


| Basic Information | |
|---|---|
| Family ID | F069308 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIRRSPRFF |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.48 % |
| % of genes near scaffold ends (potentially truncated) | 96.77 % |
| % of genes from short scaffolds (< 2000 bps) | 90.32 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.935 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.935 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.581 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13602 | ADH_zinc_N_2 | 19.35 |
| PF00144 | Beta-lactamase | 9.68 |
| PF02567 | PhzC-PhzF | 8.87 |
| PF14437 | MafB19-deam | 2.42 |
| PF00378 | ECH_1 | 2.42 |
| PF02538 | Hydantoinase_B | 1.61 |
| PF13302 | Acetyltransf_3 | 1.61 |
| PF08240 | ADH_N | 1.61 |
| PF06210 | DUF1003 | 0.81 |
| PF01979 | Amidohydro_1 | 0.81 |
| PF00856 | SET | 0.81 |
| PF11860 | Muramidase | 0.81 |
| PF01138 | RNase_PH | 0.81 |
| PF13207 | AAA_17 | 0.81 |
| PF00004 | AAA | 0.81 |
| PF00296 | Bac_luciferase | 0.81 |
| PF07589 | PEP-CTERM | 0.81 |
| PF13751 | DDE_Tnp_1_6 | 0.81 |
| PF01934 | HepT-like | 0.81 |
| PF02738 | MoCoBD_1 | 0.81 |
| PF02416 | TatA_B_E | 0.81 |
| PF02774 | Semialdhyde_dhC | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 9.68 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 9.68 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 9.68 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 8.87 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 3.23 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.81 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.81 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.81 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.81 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.39 % |
| Unclassified | root | N/A | 26.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_119394408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300003219|JGI26341J46601_10126215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300004092|Ga0062389_104109679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300004114|Ga0062593_103547630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 501 | Open in IMG/M |
| 3300005181|Ga0066678_10201773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1270 | Open in IMG/M |
| 3300005347|Ga0070668_100720611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 881 | Open in IMG/M |
| 3300005436|Ga0070713_100126599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2248 | Open in IMG/M |
| 3300005535|Ga0070684_100486038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1143 | Open in IMG/M |
| 3300005540|Ga0066697_10691958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 558 | Open in IMG/M |
| 3300005576|Ga0066708_10617447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 693 | Open in IMG/M |
| 3300005764|Ga0066903_104563853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 738 | Open in IMG/M |
| 3300005764|Ga0066903_105040379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300005764|Ga0066903_106228617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 623 | Open in IMG/M |
| 3300005764|Ga0066903_107780180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 551 | Open in IMG/M |
| 3300005921|Ga0070766_10688637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300006169|Ga0082029_1636313 | Not Available | 597 | Open in IMG/M |
| 3300006176|Ga0070765_100636509 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300006796|Ga0066665_10375055 | Not Available | 1168 | Open in IMG/M |
| 3300009137|Ga0066709_101627234 | Not Available | 922 | Open in IMG/M |
| 3300009137|Ga0066709_103262397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300010046|Ga0126384_11180127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300010361|Ga0126378_10071399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3327 | Open in IMG/M |
| 3300010366|Ga0126379_12152740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300010369|Ga0136643_10831321 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010376|Ga0126381_100977374 | Not Available | 1221 | Open in IMG/M |
| 3300010376|Ga0126381_102234046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300010376|Ga0126381_105085514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300010376|Ga0126381_105125992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300011120|Ga0150983_11255326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300012211|Ga0137377_11371204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300012212|Ga0150985_100076458 | Not Available | 588 | Open in IMG/M |
| 3300012924|Ga0137413_11565019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300012927|Ga0137416_11305091 | Not Available | 656 | Open in IMG/M |
| 3300012977|Ga0134087_10542975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300013297|Ga0157378_12999206 | Not Available | 524 | Open in IMG/M |
| 3300013503|Ga0120127_10172327 | Not Available | 526 | Open in IMG/M |
| 3300015356|Ga0134073_10097147 | Not Available | 866 | Open in IMG/M |
| 3300015373|Ga0132257_101748756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300016270|Ga0182036_10324934 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300016270|Ga0182036_11363427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300016319|Ga0182033_10042005 | All Organisms → cellular organisms → Bacteria | 3027 | Open in IMG/M |
| 3300016319|Ga0182033_12077066 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300016341|Ga0182035_10394041 | Not Available | 1162 | Open in IMG/M |
| 3300016404|Ga0182037_10353806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1197 | Open in IMG/M |
| 3300017973|Ga0187780_10881315 | Not Available | 649 | Open in IMG/M |
| 3300017974|Ga0187777_11421129 | Not Available | 512 | Open in IMG/M |
| 3300018001|Ga0187815_10231439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300018029|Ga0187787_10225389 | Not Available | 673 | Open in IMG/M |
| 3300018088|Ga0187771_10497574 | Not Available | 1031 | Open in IMG/M |
| 3300018090|Ga0187770_10044114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3188 | Open in IMG/M |
| 3300019889|Ga0193743_1158655 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300020579|Ga0210407_11180912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300021171|Ga0210405_10489810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 964 | Open in IMG/M |
| 3300021181|Ga0210388_11401668 | Not Available | 587 | Open in IMG/M |
| 3300021404|Ga0210389_10982209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300021406|Ga0210386_10729892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 853 | Open in IMG/M |
| 3300021407|Ga0210383_10055800 | Not Available | 3294 | Open in IMG/M |
| 3300021559|Ga0210409_10108954 | Not Available | 2550 | Open in IMG/M |
| 3300021559|Ga0210409_10410398 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300022716|Ga0242673_1077382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300022721|Ga0242666_1083460 | Not Available | 719 | Open in IMG/M |
| 3300022756|Ga0222622_10445134 | Not Available | 919 | Open in IMG/M |
| 3300025903|Ga0207680_10664718 | Not Available | 746 | Open in IMG/M |
| 3300025905|Ga0207685_10382930 | Not Available | 717 | Open in IMG/M |
| 3300026021|Ga0208140_1013131 | Not Available | 1196 | Open in IMG/M |
| 3300026508|Ga0257161_1097493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300026523|Ga0209808_1264422 | Not Available | 549 | Open in IMG/M |
| 3300027824|Ga0209040_10532352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300027908|Ga0209006_11031520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300030706|Ga0310039_10304200 | Not Available | 603 | Open in IMG/M |
| 3300031544|Ga0318534_10138776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1401 | Open in IMG/M |
| 3300031546|Ga0318538_10041636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2207 | Open in IMG/M |
| 3300031549|Ga0318571_10113465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300031561|Ga0318528_10568470 | Not Available | 608 | Open in IMG/M |
| 3300031564|Ga0318573_10666818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300031572|Ga0318515_10098993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1527 | Open in IMG/M |
| 3300031572|Ga0318515_10466963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300031668|Ga0318542_10110481 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300031680|Ga0318574_10085053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1731 | Open in IMG/M |
| 3300031681|Ga0318572_10611206 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031681|Ga0318572_10834991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031719|Ga0306917_10029512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3502 | Open in IMG/M |
| 3300031719|Ga0306917_10342169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1161 | Open in IMG/M |
| 3300031736|Ga0318501_10063508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1766 | Open in IMG/M |
| 3300031744|Ga0306918_10320309 | Not Available | 1198 | Open in IMG/M |
| 3300031747|Ga0318502_10106606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1559 | Open in IMG/M |
| 3300031748|Ga0318492_10256974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300031751|Ga0318494_10566235 | Not Available | 664 | Open in IMG/M |
| 3300031754|Ga0307475_10017475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4953 | Open in IMG/M |
| 3300031770|Ga0318521_10147757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1333 | Open in IMG/M |
| 3300031771|Ga0318546_10600417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300031777|Ga0318543_10088231 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300031782|Ga0318552_10289944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
| 3300031782|Ga0318552_10531699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300031794|Ga0318503_10048820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1285 | Open in IMG/M |
| 3300031796|Ga0318576_10184553 | Not Available | 979 | Open in IMG/M |
| 3300031796|Ga0318576_10438650 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031798|Ga0318523_10552039 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300031805|Ga0318497_10692883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300031833|Ga0310917_11010302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300031845|Ga0318511_10621463 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031880|Ga0318544_10430586 | Not Available | 513 | Open in IMG/M |
| 3300031893|Ga0318536_10210762 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300031941|Ga0310912_11137596 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031945|Ga0310913_11080458 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031947|Ga0310909_11044821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300032025|Ga0318507_10169624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300032035|Ga0310911_10075296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1809 | Open in IMG/M |
| 3300032042|Ga0318545_10017000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2277 | Open in IMG/M |
| 3300032052|Ga0318506_10174174 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300032076|Ga0306924_11388844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300032090|Ga0318518_10432743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300032091|Ga0318577_10432426 | Not Available | 628 | Open in IMG/M |
| 3300032091|Ga0318577_10534295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300032094|Ga0318540_10074813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1562 | Open in IMG/M |
| 3300032094|Ga0318540_10600605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300032205|Ga0307472_100317430 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300032261|Ga0306920_100267456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2549 | Open in IMG/M |
| 3300032892|Ga0335081_10204388 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
| 3300032898|Ga0335072_11660347 | Not Available | 535 | Open in IMG/M |
| 3300033134|Ga0335073_11104840 | Not Available | 807 | Open in IMG/M |
| 3300033158|Ga0335077_10785297 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300033158|Ga0335077_10935214 | Not Available | 870 | Open in IMG/M |
| 3300033158|Ga0335077_11088300 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.23% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.81% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010369 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3) | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026021 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1193944081 | 3300002568 | Soil | MAGNLVQGALFTVMVVRAGMLRDPEFQDELAQQIERSPRF |
| JGI26341J46601_101262152 | 3300003219 | Bog Forest Soil | MAGNLVQGAVFTVMVVRAGMLRDAAFEPELAEQIRRSPRFFLNA |
| Ga0062389_1041096791 | 3300004092 | Bog Forest Soil | MAGNLVQGAVFTVMVVRAGLLRDAAFEQDLAEQIRRSPRFF |
| Ga0062593_1035476302 | 3300004114 | Soil | MAAGSLVQGALFTVMVVRAGMLRDPAFAHELGQQVERSPRFFQN |
| Ga0066678_102017731 | 3300005181 | Soil | MAGNLVQGALFTVMVIRAGMLRDAVFEQELTEQIERSPRFF |
| Ga0070668_1007206112 | 3300005347 | Switchgrass Rhizosphere | MAAGTLVQGALFTVMVVRAGMLRDPEFGRELAVQVERSPRFF |
| Ga0070713_1001265991 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGNLVQGALFTVMVVRAGILRDAAFGLELEQQVGRSPRFFL |
| Ga0070684_1004860381 | 3300005535 | Corn Rhizosphere | MAAGTIQGALFTVMVVRAVPLSDPAFEHELARQIERSPRF |
| Ga0066697_106919582 | 3300005540 | Soil | MASNLVQGALFTVMVVRAGLLRDAAFDRELEQQVERS |
| Ga0066708_106174471 | 3300005576 | Soil | MAAGNLVQGALFTVIVVRAGLLRDAEFARELAQQVERSPRFFRNA |
| Ga0066903_1045638532 | 3300005764 | Tropical Forest Soil | VAAGNLLQGALFTVMVVRAGMLRDPAFAPQLATQVERSPR |
| Ga0066903_1050403791 | 3300005764 | Tropical Forest Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQILRSP |
| Ga0066903_1062286171 | 3300005764 | Tropical Forest Soil | MAGNLVQGALFTVMVVRAGMLRDPGFEFELAGQVQRSPRFF |
| Ga0066903_1077801801 | 3300005764 | Tropical Forest Soil | MAAGNLVQGALFTVIVVRAAMLHDSAFAADLAQQIERSPRFFRDAPV |
| Ga0070766_106886372 | 3300005921 | Soil | MAAGNLVQGALFTVMVVRAAMLREPGFADELAQQIK |
| Ga0082029_16363131 | 3300006169 | Termite Nest | MAAGTLVQGALFTVMVVRAGMLRDPEFGRELAVQVE |
| Ga0070765_1006365093 | 3300006176 | Soil | MAGSLVQGAIFTVMVVRAAMLRDPAFAEELAKQVERSPRFFLNAP |
| Ga0066665_103750552 | 3300006796 | Soil | MPGNLVQGAVFTVMVVRAEMLRDPAFEPELAEQVRRS |
| Ga0066709_1016272341 | 3300009137 | Grasslands Soil | MAGNLVQGALFTVMVIRAGMLRDAVFEQELTEQIERSPRF |
| Ga0066709_1032623971 | 3300009137 | Grasslands Soil | MAGNLVQGAVFTVMVVRAGMLRDSDFEAELAEQVRRSPRFFHNAP |
| Ga0126384_111801273 | 3300010046 | Tropical Forest Soil | MAANLVQGAVFTVMVVRAGTLRDPGFEFELAGQVQ |
| Ga0126378_100713991 | 3300010361 | Tropical Forest Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIRLS |
| Ga0126379_121527401 | 3300010366 | Tropical Forest Soil | MAAGNLVQGALFTVMVVRAGLLRDPDFEEELARQIERS |
| Ga0136643_108313212 | 3300010369 | Termite Gut | MAGNLVQGAVFTVMVVRAELLRDPGFEFELAGQIQR |
| Ga0126381_1009773741 | 3300010376 | Tropical Forest Soil | MAGNLVQGAVFTVMVVRAGLLRDPGFDAELAKQVQRSPR |
| Ga0126381_1022340463 | 3300010376 | Tropical Forest Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFEFELAGQVQRSPRFF |
| Ga0126381_1050855141 | 3300010376 | Tropical Forest Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFEFELAGQVQRS |
| Ga0126381_1051259922 | 3300010376 | Tropical Forest Soil | MAANLVQGAVFTVMVVRAGMLRDPGFEFELAGQVQRSPRFFLN |
| Ga0150983_112553262 | 3300011120 | Forest Soil | MAGNLVQGAVFTVMVVRAGMLRDHGFEAELAEQVRRSPRFFHNA |
| Ga0137377_113712041 | 3300012211 | Vadose Zone Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFELELAEQVRRSPRFF |
| Ga0150985_1000764581 | 3300012212 | Avena Fatua Rhizosphere | MATGTLVQGALFTVMVVRAGMLRDPEFGRELALQVERS |
| Ga0137413_115650192 | 3300012924 | Vadose Zone Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFEAELAEQVQRSPRFFLN |
| Ga0137416_113050911 | 3300012927 | Vadose Zone Soil | MAAGNLVQGALFTVMVVRAGMLRDPAFAYELAQQVERSP |
| Ga0134087_105429751 | 3300012977 | Grasslands Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFEAELAEQVRRRPP* |
| Ga0157378_129992061 | 3300013297 | Miscanthus Rhizosphere | MAAGTLVQGALFTVMVVRAGMLRDPEFGRELAVQVERSPRFFRNAPV |
| Ga0120127_101723271 | 3300013503 | Permafrost | MAAGNLVQGALFTVMVVRAAMLRDPAFAHELAQQVE |
| Ga0134073_100971472 | 3300015356 | Grasslands Soil | MAGNLVQGAVFTVMVVRASMLRDPEFQDELSRQIDRSP |
| Ga0132257_1017487561 | 3300015373 | Arabidopsis Rhizosphere | MAGNLVQGAVFTVMVVRAGMLRDPAFESELAPQIERSPRFFLTAPVVLDLRGAAEFVRDE |
| Ga0182036_103249341 | 3300016270 | Soil | MAVSLVQGAVFTVMVVRAGMLRDPAFEAELARQIE |
| Ga0182036_113634271 | 3300016270 | Soil | MAGNLVQGALFTVMVVRAGMLRDPVFELELAQRVQRSPRFF |
| Ga0182033_100420051 | 3300016319 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEQELAEQIRL |
| Ga0182033_120770661 | 3300016319 | Soil | MAGNLVQGAVFTVMVVRAGLLRDPAFEPELARQVQRSPRF |
| Ga0182035_103940411 | 3300016341 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEQELAEQIRLS |
| Ga0182037_103538061 | 3300016404 | Soil | MVGNLVQGAVFTVMVVRAGMLRDPVFETELAEQIR |
| Ga0187780_108813152 | 3300017973 | Tropical Peatland | MAAGNLVQGALFTVMVVRAAMLRDPAFEHELAQQIGRSPRFF |
| Ga0187777_114211291 | 3300017974 | Tropical Peatland | MAAGNLVQGALFTVMVVRAAMLRNPAFTQELTQQIGRSPR |
| Ga0187815_102314391 | 3300018001 | Freshwater Sediment | MAGSLVQGAVFTVMVVRAGMLRDPIFEAELAEQISRSPRFFLN |
| Ga0187787_102253891 | 3300018029 | Tropical Peatland | MAAGNIVQGALFTVMVVRAAMLRDPAFESELARQIARSPR |
| Ga0187771_104975741 | 3300018088 | Tropical Peatland | MAAGNIVQGALFTVMVVRAAMLRDPAFETELAQQI |
| Ga0187770_100441141 | 3300018090 | Tropical Peatland | MAAGNIVQGALFTVMVVRAAMLRDPAFETELAQQIGRSPRFFQNA |
| Ga0193743_11586551 | 3300019889 | Soil | MAAGNLVQGALFTVMVVRAGMLGDPAFAHELGLQVERS |
| Ga0210407_111809121 | 3300020579 | Soil | MAGNLVQGAVFTVMVVRAEMLRDPAFDPELAQQVQ |
| Ga0210405_104898103 | 3300021171 | Soil | MAGNLVQGAVFTVMVVRAEMLRDPAFEAELAVQVQRSPRFFHNAP |
| Ga0210388_114016682 | 3300021181 | Soil | MAAGNIVQGALFTVMVVRAAMLRDSTFETELGQQIERSPRF |
| Ga0210389_109822093 | 3300021404 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFEAELAEKVRRSP |
| Ga0210386_107298921 | 3300021406 | Soil | MAGNLVQGAVFTVMVVRAGLLRDPTFEAELAEQIRRSPRFFLNAPV |
| Ga0210383_100558001 | 3300021407 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFETELAEQVQRS |
| Ga0210409_101089545 | 3300021559 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFEAELAEQVRR |
| Ga0210409_104103983 | 3300021559 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFEAELAEQVH |
| Ga0242673_10773822 | 3300022716 | Soil | MAGNLVQGAVFTVMVVRAGLLRDPAFEAELAEQISRSPRFFF |
| Ga0242666_10834601 | 3300022721 | Soil | MAGNLVQGAVFTVMVVRAGLLRDPAFEAELAEQISRSPRFF |
| Ga0222622_104451341 | 3300022756 | Groundwater Sediment | MAGNLVQGALFTVMVVRAGMLRDAAFEEELHQQVGRSPRFFL |
| Ga0207680_106647182 | 3300025903 | Switchgrass Rhizosphere | MAAGSLVQGALFTVMVVRAGMLRDPAFAYELGQQVERSPRF |
| Ga0207685_103829301 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGNLVQGALFTVMVVRAGMLRDTAFEEELQQQVGR |
| Ga0208140_10131311 | 3300026021 | Rice Paddy Soil | MAAGNLVQGALFTVMVVRAGLLHDAAFARELAQQV |
| Ga0257161_10974931 | 3300026508 | Soil | MVGNLVQGAVFTVMVVRAEMLRDPAFDPELAQQVQRSPRFFLN |
| Ga0209808_12644221 | 3300026523 | Soil | MASNLVQGALFTVMVVRAGLLRDAAFDRELEQQVERSPRFF |
| Ga0209040_105323521 | 3300027824 | Bog Forest Soil | MAGSLVQGAVFTVMVVRAEMLRDPAFEAELAEQIRRSPRFFLNAPV |
| Ga0209006_110315202 | 3300027908 | Forest Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFEAELAEQVHRSPRFFHNAPV |
| Ga0310039_103042001 | 3300030706 | Peatlands Soil | MAAGNLVQGALFTVMVVRAAMLRDSDFEHELAQQI |
| Ga0318534_101387761 | 3300031544 | Soil | MAGSLVQGAVFTVMVVRAGMLRDPGFEFELAGQVQRSPRFFLNAPVVLD |
| Ga0318538_100416366 | 3300031546 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEPELAEQIRRSPRFFLNAP |
| Ga0318571_101134651 | 3300031549 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEPELAEQIR |
| Ga0318528_105684701 | 3300031561 | Soil | MTGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIQRSPRFFLN |
| Ga0318573_106668182 | 3300031564 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPSFEFELAQQVQRSPRFFLNAPVVL |
| Ga0318515_100989931 | 3300031572 | Soil | MVGNLVQGAVFTVMVVRAGMLRDPVFETELAEQIRLSPRFFLN |
| Ga0318515_104669632 | 3300031572 | Soil | MAGNLVQGAVFTVMVVRAENLREPAFEPELAQQVQRSPR |
| Ga0318542_101104814 | 3300031668 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPSFEFELAQQVQRSPRFFLNAPV |
| Ga0318574_100850531 | 3300031680 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFESELADQAQ |
| Ga0318572_106112062 | 3300031681 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIRLSPRFFLNAPV |
| Ga0318572_108349911 | 3300031681 | Soil | MAGNLVQGAVFTVMVVRAGLLRDPTFEQNLAEQIQRSPRF |
| Ga0306917_100295121 | 3300031719 | Soil | MAASLVQGAVFTVMVVRAGMLRDPAFEAELARQIERSP |
| Ga0306917_103421693 | 3300031719 | Soil | MAGNLVQGALFTVMVVRAGMLRDPVFELELAQQVQRSPRFFLNA |
| Ga0318501_100635081 | 3300031736 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEPELAEQIRRSPR |
| Ga0306918_103203092 | 3300031744 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQILRSPR |
| Ga0318502_101066061 | 3300031747 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEPELAEQIRRSPRFFLNAPVV |
| Ga0318492_102569742 | 3300031748 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEPELAEQIRRSP |
| Ga0318494_105662352 | 3300031751 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIRL |
| Ga0307475_100174751 | 3300031754 | Hardwood Forest Soil | MAGNLVQGAVFTVMVVRAEMLRDPAFEAELAVQVQR |
| Ga0318521_101477572 | 3300031770 | Soil | MAGNLVQGAVFTVIVVRAGMLRDPAFEFELAEQIRRSPRFFLNAPVV |
| Ga0318546_106004172 | 3300031771 | Soil | MAGNLVQGALFTVMVVGAGGLRDPAFEFQLGEQVRRSPR |
| Ga0318543_100882314 | 3300031777 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIRLSPRF |
| Ga0318552_102899442 | 3300031782 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPDFDSQLAEQVRRSPRFFLNAPV |
| Ga0318552_105316992 | 3300031782 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEPELAEQIRRSPRFFLNAPV |
| Ga0318503_100488201 | 3300031794 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFESELAEQIRRSPRFFLNAPVV |
| Ga0318576_101845531 | 3300031796 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEPELAEQIRR |
| Ga0318576_104386502 | 3300031796 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIR |
| Ga0318523_105520391 | 3300031798 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIRRSPRFFLNAPVVL |
| Ga0318497_106928831 | 3300031805 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEPELAEQIRRSPRFFLNA |
| Ga0310917_110103021 | 3300031833 | Soil | MAGNLVQGAVFTVMVVRAGLLRDPAFEPELARQVQRSP |
| Ga0318511_106214632 | 3300031845 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFESELAEQIRRSPRFFLNAPVVL |
| Ga0318544_104305862 | 3300031880 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIQR |
| Ga0318536_102107621 | 3300031893 | Soil | MAGNLVQGAVFTVMVVRAENLREPTFEPELAQQVRR |
| Ga0310912_111375961 | 3300031941 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIRRSPR |
| Ga0310913_110804581 | 3300031945 | Soil | MAAGNIVQGALFTVMVVRATMLRDPAFENELAQQIGRSPR |
| Ga0310909_110448212 | 3300031947 | Soil | MAGNLVQGAVFTVMVVRAGLLRDPTFEQNLAEQIQRSPRFFLN |
| Ga0318507_101696242 | 3300032025 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPDFDSQLAEQVRRSPRFFLNAPDCPPSENRHR |
| Ga0310911_100752963 | 3300032035 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPVFETELAEQIRLSPRFFLNAPVVLD |
| Ga0318545_100170001 | 3300032042 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEPELAEQIRRS |
| Ga0318506_101741742 | 3300032052 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPDFDSQLAEQVRRSPRFFLN |
| Ga0306924_113888443 | 3300032076 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPGFEAELAEQVQ |
| Ga0318518_104327432 | 3300032090 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQILRSPRFFLNAPV |
| Ga0318577_104324262 | 3300032091 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPVFETELAEQIRLSPRFFLN |
| Ga0318577_105342952 | 3300032091 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPSFEFELAQQVQRSPRFFLN |
| Ga0318540_100748133 | 3300032094 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIRLSPRWCST |
| Ga0318540_106006051 | 3300032094 | Soil | MAGNLVQGALFTVMVVRAGMLRDPVFELELAQQVQR |
| Ga0307472_1003174303 | 3300032205 | Hardwood Forest Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEQELAEQIQRSP |
| Ga0306920_1002674564 | 3300032261 | Soil | MAGNLVQGAVFTVMVVRAGMLRDPAFEHELAEQIRRSPRFF |
| Ga0335081_102043884 | 3300032892 | Soil | MAAGNLVQGALFTVMVVRATMLRDPEFEHELARQIGRSPRFFQ |
| Ga0335072_116603472 | 3300032898 | Soil | MAAGNLVQGALFTVMVVRAAALREPAFEAELGQQIGRSPRF |
| Ga0335073_111048401 | 3300033134 | Soil | MASNLVQGAVFTVMVVRAGMLRDPVFEAQLAEQIGRSPRF |
| Ga0335077_107852971 | 3300033158 | Soil | MAAGNLVQGALFTVMVVRATMLRDPEFEHELARQIGRSP |
| Ga0335077_109352142 | 3300033158 | Soil | MATGTLVQGALFTVMVVRAGMLRDPSFEHELARQVERSPRFFR |
| Ga0335077_110883002 | 3300033158 | Soil | MAGGLVQGALFTVMVVRAAMLRDAAFAYELAQQVERSPRFFLHAP |
| ⦗Top⦘ |