


| Basic Information | |
|---|---|
| Family ID | F069406 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.35 % |
| % of genes near scaffold ends (potentially truncated) | 36.29 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.613 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.097 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.258 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.516 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.46% β-sheet: 0.00% Coil/Unstructured: 61.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF07045 | DUF1330 | 56.45 |
| PF13577 | SnoaL_4 | 12.90 |
| PF04964 | Flp_Fap | 4.03 |
| PF00196 | GerE | 3.23 |
| PF01464 | SLT | 3.23 |
| PF07883 | Cupin_2 | 0.81 |
| PF07730 | HisKA_3 | 0.81 |
| PF02518 | HATPase_c | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 56.45 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 4.03 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.81 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.81 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.81 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.61 % |
| Unclassified | root | N/A | 23.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_11694597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1772 | Open in IMG/M |
| 3300000041|ARcpr5oldR_c017436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 630 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105600675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1757 | Open in IMG/M |
| 3300004479|Ga0062595_100009053 | All Organisms → cellular organisms → Bacteria | 3160 | Open in IMG/M |
| 3300004633|Ga0066395_10176697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1102 | Open in IMG/M |
| 3300004801|Ga0058860_11794396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 759 | Open in IMG/M |
| 3300005169|Ga0066810_10056438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 781 | Open in IMG/M |
| 3300005328|Ga0070676_10066105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2160 | Open in IMG/M |
| 3300005332|Ga0066388_100098732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3376 | Open in IMG/M |
| 3300005332|Ga0066388_101021085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1388 | Open in IMG/M |
| 3300005332|Ga0066388_102978187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| 3300005332|Ga0066388_106652152 | Not Available | 582 | Open in IMG/M |
| 3300005343|Ga0070687_101128360 | Not Available | 575 | Open in IMG/M |
| 3300005354|Ga0070675_100819895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 851 | Open in IMG/M |
| 3300005364|Ga0070673_100145157 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300005367|Ga0070667_100204411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1753 | Open in IMG/M |
| 3300005434|Ga0070709_10118444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1791 | Open in IMG/M |
| 3300005439|Ga0070711_101720567 | Not Available | 549 | Open in IMG/M |
| 3300005455|Ga0070663_101361968 | Not Available | 627 | Open in IMG/M |
| 3300005457|Ga0070662_101284531 | Not Available | 630 | Open in IMG/M |
| 3300005545|Ga0070695_100252417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1284 | Open in IMG/M |
| 3300005615|Ga0070702_100086602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1890 | Open in IMG/M |
| 3300005713|Ga0066905_100103945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1937 | Open in IMG/M |
| 3300005718|Ga0068866_10558400 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005719|Ga0068861_100396044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1224 | Open in IMG/M |
| 3300005764|Ga0066903_103668012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 826 | Open in IMG/M |
| 3300005764|Ga0066903_106968856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300006047|Ga0075024_100156693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
| 3300006057|Ga0075026_100274529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 912 | Open in IMG/M |
| 3300006163|Ga0070715_10082311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1464 | Open in IMG/M |
| 3300006575|Ga0074053_11994705 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006576|Ga0074047_11798406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1248 | Open in IMG/M |
| 3300006577|Ga0074050_11971910 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006578|Ga0074059_12137207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1255 | Open in IMG/M |
| 3300006755|Ga0079222_10369310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 980 | Open in IMG/M |
| 3300006806|Ga0079220_10528365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300006852|Ga0075433_10305726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
| 3300006954|Ga0079219_10320525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 974 | Open in IMG/M |
| 3300009011|Ga0105251_10060748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1778 | Open in IMG/M |
| 3300009101|Ga0105247_10286178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1138 | Open in IMG/M |
| 3300009156|Ga0111538_10920511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300009177|Ga0105248_12478919 | Not Available | 591 | Open in IMG/M |
| 3300009553|Ga0105249_10419499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1372 | Open in IMG/M |
| 3300009553|Ga0105249_10958218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 924 | Open in IMG/M |
| 3300010043|Ga0126380_10660754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
| 3300010359|Ga0126376_10293313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1410 | Open in IMG/M |
| 3300010361|Ga0126378_13076590 | Not Available | 531 | Open in IMG/M |
| 3300010366|Ga0126379_10196222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1937 | Open in IMG/M |
| 3300010371|Ga0134125_10848582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1004 | Open in IMG/M |
| 3300010373|Ga0134128_12854633 | Not Available | 532 | Open in IMG/M |
| 3300010398|Ga0126383_10694009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
| 3300010400|Ga0134122_10269704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1446 | Open in IMG/M |
| 3300011119|Ga0105246_11996889 | Not Available | 559 | Open in IMG/M |
| 3300012473|Ga0157340_1000303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1848 | Open in IMG/M |
| 3300012474|Ga0157356_1018342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 554 | Open in IMG/M |
| 3300012477|Ga0157336_1012900 | Not Available | 669 | Open in IMG/M |
| 3300012481|Ga0157320_1039775 | Not Available | 506 | Open in IMG/M |
| 3300012491|Ga0157329_1023861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 592 | Open in IMG/M |
| 3300012493|Ga0157355_1000849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1482 | Open in IMG/M |
| 3300012499|Ga0157350_1009889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 790 | Open in IMG/M |
| 3300012513|Ga0157326_1003263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1712 | Open in IMG/M |
| 3300012517|Ga0157354_1007530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1012 | Open in IMG/M |
| 3300012948|Ga0126375_11607310 | Not Available | 560 | Open in IMG/M |
| 3300012957|Ga0164303_10001705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6108 | Open in IMG/M |
| 3300012960|Ga0164301_10005073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4796 | Open in IMG/M |
| 3300012960|Ga0164301_10012806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3471 | Open in IMG/M |
| 3300012987|Ga0164307_10027248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3042 | Open in IMG/M |
| 3300012987|Ga0164307_10589500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 855 | Open in IMG/M |
| 3300013100|Ga0157373_11489909 | Not Available | 516 | Open in IMG/M |
| 3300013306|Ga0163162_12752822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 566 | Open in IMG/M |
| 3300013307|Ga0157372_11357758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 820 | Open in IMG/M |
| 3300015371|Ga0132258_12076312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1429 | Open in IMG/M |
| 3300017944|Ga0187786_10062252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1158 | Open in IMG/M |
| 3300017947|Ga0187785_10007408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3667 | Open in IMG/M |
| 3300017947|Ga0187785_10019739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2375 | Open in IMG/M |
| 3300017974|Ga0187777_10476384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 870 | Open in IMG/M |
| 3300018060|Ga0187765_10683112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 672 | Open in IMG/M |
| 3300018066|Ga0184617_1260274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 521 | Open in IMG/M |
| 3300018081|Ga0184625_10564604 | Not Available | 564 | Open in IMG/M |
| 3300021560|Ga0126371_11301050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 860 | Open in IMG/M |
| 3300021560|Ga0126371_11830663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 728 | Open in IMG/M |
| 3300024232|Ga0247664_1096567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 685 | Open in IMG/M |
| 3300025898|Ga0207692_10093420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1636 | Open in IMG/M |
| 3300025900|Ga0207710_10752849 | Not Available | 512 | Open in IMG/M |
| 3300025905|Ga0207685_10003201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3937 | Open in IMG/M |
| 3300025907|Ga0207645_11026093 | Not Available | 558 | Open in IMG/M |
| 3300025918|Ga0207662_10206340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1274 | Open in IMG/M |
| 3300025926|Ga0207659_10771137 | Not Available | 826 | Open in IMG/M |
| 3300025938|Ga0207704_10154685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1623 | Open in IMG/M |
| 3300025961|Ga0207712_10315566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1288 | Open in IMG/M |
| 3300026023|Ga0207677_10409321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1152 | Open in IMG/M |
| 3300026118|Ga0207675_100365883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1416 | Open in IMG/M |
| 3300026805|Ga0207507_105936 | Not Available | 500 | Open in IMG/M |
| 3300027560|Ga0207981_1018706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1247 | Open in IMG/M |
| 3300027765|Ga0209073_10150494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300028755|Ga0307316_10140945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 856 | Open in IMG/M |
| 3300028791|Ga0307290_10250114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 649 | Open in IMG/M |
| 3300028814|Ga0307302_10272394 | Not Available | 831 | Open in IMG/M |
| 3300028875|Ga0307289_10141009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 990 | Open in IMG/M |
| 3300031170|Ga0307498_10005271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2285 | Open in IMG/M |
| 3300031170|Ga0307498_10016007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1618 | Open in IMG/M |
| 3300031170|Ga0307498_10340200 | Not Available | 573 | Open in IMG/M |
| 3300031226|Ga0307497_10065201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1325 | Open in IMG/M |
| 3300031544|Ga0318534_10087418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1776 | Open in IMG/M |
| 3300031545|Ga0318541_10213109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1070 | Open in IMG/M |
| 3300031546|Ga0318538_10139521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1275 | Open in IMG/M |
| 3300031561|Ga0318528_10219484 | Not Available | 1019 | Open in IMG/M |
| 3300031561|Ga0318528_10428606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 710 | Open in IMG/M |
| 3300031720|Ga0307469_12482532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 506 | Open in IMG/M |
| 3300031744|Ga0306918_10015547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4466 | Open in IMG/M |
| 3300031780|Ga0318508_1170359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 621 | Open in IMG/M |
| 3300031819|Ga0318568_10693290 | Not Available | 633 | Open in IMG/M |
| 3300031910|Ga0306923_10818101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1027 | Open in IMG/M |
| 3300031946|Ga0310910_10915406 | Not Available | 687 | Open in IMG/M |
| 3300032059|Ga0318533_10977981 | Not Available | 621 | Open in IMG/M |
| 3300032089|Ga0318525_10692830 | Not Available | 518 | Open in IMG/M |
| 3300032094|Ga0318540_10108917 | Not Available | 1308 | Open in IMG/M |
| 3300032205|Ga0307472_102307756 | Not Available | 544 | Open in IMG/M |
| 3300032954|Ga0335083_10696017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 826 | Open in IMG/M |
| 3300033289|Ga0310914_10044485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3632 | Open in IMG/M |
| 3300033289|Ga0310914_10529552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1065 | Open in IMG/M |
| 3300033289|Ga0310914_10681085 | Not Available | 923 | Open in IMG/M |
| 3300034668|Ga0314793_152406 | Not Available | 523 | Open in IMG/M |
| 3300034672|Ga0314797_054908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 733 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 4.03% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 3.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.23% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026805 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0871.00001200 | 2162886013 | Switchgrass Rhizosphere | MSTFQVHAPVMPPLGGFARVISFFKTFAEVFLDARREAAVAHKRYPFADW |
| ARcpr5oldR_0174361 | 3300000041 | Arabidopsis Rhizosphere | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRY |
| INPhiseqgaiiFebDRAFT_1056006753 | 3300000364 | Soil | MSTFQVRAPEMSPLGGFARVISFFMTFAEAFLDAQREAAAAQKRYPFAAW* |
| Ga0062595_1000090537 | 3300004479 | Soil | MSTFQVHAPVMPPLGGFARVISFFKTFAEVFLDARREAAVAHKRYPFADW* |
| Ga0066395_101766973 | 3300004633 | Tropical Forest Soil | MSTFQVRAPVMSPLGGLARVISFFMTFTEVFLDAQREAAAAHKRYPFADW* |
| Ga0058860_117943962 | 3300004801 | Host-Associated | MSILQVHAPVVPRLGGFARVISFFKTFVEVFLDAQREAAAAHKRYPFADW* |
| Ga0066810_100564382 | 3300005169 | Soil | MSILQVHAPVVPQLGGFARVSFFKTFAEVFLDAQRDAAAAHKRYPFADW* |
| Ga0070676_100661053 | 3300005328 | Miscanthus Rhizosphere | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKCYPFADW* |
| Ga0066388_1000987327 | 3300005332 | Tropical Forest Soil | MSTFQVHAPVMPPIGGFARVISFLRTVAEVFLDAQREAAAAHKRYPFADW* |
| Ga0066388_1010210853 | 3300005332 | Tropical Forest Soil | MSTFQVHAPVMPPLGGFSRVISFFKTFADVFLDAQREAAGAHKRYPCTDW* |
| Ga0066388_1029781872 | 3300005332 | Tropical Forest Soil | MTALQVHAPAVPQFGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0066388_1066521522 | 3300005332 | Tropical Forest Soil | MSTFQVHAPVVPPLGGFARVVAFFKTFAEVFLDVQREAAAAHKRYPFADW* |
| Ga0070687_1011283602 | 3300005343 | Switchgrass Rhizosphere | PQLGAFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0070675_1008198953 | 3300005354 | Miscanthus Rhizosphere | MSTFQVHAPVMPPLGGFARVISFFKTFAEVFLDAQREAAVAHKRYPFADW* |
| Ga0070673_1001451571 | 3300005364 | Switchgrass Rhizosphere | MSILQVHAPVVPQLGGFARVSFFKTFAEVFLDAQREAAAAHKR |
| Ga0070667_1002044112 | 3300005367 | Switchgrass Rhizosphere | MSILQVHAPVVPQLGAFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0070709_101184441 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSILQVHAPVVPQLGGFARVSFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0070711_1017205672 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0070663_1013619682 | 3300005455 | Corn Rhizosphere | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTDW* |
| Ga0070662_1012845312 | 3300005457 | Corn Rhizosphere | MSTFQVHAPVMPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0070695_1002524173 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSILQVHAPVVPQLGGFARVISFFKTLAEVFLDAQREAAAAHKRYPFADW* |
| Ga0070702_1000866021 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSILQVRAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRY |
| Ga0066905_1001039453 | 3300005713 | Tropical Forest Soil | MSTFQVHAPAVPPLGGFARVVAFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0068866_105584003 | 3300005718 | Miscanthus Rhizosphere | LQVHAPVVPQLGAFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0068861_1003960444 | 3300005719 | Switchgrass Rhizosphere | FARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0066903_1036680121 | 3300005764 | Tropical Forest Soil | MSTFQVHAPVMPPVGGFARVISFFKTFAEVFLDAQREAAAAHRRYPFADW* |
| Ga0066903_1069688561 | 3300005764 | Tropical Forest Soil | MSVFRVHAPVMPPLDGFARVISFFKTFAEVYLDAQREAAAAHRRYPFADW* |
| Ga0075024_1001566933 | 3300006047 | Watersheds | MSTLQVHAPVVPPLGGFAHVISLLKTFAEVFLDAQRDAAAAHKRYPFADW* |
| Ga0075026_1002745293 | 3300006057 | Watersheds | MSTLQVHAPVVPPLGGFARVISLLKTFAEVFLDAQRDAAAAHKRYPFADW* |
| Ga0070715_100823111 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | APLRRRTMSILQVHAPVVPQLGGFARVSFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0074053_119947051 | 3300006575 | Soil | SILQVHAPVVPQLGGFARVSFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0074047_117984062 | 3300006576 | Soil | MSTLQVHAPVVPPLGGFARVISLLKTFAEVFLDAQRDAAAAHERYPFADW* |
| Ga0074050_119719103 | 3300006577 | Soil | LQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAVAAHKRYPFADW* |
| Ga0074059_121372071 | 3300006578 | Soil | RTAFSVNAAAPLRRRTMSILQVHAPVVPQLGGFARVSFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0079222_103693102 | 3300006755 | Agricultural Soil | LSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0079220_105283651 | 3300006806 | Agricultural Soil | MSILQVHAPVVPRFGGFARVISFFKTFVEVFLDAQREAAAAHKRYPFADW* |
| Ga0075433_103057262 | 3300006852 | Populus Rhizosphere | VPRLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTDW* |
| Ga0079219_103205252 | 3300006954 | Agricultural Soil | MSILQVHAPVVPRLGGFARVISFFKTFVEVFLDAQCEAAAAHKRYPFADW* |
| Ga0105251_100607481 | 3300009011 | Switchgrass Rhizosphere | MSILQVHAPVVPRLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0105247_102861782 | 3300009101 | Switchgrass Rhizosphere | VPQLGGFARVSFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0111538_109205113 | 3300009156 | Populus Rhizosphere | MSILQVHAPVVPRLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTDW* |
| Ga0105248_124789192 | 3300009177 | Switchgrass Rhizosphere | MWILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTDW* |
| Ga0105249_104194991 | 3300009553 | Switchgrass Rhizosphere | ARDRTTLSVHAAAPVRRRTMWILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0105249_109582182 | 3300009553 | Switchgrass Rhizosphere | MSILQVHAPVVLPLGGFARVISFFKTFAEVFLEAQREAAAAHKRYPFADW* |
| Ga0126380_106607543 | 3300010043 | Tropical Forest Soil | FQAHAPVMPPLGGFARVISFLETFAEVFYDAQREAAAAHKRYPFADW* |
| Ga0126376_102933133 | 3300010359 | Tropical Forest Soil | MSTFQVHAPVVPPLGGFARVVAFFQTFAEVFLDVQREAAAAHKRYPFADW* |
| Ga0126378_130765902 | 3300010361 | Tropical Forest Soil | MSTFQVYARVMPPLGGFSRVISFFKTFADVFLDAQREAAGAHKRYPCTDW* |
| Ga0126379_101962223 | 3300010366 | Tropical Forest Soil | MSTFQVHAPVMPPLGGFARVISFFKTFADVFLDAQREAAGAHKRYPCSDW* |
| Ga0134125_108485821 | 3300010371 | Terrestrial Soil | MSTLQVHAPVVPPLGGFARVISLLKTFAEVFLDARRDAAAAHKRYPFADW* |
| Ga0134128_128546331 | 3300010373 | Terrestrial Soil | TALSVNAAAPLRRRTMSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTDW* |
| Ga0126383_106940093 | 3300010398 | Tropical Forest Soil | MSTFQVHAPVMPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRFPYTDW* |
| Ga0134122_102697043 | 3300010400 | Terrestrial Soil | MSILQVHAPVVPQLGGFARVISFFKTLAEVFLDAQREAAATHKRYPFADW* |
| Ga0105246_119968891 | 3300011119 | Miscanthus Rhizosphere | DRTALSVNAAAPLRRRTMSILQVHAPVVPQLGAFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0157340_10003033 | 3300012473 | Arabidopsis Rhizosphere | MSILQVHAPVVPPLGGFARVISFFKTFVEVFLDAQREAAAAHKRYPFADW* |
| Ga0157356_10183423 | 3300012474 | Unplanted Soil | MSILQVHAPVVPQLGAFARVISFFKTFVEVFLDAQREAAAAHKRYPFADW* |
| Ga0157336_10129003 | 3300012477 | Arabidopsis Rhizosphere | MSILQVHAPVVPPLGGFARVISFFKTFVEVFLDAQREAAAAHK |
| Ga0157320_10397752 | 3300012481 | Arabidopsis Rhizosphere | RRTMSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0157329_10238613 | 3300012491 | Arabidopsis Rhizosphere | PVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTDW* |
| Ga0157355_10008491 | 3300012493 | Unplanted Soil | MSILQVHAPVVPPLGGFARVISFFKTFVEVFLDAQREAAAAHKRYPF |
| Ga0157350_10098893 | 3300012499 | Unplanted Soil | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAH |
| Ga0157326_10032634 | 3300012513 | Arabidopsis Rhizosphere | MSILQVHAPVVPQLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTDW* |
| Ga0157354_10075302 | 3300012517 | Unplanted Soil | MSILQVHAPVVPPLGGFARVILFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0126375_116073102 | 3300012948 | Tropical Forest Soil | MSTFQVHAPAVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPYTDW* |
| Ga0164303_1000170511 | 3300012957 | Soil | MSILQVHAPVVPPLGGFARVISFFKTFAEAFLDAQREAAAAHKRYPFTDW* |
| Ga0164301_100050732 | 3300012960 | Soil | MPPLGGFARVISFFKTFAEVFLDAQREAAVAHKRYPFADW* |
| Ga0164301_100128066 | 3300012960 | Soil | VPQLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0164307_100272486 | 3300012987 | Soil | MSILQVHAPVVPQLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW* |
| Ga0164307_105895002 | 3300012987 | Soil | MPPLGGFARVISFFKTFAEVFLDARREAAVAHKRYPFADW* |
| Ga0157373_114899091 | 3300013100 | Corn Rhizosphere | PLRRRTMSILQVHAPVVPQLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTDW* |
| Ga0163162_127528222 | 3300013306 | Switchgrass Rhizosphere | MWILQVHAPVVPPLGGFARVISFFKTFAEVFLEAQREAAAAHKRYPFADW* |
| Ga0157372_113577582 | 3300013307 | Corn Rhizosphere | MSILQVHAPVVPRLGGFARVISFFKTFAEVFLEAQREAAAAHKRYPFADW* |
| Ga0132258_120763123 | 3300015371 | Arabidopsis Rhizosphere | MSILQVHAPVVPPLGGFARVILFFKTFAEVFLDAQREAAAAHKRYPFTDW* |
| Ga0187786_100622524 | 3300017944 | Tropical Peatland | MSILQVHAPVVPPHGGFARVISFFKTLAEVFLDAQREAAAAHKRYPF |
| Ga0187785_100074085 | 3300017947 | Tropical Peatland | MSTFRVHAPVMPPVGGFARVFSFFKAFAEVFLDAQREAAAAHRRYPFADW |
| Ga0187785_100197396 | 3300017947 | Tropical Peatland | MSILQVHAPVVPPHGGFARVISFFKTLAEVFLDAQREAAAAHKRYPFADW |
| Ga0187777_104763841 | 3300017974 | Tropical Peatland | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Ga0187765_106831121 | 3300018060 | Tropical Peatland | PVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Ga0184617_12602743 | 3300018066 | Groundwater Sediment | MSTLQVHAPTMLSSGGFARVVSFINTCVEVFLDAQREAAAAHKRFPFTDW |
| Ga0184625_105646042 | 3300018081 | Groundwater Sediment | MSTMPVQAHAGPSFGGFARVVSFLSTCVEVFLDAQREATAAHRRYPFTDW |
| Ga0126371_113010503 | 3300021560 | Tropical Forest Soil | MSTFQVHAPVMPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0126371_118306631 | 3300021560 | Tropical Forest Soil | MSTFQVHAPVMPPVGGFARVISFFKTFAEVFLDAQREAAAAHRRYPFADW |
| Ga0247664_10965673 | 3300024232 | Soil | MSILQVHAPVVPRLGGFARVISFFKTFVEVFLDAQREAAAAHKRYPFADW |
| Ga0207692_100934202 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSILQVHAPVVPQLGGFARVSFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Ga0207710_107528492 | 3300025900 | Switchgrass Rhizosphere | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTDW |
| Ga0207685_100032014 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSILQVHAPVVPQLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Ga0207645_110260933 | 3300025907 | Miscanthus Rhizosphere | APVMPPLGGFARVISFFKTFAEVFLDARREAAVAHKRYPFADW |
| Ga0207662_102063404 | 3300025918 | Switchgrass Rhizosphere | PQLGAFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Ga0207659_107711372 | 3300025926 | Miscanthus Rhizosphere | MSTFQVHAPVMPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Ga0207704_101546851 | 3300025938 | Miscanthus Rhizosphere | TMSILQVHAPVVPQLGAFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Ga0207712_103155663 | 3300025961 | Switchgrass Rhizosphere | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLEAQREAAAAHKRYPFADW |
| Ga0207677_104093214 | 3300026023 | Miscanthus Rhizosphere | MSILQVHAPVVPRLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Ga0207675_1003658831 | 3300026118 | Switchgrass Rhizosphere | VHAPVVPPLGGFARVISFFKTFAEVFLEAQREAAAAHKRYPFADW |
| Ga0207507_1059362 | 3300026805 | Soil | PVVPPLGGFARVISFFKMFAEVFLDAQREAAAAHKRYPFTDW |
| Ga0207981_10187063 | 3300027560 | Soil | MSTLQVHAPVVPPLGGFARVISLLKTFAEVFLDAQRDAAAAHKRYPFADW |
| Ga0209073_101504942 | 3300027765 | Agricultural Soil | MSILQVHAPVVPRFGGFARVISFFKTFVEVFLDAQREAAAAHKRYPFADW |
| Ga0307316_101409451 | 3300028755 | Soil | MLSSGGFASVVSFINTCVEVFLDAQREAAAAHKRFPFTDW |
| Ga0307290_102501141 | 3300028791 | Soil | MLSSGGLARVVSFINTCVEVFLDAQREAAAAHKRFPFTDW |
| Ga0307302_102723942 | 3300028814 | Soil | MSTMPVQAHAGPSFGGFARVVSLLSTCVEVFLDAQREATAAHRRYPFTDW |
| Ga0307289_101410093 | 3300028875 | Soil | GFARVVSFINTCVEVFLDAQREAAAAHKRFPFTDW |
| Ga0307498_100052712 | 3300031170 | Soil | VVPPLGGFACVISFFKTFAEVFLDAQREAAAAHKRYPFTDW |
| Ga0307498_100160073 | 3300031170 | Soil | MSTMPVQAHAGPSFGGFARVVFFLSTCVEVFLDAQREATAAHRRYPFTDW |
| Ga0307498_103402002 | 3300031170 | Soil | MSTIPVQAHAVPSFGGFARVVSFLSTCVEVFLDAQREATAAHRRYPFTDW |
| Ga0307497_100652014 | 3300031226 | Soil | LQVHAPVVPPLGGFACVISFFKTFAEVFLDAQREAAAAHKRYPFTDW |
| Ga0318534_100874184 | 3300031544 | Soil | HIHVPVMPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0318541_102131093 | 3300031545 | Soil | PVVPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0318538_101395213 | 3300031546 | Soil | MSTFQVHAPVMPPLGGFARIISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0318528_102194843 | 3300031561 | Soil | MSTFQVHAPVVPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYPY |
| Ga0318528_104286061 | 3300031561 | Soil | FQVYAPVMPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0307469_124825322 | 3300031720 | Hardwood Forest Soil | MSTLQVHAPVVPPLSGFARVISYVKTFAEVFLDAQGDAAAAHKRYAFADW |
| Ga0306918_100155472 | 3300031744 | Soil | MSTFHIHVPVMPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0318508_11703593 | 3300031780 | Soil | PVMPPLGGFARIISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0318568_106932902 | 3300031819 | Soil | MSTFQIHVPVMPPLGGFARIISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0306923_108181013 | 3300031910 | Soil | GFGRVMVFLTTFFEVIVDAQREAAAAHKRYPFAEW |
| Ga0310910_109154062 | 3300031946 | Soil | MSTFQVHAPVVPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0318533_109779813 | 3300032059 | Soil | MSTFQIHVPVMPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYRY |
| Ga0318525_106928302 | 3300032089 | Soil | CTMSTFQVHAPVMPPLGGFARIISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0318540_101089172 | 3300032094 | Soil | MSTFQIHVPVMPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYRYTDW |
| Ga0307472_1023077561 | 3300032205 | Hardwood Forest Soil | TAPLRCAMSTFQVHAPVMPPLGGFARVISFFKTFAEVFLDAQREAAVAHKRYPFADW |
| Ga0335083_106960171 | 3300032954 | Soil | MSILQVHAPVVPPHGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFADW |
| Ga0310914_100444856 | 3300033289 | Soil | LGGFARVISFFKTFAEVFLDAQRDAAAAHKRYPYTDW |
| Ga0310914_105295521 | 3300033289 | Soil | TFTGFGRVMVFLTTFFEVIVDAQREAAAAHKRYPFAEW |
| Ga0310914_106810851 | 3300033289 | Soil | MSTFHIHVPVMPPLGGFARVISFFKTFAEVFLDAQRDAAAAHKRYRYTDW |
| Ga0314793_152406_324_476 | 3300034668 | Soil | MSILQVHAPVVPPLGGFARVISFFKTCAEVFLVAQREAAAAHKRYPFTDW |
| Ga0314797_054908_298_450 | 3300034672 | Soil | MSILQVHAPVVPPLGGFARVISFFKTFAEVFLDAQREAAAAHKRYPFTEW |
| ⦗Top⦘ |