


| Basic Information | |
|---|---|
| Family ID | F069359 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNK |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.81 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.35 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (41.935 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (46.774 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.290 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.548 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.43% β-sheet: 0.00% Coil/Unstructured: 78.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF16778 | Phage_tail_APC | 6.45 |
| PF01555 | N6_N4_Mtase | 6.45 |
| PF07484 | Collar | 0.81 |
| PF00622 | SPRY | 0.81 |
| PF04055 | Radical_SAM | 0.81 |
| PF02195 | ParBc | 0.81 |
| PF09636 | XkdW | 0.81 |
| PF05345 | He_PIG | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 6.45 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 6.45 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 6.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10217897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300001353|JGI20159J14440_10179810 | Not Available | 593 | Open in IMG/M |
| 3300001450|JGI24006J15134_10154349 | Not Available | 748 | Open in IMG/M |
| 3300001450|JGI24006J15134_10159887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300001460|JGI24003J15210_10066776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1136 | Open in IMG/M |
| 3300001472|JGI24004J15324_10084574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P | 850 | Open in IMG/M |
| 3300002514|JGI25133J35611_10200131 | Not Available | 524 | Open in IMG/M |
| 3300004112|Ga0065166_10519591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300005408|Ga0066848_10027095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1616 | Open in IMG/M |
| 3300005551|Ga0066843_10205145 | Not Available | 554 | Open in IMG/M |
| 3300005595|Ga0066833_10158935 | Not Available | 621 | Open in IMG/M |
| 3300005603|Ga0066853_10297839 | Not Available | 528 | Open in IMG/M |
| 3300005931|Ga0075119_1129641 | Not Available | 530 | Open in IMG/M |
| 3300006029|Ga0075466_1125200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300006091|Ga0082018_1101562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300006164|Ga0075441_10012749 | All Organisms → Viruses → Predicted Viral | 3548 | Open in IMG/M |
| 3300006190|Ga0075446_10230998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300006340|Ga0068503_10960037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 610 | Open in IMG/M |
| 3300006736|Ga0098033_1091040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptostreptococcaceae → Clostridioides → Clostridioides mangenotii | 871 | Open in IMG/M |
| 3300006736|Ga0098033_1176358 | Not Available | 595 | Open in IMG/M |
| 3300006738|Ga0098035_1220357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300006738|Ga0098035_1322544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300006750|Ga0098058_1131674 | Not Available | 666 | Open in IMG/M |
| 3300006754|Ga0098044_1286231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300006793|Ga0098055_1229660 | Not Available | 700 | Open in IMG/M |
| 3300006793|Ga0098055_1347167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 552 | Open in IMG/M |
| 3300006900|Ga0066376_10432419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300006923|Ga0098053_1101312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300006926|Ga0098057_1103109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 696 | Open in IMG/M |
| 3300006927|Ga0098034_1031256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1605 | Open in IMG/M |
| 3300006928|Ga0098041_1297802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300006990|Ga0098046_1148761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300007236|Ga0075463_10118533 | Not Available | 855 | Open in IMG/M |
| 3300007291|Ga0066367_1387309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300008050|Ga0098052_1403016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300008114|Ga0114347_1216893 | Not Available | 620 | Open in IMG/M |
| 3300008216|Ga0114898_1160732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300008219|Ga0114905_1177091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300008221|Ga0114916_1137048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
| 3300009173|Ga0114996_10676595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300009193|Ga0115551_1362432 | Not Available | 627 | Open in IMG/M |
| 3300009409|Ga0114993_10451102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
| 3300009413|Ga0114902_1189883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300009418|Ga0114908_1194236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300009498|Ga0115568_10290198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 726 | Open in IMG/M |
| 3300009604|Ga0114901_1220530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300009605|Ga0114906_1075079 | Not Available | 1246 | Open in IMG/M |
| 3300009786|Ga0114999_10599085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
| 3300010150|Ga0098056_1172348 | All Organisms → Viruses → environmental samples → uncultured virus | 727 | Open in IMG/M |
| 3300010151|Ga0098061_1214875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300010155|Ga0098047_10162104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300010155|Ga0098047_10286892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300010296|Ga0129348_1094215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1058 | Open in IMG/M |
| 3300010296|Ga0129348_1277612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300010354|Ga0129333_11434218 | Not Available | 567 | Open in IMG/M |
| 3300010883|Ga0133547_10581518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 2244 | Open in IMG/M |
| 3300010883|Ga0133547_10687390 | Not Available | 2029 | Open in IMG/M |
| 3300010883|Ga0133547_11337943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P | 1357 | Open in IMG/M |
| 3300011252|Ga0151674_1072302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300012520|Ga0129344_1037084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300017718|Ga0181375_1066221 | Not Available | 594 | Open in IMG/M |
| 3300017738|Ga0181428_1127423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 597 | Open in IMG/M |
| 3300017749|Ga0181392_1006490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3975 | Open in IMG/M |
| 3300017759|Ga0181414_1102096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300017762|Ga0181422_1067466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1135 | Open in IMG/M |
| 3300017769|Ga0187221_1224855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 536 | Open in IMG/M |
| 3300017773|Ga0181386_1193788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 612 | Open in IMG/M |
| 3300017775|Ga0181432_1302298 | Not Available | 508 | Open in IMG/M |
| 3300017779|Ga0181395_1055706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1298 | Open in IMG/M |
| 3300017781|Ga0181423_1009654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Pelagibacter phage HTVC025P | 4099 | Open in IMG/M |
| 3300017783|Ga0181379_1270570 | Not Available | 582 | Open in IMG/M |
| 3300017786|Ga0181424_10025367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → unclassified Autographiviridae → Pelagibacter phage HTVC025P | 2570 | Open in IMG/M |
| 3300017956|Ga0181580_10758377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 614 | Open in IMG/M |
| 3300017969|Ga0181585_11056593 | Not Available | 516 | Open in IMG/M |
| 3300018415|Ga0181559_10454831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300018420|Ga0181563_10838643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300018423|Ga0181593_11233022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 502 | Open in IMG/M |
| 3300020396|Ga0211687_10078810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1423 | Open in IMG/M |
| 3300020456|Ga0211551_10647012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300020467|Ga0211713_10655465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300022074|Ga0224906_1136234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P → Pelagibacter phage HTVC019P | 701 | Open in IMG/M |
| 3300022200|Ga0196901_1049813 | Not Available | 1567 | Open in IMG/M |
| 3300022200|Ga0196901_1168018 | Not Available | 721 | Open in IMG/M |
| 3300023110|Ga0255743_10453181 | Not Available | 620 | Open in IMG/M |
| 3300025069|Ga0207887_1051190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300025071|Ga0207896_1043556 | All Organisms → Viruses | 745 | Open in IMG/M |
| 3300025084|Ga0208298_1074937 | Not Available | 634 | Open in IMG/M |
| 3300025086|Ga0208157_1029261 | All Organisms → Viruses | 1603 | Open in IMG/M |
| 3300025098|Ga0208434_1105403 | Not Available | 546 | Open in IMG/M |
| 3300025103|Ga0208013_1118885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300025108|Ga0208793_1153053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300025109|Ga0208553_1030250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1396 | Open in IMG/M |
| 3300025109|Ga0208553_1059730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300025114|Ga0208433_1117583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300025118|Ga0208790_1161658 | All Organisms → Viruses | 613 | Open in IMG/M |
| 3300025137|Ga0209336_10007383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P | 4629 | Open in IMG/M |
| 3300025138|Ga0209634_1071413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Votkovvirus → unclassified Votkovvirus → Pelagibacter phage HTVC200P | 1629 | Open in IMG/M |
| 3300025168|Ga0209337_1093511 | All Organisms → Viruses | 1421 | Open in IMG/M |
| 3300025168|Ga0209337_1319533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300025244|Ga0207908_1045478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300025268|Ga0207894_1078770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300025270|Ga0208813_1089043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 628 | Open in IMG/M |
| 3300025674|Ga0208162_1172583 | All Organisms → Viruses | 573 | Open in IMG/M |
| 3300025685|Ga0209095_1221275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300025699|Ga0209715_1115702 | Not Available | 961 | Open in IMG/M |
| 3300025769|Ga0208767_1143252 | Not Available | 882 | Open in IMG/M |
| 3300025818|Ga0208542_1128853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300025876|Ga0209223_10154695 | All Organisms → Viruses | 1173 | Open in IMG/M |
| 3300025889|Ga0208644_1282152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300025890|Ga0209631_10078508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1980 | Open in IMG/M |
| 3300025892|Ga0209630_10259278 | All Organisms → Viruses | 811 | Open in IMG/M |
| 3300026206|Ga0207988_1111218 | Not Available | 626 | Open in IMG/M |
| 3300026208|Ga0208640_1120967 | Not Available | 533 | Open in IMG/M |
| 3300026211|Ga0208132_1147332 | Not Available | 508 | Open in IMG/M |
| 3300026260|Ga0208408_1142734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage HTVC121P | 674 | Open in IMG/M |
| 3300027771|Ga0209279_10096910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 842 | Open in IMG/M |
| 3300027838|Ga0209089_10300299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 915 | Open in IMG/M |
| 3300027847|Ga0209402_10676050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300028335|Ga0247566_1061691 | All Organisms → Viruses | 627 | Open in IMG/M |
| 3300031644|Ga0308001_10314857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 585 | Open in IMG/M |
| 3300031695|Ga0308016_10323888 | Not Available | 561 | Open in IMG/M |
| 3300031775|Ga0315326_10957341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300032277|Ga0316202_10564876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300034655|Ga0326746_028552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 581 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 46.77% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.68% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 8.06% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.26% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.84% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.84% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.23% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.23% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.42% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.61% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.81% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.81% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.81% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.81% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.81% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005408 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 | Environmental | Open in IMG/M |
| 3300005551 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF89A | Environmental | Open in IMG/M |
| 3300005595 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006091 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025244 | Marine viral communities from the Deep Pacific Ocean - MSP-81 (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026206 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 (SPAdes) | Environmental | Open in IMG/M |
| 3300026208 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 (SPAdes) | Environmental | Open in IMG/M |
| 3300026211 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV199 (SPAdes) | Environmental | Open in IMG/M |
| 3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028335 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034655 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_102178973 | 3300000115 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDI |
| JGI20159J14440_101798103 | 3300001353 | Pelagic Marine | VKYYNKGIAAHLEAILKLQDDDHLVFENLQGQGPIDIITVNKQT |
| JGI24006J15134_101543493 | 3300001450 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPID |
| JGI24006J15134_101598873 | 3300001450 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVIYY |
| JGI24003J15210_100667761 | 3300001460 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPID |
| JGI24004J15324_100845741 | 3300001472 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTG |
| JGI25133J35611_102001311 | 3300002514 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTV |
| Ga0065166_105195911 | 3300004112 | Freshwater Lake | LKHYNKGIAAHMIAILELVDDDHLVFTNVNGVGPIDIVTVNTKTGKVDLY |
| Ga0066848_100270951 | 3300005408 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNI |
| Ga0066843_102051451 | 3300005551 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKS |
| Ga0066833_101589351 | 3300005595 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTFYD |
| Ga0066853_102978393 | 3300005603 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSG |
| Ga0075119_11296411 | 3300005931 | Saline Lake | VKFYNKGIAAHLEALLKLQDDDHLIFENLQGVGPIDIITVN |
| Ga0075466_11252001 | 3300006029 | Aqueous | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPI |
| Ga0082018_11015623 | 3300006091 | Marine | VKYYNKGIAAHLIAMLELLDDDHLIFTNVQGIGPIDRVTVNIKTG |
| Ga0075441_100127497 | 3300006164 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDLITVNKETGKVT |
| Ga0075446_102309983 | 3300006190 | Marine | VKYYNKGIAAHLETILKLQDDDHLVFEAVQAVGPIDIITVNKETGKVT |
| Ga0068503_109600371 | 3300006340 | Marine | VKYFNKGIAAHLEAMLKLLDDDHLIFTNQFGVGPIDIVTVNIKTGKVDL |
| Ga0098033_10910401 | 3300006736 | Marine | MKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTF |
| Ga0098033_11763581 | 3300006736 | Marine | MKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPI |
| Ga0098035_12203574 | 3300006738 | Marine | VKYYNKGIAAHLIAMLELLDDDHLIFTNTNGVGPI |
| Ga0098035_13225441 | 3300006738 | Marine | MKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSG |
| Ga0098058_11316742 | 3300006750 | Marine | MKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIVPIDIIT |
| Ga0098044_12862311 | 3300006754 | Marine | VKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVTVNIKTGKVDF |
| Ga0098055_12296604 | 3300006793 | Marine | VKYYNKGIAAHLEAMLELLDDDHLLFTNVQGLGPIDIVRVNIHTGK |
| Ga0098055_13471671 | 3300006793 | Marine | VKYYNKGIAAHLIAMLELLDDDHLIFTNVQGIGPIDIVRVNIKTGEVD |
| Ga0066376_104324194 | 3300006900 | Marine | VKYFNKGIAAHLEAMLELLDDEHLIFTNVQVVGPIDIVRVNIHTG |
| Ga0098053_11013121 | 3300006923 | Marine | VKYYNKGIAAHLEAMLELLDDDHLLFTNVQGLGPIDIVRVNIHTGKTDF |
| Ga0098057_11031094 | 3300006926 | Marine | VKYFNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIKSGEVTF |
| Ga0098034_10312565 | 3300006927 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNI |
| Ga0098041_12978022 | 3300006928 | Marine | VRYFNKGIAAHLEALLKLLDDDHLIFTNLFGVGPIDVV |
| Ga0098046_11487613 | 3300006990 | Marine | VKYYNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDIVRV |
| Ga0075463_101185334 | 3300007236 | Aqueous | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHSGKVTF |
| Ga0066367_13873091 | 3300007291 | Marine | VKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVRVNIKTGEVD |
| Ga0098052_14030161 | 3300008050 | Marine | VKYYNKGIAAHLQAMLQLLDDDHLLFTNVQGIGPIDI |
| Ga0114347_12168933 | 3300008114 | Freshwater, Plankton | LKYYNKGIAAHVIAILELLDDDHLVFTNVNGVGPIDIVTVNTKTGK |
| Ga0114898_11607321 | 3300008216 | Deep Ocean | VKYYNKGIKAHLIAMQELLDDDHLIFQNVQGIGPIDI |
| Ga0114905_11770911 | 3300008219 | Deep Ocean | VKYYNKGIAAHLIAMLELLDDDHLIFSNVQGIGPIDIVTVNIKSGDVN |
| Ga0114916_11370483 | 3300008221 | Deep Ocean | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDLITV |
| Ga0114996_106765951 | 3300009173 | Marine | VKYYNKGIAAHLEAILKLQDDDHLIFENLQGVGPIDIITVNKETGKVTF |
| Ga0115551_13624323 | 3300009193 | Pelagic Marine | VKYYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKE |
| Ga0114993_104511021 | 3300009409 | Marine | VKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVTVN |
| Ga0114902_11898832 | 3300009413 | Deep Ocean | VKYYNKGIAAHLIAMLELLNDDHLVFTNVQGIGPIDI |
| Ga0114908_11942363 | 3300009418 | Deep Ocean | VKYYNKGIKAHLIAMQELLDDDHLIFQNVQGIGPIDIVRVNIHTGAVEFFD |
| Ga0115568_102901983 | 3300009498 | Pelagic Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENIEGVGPIDIITVNK |
| Ga0114901_12205301 | 3300009604 | Deep Ocean | VKYYNKGIKAHLIAMQELLDDDHLIFQNVQGIGPI |
| Ga0114906_10750791 | 3300009605 | Deep Ocean | VKYYNKGIAAHLIAMLELLDDDHLIFSCVNGIGPIDIVT |
| Ga0114999_105990851 | 3300009786 | Marine | VKYYNKGIAAHLEAILKLQDDDHLVFENLQGQGPIDIITVNKQTGKVTFYDAKS |
| Ga0098056_11723481 | 3300010150 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFQNIQGVGPID |
| Ga0098061_12148751 | 3300010151 | Marine | VKYFNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDIVRVNIHTGEVDFYDA |
| Ga0098047_101621042 | 3300010155 | Marine | MKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVK |
| Ga0098047_102868922 | 3300010155 | Marine | VKYYNKGIAAHLIAMLELLDDDHLIFSNTQGIGPIDIVTVNIKTGKV |
| Ga0129348_10942154 | 3300010296 | Freshwater To Marine Saline Gradient | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDII |
| Ga0129348_12776123 | 3300010296 | Freshwater To Marine Saline Gradient | LKFYNKGIAAHLTAMLELLDDDHLVFTNLFGVGPIDIVTVNLKTGEVQFYD |
| Ga0129333_114342181 | 3300010354 | Freshwater To Marine Saline Gradient | LKYYNKGIAAHIIAILELLDDDHLIFTNVNGVGPID |
| Ga0133547_105815181 | 3300010883 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKH |
| Ga0133547_106873905 | 3300010883 | Marine | VRYFNKGIAAHLEAMLKLLDDDHLIFTNLQGVGPIDIVTVNIK |
| Ga0133547_113379431 | 3300010883 | Marine | VKYFNKGIAAHLEAMLKLLDDDHLIFTNQFGVGPIDI |
| Ga0151674_10723021 | 3300011252 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKHTGKV |
| Ga0129344_10370843 | 3300012520 | Aqueous | VKYYNNGIAAHLTAMLELIDDDHLLFTNVNGVGPIDIVRVNIY |
| Ga0181375_10662212 | 3300017718 | Marine | MKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPIDIVTVNIK |
| Ga0181428_11274233 | 3300017738 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKQTGEVTFYDAKSD |
| Ga0181392_10064907 | 3300017749 | Seawater | VKFYNKGIAANLEAILKLLDDDHLVFENIQGVGPIDIITVNKK |
| Ga0181414_11020964 | 3300017759 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIVIMTVSKK |
| Ga0181422_10674661 | 3300017762 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKR |
| Ga0187221_12248553 | 3300017769 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKET |
| Ga0181386_11937883 | 3300017773 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYDA |
| Ga0181432_13022981 | 3300017775 | Seawater | VRYYNKGIAAHLEAMLKLLDDDHLIFTNQFGVGPIDIVTVNIKTGKVDFYD |
| Ga0181395_10557064 | 3300017779 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKETG |
| Ga0181423_10096544 | 3300017781 | Seawater | VKFYNKSIAAHLEAILKLLDDDHLVFENIQGVGPIDIITV |
| Ga0181379_12705703 | 3300017783 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKPGEVTY |
| Ga0181424_100253671 | 3300017786 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYY |
| Ga0181580_107583773 | 3300017956 | Salt Marsh | VKHYNKGIAAHLEAILKLLDDDHLVFQNIQGIGPIDIVTVNKHSG |
| Ga0181585_110565933 | 3300017969 | Salt Marsh | VKYYNKGIAAHLITMLELLDDDHLIFSNVCGVGPIDVVTVN |
| Ga0181559_104548313 | 3300018415 | Salt Marsh | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNK |
| Ga0181563_108386433 | 3300018420 | Salt Marsh | VKYYNKGIAAHLEAILKLLDDDHLVFQNIQGVGPIDIVTVNK |
| Ga0181593_112330223 | 3300018423 | Salt Marsh | VKYYNKGITAHYEAVIKLLDDDHLVFTNVNGVGPIDIVRINIHT |
| Ga0211687_100788101 | 3300020396 | Marine | VKYYNKGIAAHLEAILKLQDDDHLVFENLQGQGPIDIITV |
| Ga0211551_106470123 | 3300020456 | Marine | VKYFNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDIVRVNIHTGKVDFY |
| Ga0211713_106554653 | 3300020467 | Marine | VKYFNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDIVRVNIHT |
| Ga0224906_11362343 | 3300022074 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPL |
| Ga0196901_10498135 | 3300022200 | Aqueous | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHTGKVI |
| Ga0196901_11680183 | 3300022200 | Aqueous | VKYYNNGIAAHLTAMLELLDDDHLLFTNVNGVGPVD |
| Ga0255743_104531811 | 3300023110 | Salt Marsh | VKPYNKGIAAQLTAMLELQDDNHLVFTNLFGVGPIDIVTVNLNSGE |
| Ga0207887_10511904 | 3300025069 | Marine | VKYYNKGIAAHLIAMLELLDDDHLIFSCVNGIGPIDIVTVN |
| Ga0207896_10435561 | 3300025071 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKKTGE |
| Ga0208298_10749371 | 3300025084 | Marine | VKYYNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDI |
| Ga0208157_10292611 | 3300025086 | Marine | VKYYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTY |
| Ga0208434_11054033 | 3300025098 | Marine | VKYYNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDIV |
| Ga0208013_11188851 | 3300025103 | Marine | VKYYNKGIAAHLEAMLELLDDDHLLFTNVQGIGPIDIVRVNIHTGKADF |
| Ga0208793_11530533 | 3300025108 | Marine | VKYYNKGIAAHLEAMLKLLDDNHLLFTNVQGLGPIDIVRVN |
| Ga0208553_10302501 | 3300025109 | Marine | VKYYNKGIAAHLEAMLELLDDEHLIFSNTFGIGPIDIITV |
| Ga0208553_10597303 | 3300025109 | Marine | MKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKT |
| Ga0208433_11175831 | 3300025114 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVKFY |
| Ga0208790_11616581 | 3300025118 | Marine | VRYFNKGIAAHLEAMLKLLDDDHLIFSNQFGVGPIDIVTVNI |
| Ga0209336_100073831 | 3300025137 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGK |
| Ga0209634_10714131 | 3300025138 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKHTGEVTF |
| Ga0209337_10935111 | 3300025168 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTY |
| Ga0209337_13195331 | 3300025168 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKQTGE |
| Ga0207908_10454781 | 3300025244 | Deep Ocean | VKYYNKGIKAHLIAMQELLDDDHLIFSNTLGIGPIDI |
| Ga0207894_10787702 | 3300025268 | Deep Ocean | MKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKTGKVDF |
| Ga0208813_10890434 | 3300025270 | Deep Ocean | VKYYNKGIAAHLEAMLELLDDDHLLFTNVQGIGPI |
| Ga0208162_11725833 | 3300025674 | Aqueous | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVIYYDA |
| Ga0209095_12212751 | 3300025685 | Pelagic Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKNTGK |
| Ga0209715_11157021 | 3300025699 | Pelagic Marine | VKYYNKGIAAHLEAILKLQDDDHLVFENLQGQGPIDIITVNKQ |
| Ga0208767_11432521 | 3300025769 | Aqueous | VKYYNRGIVAHLTAAIDLLDDDHLLFENIQGQGPIDIVRINIKTGKV |
| Ga0208542_11288534 | 3300025818 | Aqueous | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIVTVNKHSGKVTFYDA |
| Ga0209223_101546954 | 3300025876 | Pelagic Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKETGKVTFYD |
| Ga0208644_12821524 | 3300025889 | Aqueous | VKYYNNGIAAHLTAMLELLDDDHLLFTNVNGVGPIDIVRVNI |
| Ga0209631_100785081 | 3300025890 | Pelagic Marine | VKYYNRGIVAHLTAAIDLLDDDHLLFENIQGQGPI |
| Ga0209630_102592784 | 3300025892 | Pelagic Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDIITVNKQT |
| Ga0207988_11112184 | 3300026206 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFNNTFGLGPI |
| Ga0208640_11209672 | 3300026208 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDII |
| Ga0208132_11473323 | 3300026211 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPID |
| Ga0208408_11427343 | 3300026260 | Marine | VKYYNKGIAAHLEAMLELLDDDHLIFSNTFGIGPIDIITVNIKSGEVNF |
| Ga0209279_100969103 | 3300027771 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDLITVNKQTGKV |
| Ga0209089_103002994 | 3300027838 | Marine | VKYYNKGIAAHLEAILKLQDDDHLIFENLQGVGPIDI |
| Ga0209402_106760501 | 3300027847 | Marine | VKYYNKGIAAHLEAILKLQDDDHLVFENLQGQGPIDI |
| Ga0247566_10616911 | 3300028335 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIIT |
| Ga0308001_103148573 | 3300031644 | Marine | VKFYNKGIAAHLEAILKLLDDDHLVFENLQGQGPIDLITVNK |
| Ga0308016_103238881 | 3300031695 | Marine | VKYYNKGIAAHLEAILKLQDDDHLLFENIQGVGPIDIITVNKQT |
| Ga0315326_109573411 | 3300031775 | Seawater | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITV |
| Ga0316202_105648763 | 3300032277 | Microbial Mat | VKFYNKGIAAHLEAILKLLDDDHLVFENIQGVGPIDIITVNKKTGKVTYYD |
| Ga0326746_028552_457_579 | 3300034655 | Filtered Seawater | MKYYNKGIAAHLIAMLELLDDDHLIFSNVQGIGPIDIVTVN |
| ⦗Top⦘ |