


| Basic Information | |
|---|---|
| Family ID | F069299 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 45.16 % |
| % of genes near scaffold ends (potentially truncated) | 48.39 % |
| % of genes from short scaffolds (< 2000 bps) | 87.10 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.161 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.613 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.290 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.032 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 14.71% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 14.52 |
| PF16868 | NMT1_3 | 8.87 |
| PF00355 | Rieske | 4.03 |
| PF07681 | DoxX | 2.42 |
| PF13620 | CarboxypepD_reg | 1.61 |
| PF09084 | NMT1 | 0.81 |
| PF01970 | TctA | 0.81 |
| PF07331 | TctB | 0.81 |
| PF13442 | Cytochrome_CBB3 | 0.81 |
| PF00005 | ABC_tran | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 14.52 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 2.42 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 2.42 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.81 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.81 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.16 % |
| Unclassified | root | N/A | 4.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10019857 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10084775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300002906|JGI25614J43888_10097358 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300002917|JGI25616J43925_10271320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300004268|Ga0066398_10119944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300004633|Ga0066395_10025703 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300004633|Ga0066395_10179058 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300005163|Ga0066823_10033733 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005164|Ga0066815_10076815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300005332|Ga0066388_102678895 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005332|Ga0066388_102850565 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005332|Ga0066388_103122511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 846 | Open in IMG/M |
| 3300005332|Ga0066388_103177687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
| 3300005332|Ga0066388_103566560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 794 | Open in IMG/M |
| 3300005332|Ga0066388_104678449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300005363|Ga0008090_10114455 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300005363|Ga0008090_10175713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300005363|Ga0008090_10192612 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005363|Ga0008090_10265656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300005363|Ga0008090_15813601 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300005467|Ga0070706_100949749 | Not Available | 793 | Open in IMG/M |
| 3300005467|Ga0070706_101105531 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005540|Ga0066697_10561477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300005713|Ga0066905_101768335 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005713|Ga0066905_101979568 | Not Available | 540 | Open in IMG/M |
| 3300005713|Ga0066905_102084196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300005713|Ga0066905_102170764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300005764|Ga0066903_102209559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1061 | Open in IMG/M |
| 3300005764|Ga0066903_103173503 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300005764|Ga0066903_103327329 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300005764|Ga0066903_104331945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300006172|Ga0075018_10022203 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
| 3300006175|Ga0070712_100043247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3100 | Open in IMG/M |
| 3300006604|Ga0074060_10017430 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300006845|Ga0075421_101220044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300006845|Ga0075421_102405687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300009012|Ga0066710_101656176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300009038|Ga0099829_10013676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5360 | Open in IMG/M |
| 3300009088|Ga0099830_10146609 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300009089|Ga0099828_10185582 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300009137|Ga0066709_102029836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300009147|Ga0114129_12380932 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300009792|Ga0126374_10979034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300009792|Ga0126374_11495024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300010043|Ga0126380_11695184 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010047|Ga0126382_10448744 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300010048|Ga0126373_10411305 | Not Available | 1379 | Open in IMG/M |
| 3300010048|Ga0126373_10778312 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300010303|Ga0134082_10302128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300010359|Ga0126376_11207450 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300010362|Ga0126377_11194500 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300010366|Ga0126379_11453225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300010376|Ga0126381_103862699 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300010398|Ga0126383_10877190 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300010398|Ga0126383_12926683 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010398|Ga0126383_13166175 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300011106|Ga0151489_1706313 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012199|Ga0137383_10017445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4929 | Open in IMG/M |
| 3300012200|Ga0137382_10057312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 2454 | Open in IMG/M |
| 3300012201|Ga0137365_10010919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 7175 | Open in IMG/M |
| 3300012211|Ga0137377_10218672 | Not Available | 1830 | Open in IMG/M |
| 3300012350|Ga0137372_10786111 | Not Available | 683 | Open in IMG/M |
| 3300012361|Ga0137360_11076330 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012923|Ga0137359_10435956 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300012948|Ga0126375_10859025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300012948|Ga0126375_11311315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300012971|Ga0126369_10598049 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300012984|Ga0164309_10081746 | Not Available | 1982 | Open in IMG/M |
| 3300012985|Ga0164308_12074271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300016357|Ga0182032_11617380 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300016387|Ga0182040_10479680 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300018433|Ga0066667_10353364 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300018468|Ga0066662_10005406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6270 | Open in IMG/M |
| 3300018468|Ga0066662_10076038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2273 | Open in IMG/M |
| 3300020581|Ga0210399_11199146 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021372|Ga0213877_10022062 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300021439|Ga0213879_10017226 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300025928|Ga0207700_10735959 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300026301|Ga0209238_1118027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300026312|Ga0209153_1256774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300026532|Ga0209160_1165511 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300026538|Ga0209056_10253037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300027576|Ga0209003_1008590 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300027846|Ga0209180_10076829 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300027874|Ga0209465_10021346 | All Organisms → cellular organisms → Bacteria | 2986 | Open in IMG/M |
| 3300027875|Ga0209283_10257097 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300027882|Ga0209590_10041461 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
| 3300031543|Ga0318516_10005124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5922 | Open in IMG/M |
| 3300031543|Ga0318516_10069326 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
| 3300031543|Ga0318516_10073682 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300031543|Ga0318516_10085394 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300031543|Ga0318516_10170445 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300031543|Ga0318516_10234292 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300031544|Ga0318534_10187006 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300031544|Ga0318534_10653612 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031549|Ga0318571_10031101 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300031561|Ga0318528_10575009 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031572|Ga0318515_10040544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2310 | Open in IMG/M |
| 3300031572|Ga0318515_10754111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300031680|Ga0318574_10694097 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031713|Ga0318496_10020545 | All Organisms → cellular organisms → Bacteria | 3259 | Open in IMG/M |
| 3300031723|Ga0318493_10050523 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300031723|Ga0318493_10363936 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300031724|Ga0318500_10548281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300031736|Ga0318501_10167818 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300031744|Ga0306918_10441204 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300031748|Ga0318492_10439510 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031764|Ga0318535_10400516 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031769|Ga0318526_10209101 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300031777|Ga0318543_10072243 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300031792|Ga0318529_10346597 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031795|Ga0318557_10178831 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300031797|Ga0318550_10024178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2556 | Open in IMG/M |
| 3300031820|Ga0307473_10977294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031832|Ga0318499_10066617 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300031832|Ga0318499_10306624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300031879|Ga0306919_11157315 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031890|Ga0306925_10705436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1055 | Open in IMG/M |
| 3300032025|Ga0318507_10247290 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300032067|Ga0318524_10464869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300032174|Ga0307470_10192144 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300033289|Ga0310914_10271223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1527 | Open in IMG/M |
| 3300033289|Ga0310914_10913050 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300033290|Ga0318519_10025975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 2697 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.03% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100198572 | 3300000597 | Forest Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARAKHWSRRRPH* |
| AF_2010_repII_A1DRAFT_100847752 | 3300000597 | Forest Soil | MVSALFKESGEIAPVDLGQFGNRAGEIIARATHWSRRRPH* |
| JGI25614J43888_100973582 | 3300002906 | Grasslands Soil | MVSALFEESGEIAAVDLGLFGKRAGEIIARATRLPRRRPH* |
| JGI25616J43925_102713201 | 3300002917 | Grasslands Soil | MVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH* |
| Ga0066398_101199442 | 3300004268 | Tropical Forest Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPTRRPH* |
| Ga0066395_100257032 | 3300004633 | Tropical Forest Soil | MVSALFEERGEIAGVDLGQFGKRAGEIIARGTHWSRRRPH* |
| Ga0066395_101790582 | 3300004633 | Tropical Forest Soil | MVSALFEESGEIAPVDLGLFGKRAGEIIAHATRLPRRRPH* |
| Ga0066823_100337332 | 3300005163 | Soil | MVSALFEESGEIAAVDLGQFGKRAGEIIARATRLRRRRPH* |
| Ga0066815_100768152 | 3300005164 | Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH* |
| Ga0066388_1026788952 | 3300005332 | Tropical Forest Soil | MMVSALFEESGEIAPIDLGQFGKRAGEIIARARQLPRRRPH* |
| Ga0066388_1028505652 | 3300005332 | Tropical Forest Soil | MVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPTRRPH* |
| Ga0066388_1031225112 | 3300005332 | Tropical Forest Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIAGATRRPRRRPH* |
| Ga0066388_1031776872 | 3300005332 | Tropical Forest Soil | MMVSALFEESGEIAPVDIGRFGKRAGEIIARATRLPRRRPH* |
| Ga0066388_1035665602 | 3300005332 | Tropical Forest Soil | MVSALFKENGEIAPVDLGQFGKRAGEIIARATHWSRRRPH* |
| Ga0066388_1046784491 | 3300005332 | Tropical Forest Soil | MMVSALFEESGEIAPVDLGQFGKRAGEIIARATYPSRRRPH* |
| Ga0008090_101144552 | 3300005363 | Tropical Rainforest Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIACATRLPRHRPH* |
| Ga0008090_101757131 | 3300005363 | Tropical Rainforest Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARATHWSRRRPH* |
| Ga0008090_101926122 | 3300005363 | Tropical Rainforest Soil | RWSLSDHKPMVSALFKESGEIAPVDLGQFGKRAGEIIARATHWSRRRPH* |
| Ga0008090_102656561 | 3300005363 | Tropical Rainforest Soil | MVSALFKESGEIAPVDLGQFGKRAGEIIARATHWSRRRPH* |
| Ga0008090_158136012 | 3300005363 | Tropical Rainforest Soil | MVSALFEESGGIAPVDLGQFGKRAGEIIARATRLPRRRPH* |
| Ga0070706_1009497492 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSALFEESGEIAAVDLGLFGKRAGEIIAHATRLPRRRPH* |
| Ga0070706_1011055311 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSALFEESGEIAPVDLGQFGKRAGEIIARATYLPRRRPH* |
| Ga0066697_105614771 | 3300005540 | Soil | MVSALFEESGEIAAVDLGLFGKRAGEIIARATRLPRR |
| Ga0066905_1017683352 | 3300005713 | Tropical Forest Soil | DPKMMVSALFEESGEIAPVDIGRFGKRAGEIIARATQLPRRRPH* |
| Ga0066905_1019795681 | 3300005713 | Tropical Forest Soil | MMVSALFAESGEIAPVDLGRFGKRAGEIIARATQL |
| Ga0066905_1020841962 | 3300005713 | Tropical Forest Soil | MMVSALFEQSGEIAPVDIGRFGKRAGEIIARATQLPRRRPH* |
| Ga0066905_1021707642 | 3300005713 | Tropical Forest Soil | LFAESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY* |
| Ga0066903_1022095592 | 3300005764 | Tropical Forest Soil | LFEQSGEIAPVDFRRFGTRAGEIIARAASLPRRKAL* |
| Ga0066903_1031735032 | 3300005764 | Tropical Forest Soil | RWSISDPKLMVSALFEESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY* |
| Ga0066903_1033273292 | 3300005764 | Tropical Forest Soil | MMMSALFEESGGIAPIDIGQFGKRAGEIIARATQLPRRRPH* |
| Ga0066903_1043319452 | 3300005764 | Tropical Forest Soil | MVSALFEESGEIAPVDFGQFGKRAGEIIARATHWSRRRPH* |
| Ga0075018_100222034 | 3300006172 | Watersheds | MVSALFEESGEIAPVDLGLFGKRAGEIIARATRLPRRRPH* |
| Ga0070712_1000432474 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SDTKPMVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH* |
| Ga0074060_100174302 | 3300006604 | Soil | MVSALFEESGEIAAVDLGLFGRRAGEIIAHATRLPRRRPH* |
| Ga0075421_1012200442 | 3300006845 | Populus Rhizosphere | DERSKSDPKHVISALFEESGEVAAVDFRQFGKRAGEIIADATRLPHRKPH* |
| Ga0075421_1024056872 | 3300006845 | Populus Rhizosphere | MVSALFEESGEIAPVDLGQFGKRAGEIIARATHLPRRRPH* |
| Ga0066710_1016561762 | 3300009012 | Grasslands Soil | DRDERSKSDPKHVISALFEESGEVAPVDFRRFGTRAGEIIARATRLPYRRAH |
| Ga0099829_100136765 | 3300009038 | Vadose Zone Soil | MVSVLFEESGEIAAVDLGQFGKRAGEIIAHATRLPRRRPH* |
| Ga0099830_101466092 | 3300009088 | Vadose Zone Soil | SLSDANPMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH* |
| Ga0099828_101855823 | 3300009089 | Vadose Zone Soil | MVSALFEESGEIAAVDLGQFGKRAGDIIARATRLPRRRPH* |
| Ga0066709_1020298362 | 3300009137 | Grasslands Soil | NESGEVAPVDFSQFGKRTGEIIARATRQPRRKPH* |
| Ga0114129_123809322 | 3300009147 | Populus Rhizosphere | SLSDAKPMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRSH* |
| Ga0126374_109790342 | 3300009792 | Tropical Forest Soil | LDRKLMVSALFEESGEIAAVDLGQFGKRAGEIIARGTHWSRRRPH* |
| Ga0126374_114950242 | 3300009792 | Tropical Forest Soil | FEESGEIAPVDFGQFGKRAGEIIACATRLPRRRPH* |
| Ga0126380_116951841 | 3300010043 | Tropical Forest Soil | KLMVSALFEESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY* |
| Ga0126382_104487442 | 3300010047 | Tropical Forest Soil | MVSALFEESGQIAPVDLGQFGKRAGEIIARATRLPRRRPH* |
| Ga0126373_104113052 | 3300010048 | Tropical Forest Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIACATRLPRRRPH* |
| Ga0126373_107783122 | 3300010048 | Tropical Forest Soil | LDRKLMVSALFEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH* |
| Ga0134082_103021282 | 3300010303 | Grasslands Soil | NESGEVAPVDFSQFGKRTGEIIARATRLPRRKPH* |
| Ga0126376_112074502 | 3300010359 | Tropical Forest Soil | IVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH* |
| Ga0126377_111945002 | 3300010362 | Tropical Forest Soil | MMVSALFEESGEIAPVDIGRFGKRAGEIIARATQLPRRRPH* |
| Ga0126379_114532251 | 3300010366 | Tropical Forest Soil | IAALFEQSGEIAPVDFRRFGMRAGEIIARAASLPRRKAL* |
| Ga0126381_1038626992 | 3300010376 | Tropical Forest Soil | SDPKLIVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH* |
| Ga0126383_108771902 | 3300010398 | Tropical Forest Soil | MVSALFKENGEIAPVDLGQFGKRAGEIIARATHWSRRRP |
| Ga0126383_129266832 | 3300010398 | Tropical Forest Soil | VSALFEESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY* |
| Ga0126383_131661752 | 3300010398 | Tropical Forest Soil | LMVSALFEESGEIAPIDIGQFGKRAGEIIARARRLPRRRPH* |
| Ga0151489_17063131 | 3300011106 | Soil | LFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH* |
| Ga0137383_100174454 | 3300012199 | Vadose Zone Soil | MVSALFEDSGEIAPVDLGQFGKRAGEIIARATYPQRRRPH* |
| Ga0137382_100573121 | 3300012200 | Vadose Zone Soil | ERWSLSDAKPMVSALFEESGEIAAVDLGLFGKRAGEIIARATRLPRRRPH* |
| Ga0137365_100109195 | 3300012201 | Vadose Zone Soil | MVSALFEESGEIASVDLGQFGKRAGEIIARATYPQRRRPH* |
| Ga0137377_102186722 | 3300012211 | Vadose Zone Soil | MVSALFEESGGIAAGDLGLVGKRAGEIIPPATRLPRRRPH* |
| Ga0137372_107861112 | 3300012350 | Vadose Zone Soil | MVSALFEDSGEIASVDLGQFGKRAGEIIARATYPQRRRPH* |
| Ga0137360_110763301 | 3300012361 | Vadose Zone Soil | MVSALFEESGDIAPVDLGQFGKRAGAIIARATYPQRRRAH* |
| Ga0137359_104359562 | 3300012923 | Vadose Zone Soil | SDANPMVSALFEESGEIAAVDLGQFGKRAGEIIARATQLPRRRPH* |
| Ga0126375_108590252 | 3300012948 | Tropical Forest Soil | MMVSALFAESGEIAPVDLGRFGKRAGEIIARATQLPRRRPY* |
| Ga0126375_113113152 | 3300012948 | Tropical Forest Soil | MVSALFEESGQIAPVDLGQFGKRAGEIIARARHLPRRRPH* |
| Ga0126369_105980492 | 3300012971 | Tropical Forest Soil | LDRKLMVSALFEERGEIAGVDLGQFGKRAGEIIARGTHWSRRRPH* |
| Ga0164309_100817461 | 3300012984 | Soil | ALFEQSGEIAPVDFRRFGMRAGEIIARGAQLPRRKSL* |
| Ga0164308_120742711 | 3300012985 | Soil | PQPVIAALFEQSGEIAPVDFRRFGMRAGEIIARGAQLPRRKPL* |
| Ga0182032_116173801 | 3300016357 | Soil | PKLIVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH |
| Ga0182040_104796801 | 3300016387 | Soil | RWSLSDPKLMVSALFEESGEIAPVDLGQFGKRAGEIIARATHLPRRRPH |
| Ga0066667_103533642 | 3300018433 | Grasslands Soil | MVSALFEESGEIPAVDLGLFGKRAGEIIARATRLPRRRPH |
| Ga0066662_100054066 | 3300018468 | Grasslands Soil | MVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH |
| Ga0066662_100760383 | 3300018468 | Grasslands Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARATYPQRRRAH |
| Ga0210399_111991461 | 3300020581 | Soil | KPMVSALFEESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH |
| Ga0213877_100220622 | 3300021372 | Bulk Soil | MVSALFAESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH |
| Ga0213879_100172261 | 3300021439 | Bulk Soil | MVSALFAESGEIAAVDLGQFGKRAGEIIARATRLP |
| Ga0207700_107359592 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSALFEESGEIAAVDLGLFGKRAGEIIARATRLPRRRPH |
| Ga0209238_11180272 | 3300026301 | Grasslands Soil | RDERSKSDPKHVISALFEESGEVAPVDFRRFGTRAGEIIARATRLPYRRAH |
| Ga0209153_12567741 | 3300026312 | Soil | DRKHVITALFAQSGEIAPVDFRRFGTRAGEIIARAATLPRRKAL |
| Ga0209160_11655112 | 3300026532 | Soil | ALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH |
| Ga0209056_102530371 | 3300026538 | Soil | QWSSSDHKDAVTALFNESGEVAPVDFSQFGKRTGEIIARATRLPRRKPH |
| Ga0209003_10085902 | 3300027576 | Forest Soil | QWSLSDAKPMVSALFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH |
| Ga0209180_100768293 | 3300027846 | Vadose Zone Soil | MVSVLFEESGEIAAVDLGQFGKRAGEIIARATRLPRRRPH |
| Ga0209465_100213462 | 3300027874 | Tropical Forest Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH |
| Ga0209283_102570971 | 3300027875 | Vadose Zone Soil | MVSALFEESGEIAAVDLGQFGKRAGDIIARATRLPRRRPH |
| Ga0209590_100414612 | 3300027882 | Vadose Zone Soil | MVSVLFEESGEIAAVDLGQFGKRAGEIIAHATRLPRRRPH |
| Ga0318516_100051245 | 3300031543 | Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARATHLPRRRPH |
| Ga0318516_100693262 | 3300031543 | Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIACATRLPRRRPH |
| Ga0318516_100736822 | 3300031543 | Soil | MVSALFAESGEIAPVDLGQFGKRAGEIIARATRPPRRRPH |
| Ga0318516_100853942 | 3300031543 | Soil | MVSALFEESGEIAAVDFGQFGKRAGEIIARATQLPRRRPH |
| Ga0318516_101704451 | 3300031543 | Soil | MVSALFKESGEIAPVDLGQFGKRAGEIIARATHWSCRRPH |
| Ga0318516_102342922 | 3300031543 | Soil | MVSALFKESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH |
| Ga0318534_101870062 | 3300031544 | Soil | MVSALFAESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH |
| Ga0318534_106536122 | 3300031544 | Soil | ALFEESGEIAPVDFGQFGKRAGEIIARATYLPRPRRRPH |
| Ga0318571_100311012 | 3300031549 | Soil | FKESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH |
| Ga0318528_105750092 | 3300031561 | Soil | RWSLSDPKLIVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH |
| Ga0318515_100405442 | 3300031572 | Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARATHPPRRRPH |
| Ga0318515_107541112 | 3300031572 | Soil | MVSALFAESGEIAPVDLGQFGKRAGEIIARATRPPRR |
| Ga0318574_106940971 | 3300031680 | Soil | LMVSALFAESGEIAPVDLGQFGKRAGEIIARATRPPRRRPH |
| Ga0318496_100205452 | 3300031713 | Soil | MVSALFAESGEIAPVDLGQFGNRAGEIIARATRPPRRRPH |
| Ga0318493_100505231 | 3300031723 | Soil | EESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH |
| Ga0318493_103639361 | 3300031723 | Soil | DLWSLSDRKLMVSALFEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH |
| Ga0318500_105482812 | 3300031724 | Soil | FEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRPH |
| Ga0318501_101678182 | 3300031736 | Soil | MVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH |
| Ga0306918_104412042 | 3300031744 | Soil | ERWSLSDPKLMVSALFEESGEIAPVDLGQFGKRAGEIIARATHLPRRRPH |
| Ga0318492_104395102 | 3300031748 | Soil | WSLSDAKPMVSALFEESGEIAAVDFGQFGKRAGEIIARATQLPRRRPH |
| Ga0318535_104005162 | 3300031764 | Soil | LMVSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH |
| Ga0318526_102091012 | 3300031769 | Soil | LIVSALFEESGEIAPVDFGQFGKRAGEIIARATYLPRPRRRPH |
| Ga0318543_100722431 | 3300031777 | Soil | MVSALFEESGEIAPVDLGQYGKRAGEIIARGTHWSRRRPH |
| Ga0318529_103465972 | 3300031792 | Soil | VSALFEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH |
| Ga0318557_101788311 | 3300031795 | Soil | RWSLSDHKLMVSALFAESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH |
| Ga0318550_100241781 | 3300031797 | Soil | VSALFEENGEIAPVDLGQFGKRAGEIIAGATRLPRRRPH |
| Ga0307473_109772942 | 3300031820 | Hardwood Forest Soil | MVSALFEESGEIAAVDLGLFGKRAGEIIAHATRLPRRRPN |
| Ga0318499_100666171 | 3300031832 | Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARGSALT |
| Ga0318499_103066242 | 3300031832 | Soil | MVSALFEENGEIAPVDLGQFGKRAGEIIAGATRLPRRRPH |
| Ga0306919_111573152 | 3300031879 | Soil | FEESGEIAPVDFGQFGKRAGEIIARATYPPRPRRRPH |
| Ga0306925_107054361 | 3300031890 | Soil | MVSALFEESGEIAPVDLGQFGKRAGEIIARGTHWSRRRP |
| Ga0318507_102472902 | 3300032025 | Soil | LFAESGEIAPVDLGQFGKRAGEIIARATRLPRRRPH |
| Ga0318524_104648692 | 3300032067 | Soil | LSDHKLMVSALFKESGEIAPVDLGQFGKRAGEIIARATHWSCRGPH |
| Ga0307470_101921442 | 3300032174 | Hardwood Forest Soil | MVSALFEESGEIAAVDLGLFGKRAGEIIARATYLPRRRPH |
| Ga0310914_102712231 | 3300033289 | Soil | ERWSLSDPKLMVSALFEESGEIAPVDLGQFGKRAGEIIARATHPPRRRPH |
| Ga0310914_109130502 | 3300033289 | Soil | KLMVSALFEESGEIAPVDLGQFGKRAGEIIACATRMPRRRPH |
| Ga0318519_100259752 | 3300033290 | Soil | MVSVLFEESGEIAPVDLGQFGKRAGEIIARATHPPRRRPH |
| ⦗Top⦘ |