATSARE |
| Ga0193723_11539042 | 3300019879 | Soil | MIEAMRKKKTKKQSAKVTLAEVIKEMAKPRVASSAKE |
| Ga0193728_11109132 | 3300019890 | Soil | MKLSHGTRGKKKSKKQSAKATLAEVMKEMAKPRVATSARE |
| Ga0193755_11162502 | 3300020004 | Soil | MAKRKTQKKSAKATLAEVIKEMAKPRVAMSARGGL |
| Ga0193749_10145353 | 3300020010 | Soil | MGKRKAKRESAKATLAKVIKEMAKPSVAMSARGGL |
| Ga0193721_11201752 | 3300020018 | Soil | MAKRKTPKKSAKATLAEVIKEMAKPRVAMSARGGS |
| Ga0210407_109783751 | 3300020579 | Soil | MIEAMGKKKTKKQSAKATLAEVIKEMAKPRVATSARE |
| Ga0210407_114811192 | 3300020579 | Soil | MAKKKTPKKSAKATLAEVIKEMAKERVAMSARGGL |
| Ga0210401_1000244218 | 3300020583 | Soil | VTSWGLWGKKKTKKQSAKAILAEVIKEMAKPRVARSAKE |
| Ga0210400_100094316 | 3300021170 | Soil | MMANMSKKKIKKQSPKATLAEVTREMAKPRVAESARKR |
| Ga0210385_105024152 | 3300021402 | Soil | MAKGEKQKQSAKATLADVIKEMAKPRVAKSVREHSPQRSK |
| Ga0210387_116509912 | 3300021405 | Soil | MAKRKTRKQSAKATLAEVIEEMAKRRVAMSARGGL |
| Ga0210384_106483531 | 3300021432 | Soil | MGKRKTKKQSAKATLAEVIKEMAKPRVAMSAREHSH |
| Ga0210402_100012607 | 3300021478 | Soil | MGKRKTKKQQDKATLAEIVKEMAKPRVAMSGRERSPTFLKHKY |
| Ga0210410_102731772 | 3300021479 | Soil | MAKKKIQKKSAKATLAEVIKEMAKERVAMSARGGL |
| Ga0224545_10544862 | 3300022881 | Soil | MAKKKTQKKSAKATLAEVIKEMAKERVAMSARSGL |
| Ga0224547_10011381 | 3300023255 | Soil | PGLVKSWGMGKRKTKKQSDKATLAEVVKEMAKPRVATSARE |
| Ga0208821_10632811 | 3300025432 | Peatland | IMGTMGKRKTKKQSAKATLAEVIKEMAKPRVATSARE |
| Ga0208190_10865951 | 3300025473 | Peatland | PRLVKSSAMGKRKTKKQSAKATLAEVVKEMAKPRVAMSARE |
| Ga0207642_100032032 | 3300025899 | Miscanthus Rhizosphere | MNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL |
| Ga0207685_100036161 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKRKAAKQSAKATLAEVLKVMAKPRVAVSARGGS |
| Ga0207657_111004901 | 3300025919 | Corn Rhizosphere | MNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQLYS |
| Ga0207679_102210051 | 3300025945 | Corn Rhizosphere | MNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVV |
| Ga0209890_102628542 | 3300026291 | Soil | MGTMRKKKTKKQSAKETLAEVIKEMAKPRVASSARE |
| Ga0209839_100359924 | 3300026294 | Soil | MGTMRKKKTQKQSAKETLAEVIKEMAKPRVASSARE |
| Ga0209839_102079152 | 3300026294 | Soil | TREVIWTMGKKKTKKQSSKATLAEVVKEMAKPRVATSAKE |
| Ga0209577_105581122 | 3300026552 | Soil | MAKRKTQKKSAKATLAEVIKEMAKPRVAMSARGGS |
| Ga0207497_1027972 | 3300026786 | Soil | KGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL |
| Ga0208730_10264032 | 3300027047 | Forest Soil | PVDAPGLVKSWRMGKRKTKKQSAKATLAEVIKEMAKPRVATSARE |
| Ga0209329_10438431 | 3300027605 | Forest Soil | RCMAKRKTQKRSAKATLAEVIKEMAKPRMTTVCKRA |
| Ga0209528_11033151 | 3300027610 | Forest Soil | MGKKKSKKQWNKATLAEVTKEMAKPRVARSAREYSHVF |
| Ga0209117_10180375 | 3300027645 | Forest Soil | MGKRKTKTKKQSAKATLAEVVKEMAKPRVAMSARE |
| Ga0209333_11382563 | 3300027676 | Forest Soil | MPKRRTQKQSAKVTLAEVIKEMAKSRVAMSAREDCHIVRME |
| Ga0209626_11499851 | 3300027684 | Forest Soil | METMNKKKTKKQSAKATLAEVTKEMAKPRVASSAR |
| Ga0209626_12106912 | 3300027684 | Forest Soil | MKKKTKKQSDKDTLAEVTKEMAKPRVAASARTQVPIL |
| Ga0209166_100512231 | 3300027857 | Surface Soil | MIANMSKKKIKKQSPKATLAEVTREMAKPRVAESARQP |
| Ga0209275_106736121 | 3300027884 | Soil | MAKRKTRKQSAKATLAEVIEEMAMRRVAMSARGGL |
| Ga0209380_104123903 | 3300027889 | Soil | MKPSLGTMGEKKAKRQSDKATLAEVIKEMAKPRVAMSARE |
| Ga0209415_103257092 | 3300027905 | Peatlands Soil | MKSWVMGKRKTKKQLAKAALAEVVKEMAKPRVVMSAKG |
| Ga0209006_107502561 | 3300027908 | Forest Soil | MAKRKPQKQSASETLAEVIKEMAKPRVVMSGTRTGK |
| Ga0209698_101138742 | 3300027911 | Watersheds | MAKRKTQKKSAKSTLAEVIKEMAKPRVAMSARGGS |
| Ga0265357_10081803 | 3300028023 | Rhizosphere | MVKKKTPKKSAKATLAEVIKEMAKERVAMSARGGL |
| Ga0209526_106986962 | 3300028047 | Forest Soil | MGGMGKTKAKKQSAKATLAEVIKEMAKPRVVASAK |
| Ga0209526_109551021 | 3300028047 | Forest Soil | MGKRKTKKQSAKATLPEVIKEMADPRVARSAREQSSGYSQ |
| Ga0265336_100804652 | 3300028666 | Rhizosphere | MKLSHRTTGKKKSKKQSAKATLAEVMKEMAKPRVAMSARE |
| Ga0311352_100309056 | 3300029944 | Palsa | MGKKKAKRQSDKATLAEVIKEMAKPRVAMSAREQSPF |
| Ga0311352_111645882 | 3300029944 | Palsa | MAKTKTKEQSAKATLAEVVKEMAKPRVAKSAREKSSAYSE |
| Ga0210254_106469911 | 3300030602 | Soil | MRKRKTKEQQDKATLAEVIKEMAKPRVAMSARERGHIV |
| Ga0316363_100984722 | 3300030659 | Peatlands Soil | MGKRKTKTKEQQDKATLAEVRKEMAKPRVAMSARE |
| Ga0302314_118258831 | 3300030906 | Palsa | MKPSHGTMGKKKAKRQSDKATLAEVIKEMAKPRVAMSAREQS |
| Ga0073994_124274751 | 3300030991 | Soil | MAKRKTTQQLAKATLAEVIKEMAKPRVAMSARGGL |
| Ga0265754_10095901 | 3300031040 | Soil | MAKRKTQKQSAKATLAEVIKEMAKKRVAMSARGGS |
| Ga0170824_1067501141 | 3300031231 | Forest Soil | ARARDIIGTVGKRKTKKQSAKATLAEVIKEMAKPRVTSSARGG |
| Ga0302140_107593302 | 3300031261 | Bog | MHEIIGTMSKKKTKKQSAKATLAEVIKEMAKPRVAASAKE |
| Ga0311367_115217351 | 3300031918 | Fen | DHWCMGKRKAKQQSAKAILAEVIKEMAKPRVVASAKQ |
| Ga0307479_109501311 | 3300031962 | Hardwood Forest Soil | MMANMSKKKIKKQSPKATLAEVTREMAKPRVAESARKP |
| Ga0311301_102168991 | 3300032160 | Peatlands Soil | MAKKKTQEKSAKATLAEVIKEMAKKRVAMSARGGL |
| Ga0311301_105493101 | 3300032160 | Peatlands Soil | MAKKKTQKKSVKATLAEVIKEMAKERVAMSARGGL |
| Ga0307471_1014084962 | 3300032180 | Hardwood Forest Soil | MGKRKTKKQSAKATLAEVVKEMAKPRAAASAREPRFLGKKF |
| Ga0334792_024954_625_747 | 3300033888 | Soil | MKLSHRTRGKKKSKKQSAKATLAEVVKEMAKPRVAMSARE |
| Ga0334792_057426_804_926 | 3300033888 | Soil | MGKRKTKKQSAKATLAEVIKEMAKPRVASSAREQSSVFLE |
| ⦗Top⦘ |